5EFUA

Resting state of rat cysteine dioxygenase h155q variant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
b'TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLQLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Resting state of rat cysteine dioxygenase H155Q variant
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5efuA00
4IERA 5FDBA 3SXWA 4E2GA 4E2SA 1XE7A 2MHFA 3TNQA 2EAAA 4WBBA 3H50A 3I54A 3H1YA 2HKXA 1UIJA 2H6CA 4JV4A 5E16A 1ZZ8A 5LEKA 5EFUA 4XF4A 4AQ6A 1VP6A 4Q0SA 2UY9A 3ELNA 5I91A 1CAXB 5CU1A 4FT8A 4RD7A 2VQAA 2QVSB 1CAUB 4KU7A 1SQ4A 3KCCA 3SCFA 3BPZA 4EWDA 2GH2A 4R8HA 4QGMA 4HVQA 4BYYA 2QCSB 3WW2A 2MNGA 4H7LA 4XF0A 3U11A 1EP0A 2XL9A 4YRDA 3FWEA 1NXMA 4ZU4A 3PNAA 4MX3A 3MZHA 5J48A 4AVAA 2BEOA 4YARA 3ZDSA 3FE5A 1CAUA 2QJVA 3HQXA 3BB6A 3LZZA 2CAUA 4IESA 4MUVA 1VJ2A 5FPXA 4AVBA 1UPIA 1V70A 2Z2SB 3SCGA 4Z07A 2IXKA 1ZRRA 1L3JA 3LAGA 3D0JA 3IBMA 3RPQA 3C3VA 4Q0VA 2IXLA 1UD1A 5KHHA 2XL7A 3DL3A 5T3NA 4WZCA 3L2HA 4META 3R6SA 1QWRA 4TLFA 4I09A 4D7TA 5FPZA 5I0TA 4EROA 5I0SA 1Y9QA 4UBGA 1ZNPA 3D82A 2GC0A 1UIKA 2QDRA 3OD0A 2B9UA 1CAWA 3HIFA 3EJKA 4PIXA 4I0AA 1ZRFA 3HT2A 1YWKA 3GYDA 4K8FA 5JR7B 2D40A 4LLOA 3OGJA 4QMAA 4BIFA 3N4MA 2WC2A 4D7SA 2N7GA 1SFNA 1PMIA 2BNOA 4HVRA 5I0RA 3E6CC 1QXRA 3CF6E 3ES1A 4QXKA 1ZRCA 3USSA 3OF1A 2GC3A 3NJZA 4MGIE 4IEVA 2IXCA 4R52A 4QGNA 4I0BA 3E97A 3G7DA 4FAHA 2DCTA 1XE8A 3IIAA 1EY2A 1WGPA 5KHKA 4IETA 2UY8A 2KXLA 1LB2A 5JAXA 4EV0A 4XFCA 2F4PA 1O5LA 4LA2A 5EZWA 4MGKE 1CAVA 2D93A 5I8SA 4NVPA 1NYWA 1RGSA 3S7IA 5FLHA 2C0ZA 5LRSA 5KHJA 1FT9A 4A2UA 1O3QA 1Q43A 3DN7A 3M70A 3UKVA 3ST7A 3E5UA 4E2QA 4L11A 2PHDA 4ONUA 5JSRA 2BNMA 1LR5A 3ETQA 1IPKA 4HN0A 5C8WA 5KHIA 1CX4A 5KBFA 2GC1A 1DZRA 3SMHA 4O9GA 4X6RB 4XETA 4IEXA 3EO6A 4PIYA 2P17A 1J59A 1WLTA 4AXOA 4B29A 4EWEA 1NE6A 5BUVA 2BGCA 2Q30A 1YLLA 1Q3EA 1YHFA 4LULA 2ET7A 3FZ3A 4Q0PA 4HVOA 4JVAA 2Q1ZB 2ET1A 4GULA 4IEWA 1IPJA 4JTNA 3LA2A 1WA4A 4IEQA 3ES4A 1J3RA 1NZCA 3EBRA 3OCPA 1O4TA 1XRUA 4HMZA 2FMYA 4HN1A 1RC6A 4DINB 1CAXA 4PIZA 3QOPA 5C6CA 3PVBB 4MGYE 2XLAA 2PTMA 1U12A 1UW8A 2GC2A 4XFHA 4JTOA 3RZZA 3VHRA 1YFYA 3U10A 2H6BA 4MGZE 4LA3A 3H9AA 3HT1A 4MH0E 4XF1A 2GU9A 3EQEA 1X7NA 3ACLA 4BH9A 2XKPA 3ROUA 3E6BA 4IEOA 4QM9A 2Z69A 1FXZA 1Y3TA 3NKTA 4XFIA 5KHGA 4KL1A 4KWKA 1ZVFA 4ORFA 5I0UA 4XFFA 1ZZ7A 3RYPA 4I3PA 4XFGA 4F8AA 2PQQA 4IEUA 5K8SA 3BU7A 3WW1A 2OZ6A 4HSLA 4X6QB 5CADA 4XEZA 1O3SA 2ETEA 1H1MA 4XFAA 3KGZA 3MPBA 3H3ZA 3LA3A 4LTAA 3WW4A 3I59B 1GQHA 4IEYA 1DZTA 4LUKA 1CGPA 2XGXA 3WW3A 3KSCA 1RTVA 4HBNA 3BALA 1RUNA 4IEPA 4I02A 4QGLA 2UYAA 5FLJA 3E5XA 4WVZA 1ZREA 3CLPA 4MV2A 1YFXA 1OFNA 2GAUA 3FFQA 1J1LA 1LKNA 2EVXA 1ZZ6A 3H7YA 1X82A 5D1IA 4YNIA 1O3TA 4UBHA 5LRRA 4XF3A 3FX3A 1EPZA 4I2OA 4PJYA 3CJXA 1TQ5A 4AQ2A 5I8YA 1QY4A 2VPVA 1YFUA 4KU8A 3H1MA 3CEWA 4YSFA 4UXAA 2PA7A 2H0VA 5JSOA 5F1RA 5FCCA 1ZZ9A 2ATFA 2CV6A 1O5UA 4HSJA 3TNPB 1DGRA 3IWZA 5I93A 2Y0OA 2ZKLA 4O9EA 1O7FA 1VR3A 5J7MA 2V09A 3E6DA 3S7EA 2CAVA 3RYRA 3JZVA 5JSPA 4FAGA 2Q4SA 4N9HA 4Q29A 2IC1A 2EA7A 1HW5A 3CO2A 3NW4A 5CVRA 3H8UA 3BCWA 3SCHA 4ZU5A 2IXIA 3O14A 3H7JA 4YYOA 1OD5A 1OI6A 5BY5A 4HLTA 2WFPA 3RDIA 1PM7A 3MDPA 3GBFA 3IDCB 2PFWA 3D0SA 3LWCA 4CYDA 1QXJA 2HJIA 2PYTA 3DV8A 1YFWA 4KWLA 3E5QA 4IEZA 3QACA 4Z82A 3RNSA 1ZX5A 4P9GA 4Q0QA 3IDBB 3NL1A 3UKNA 4I01A 1NE4A 3FHIB 1I5ZA 1EYBA 1G6NA 5HI0A 3H3UA 1Q5OA 5BXXA 1OMIA 3NSTA 3SHRA 2XHKA 4J1XA 2QNKA 2E9QA 4EWAA 4F7ZA 3RYKA 2B5HA 4LEJA 2OA2A 3CL1A 3NVCA 2K9ZA 5BPXA 5BV6A 2O8QA 1CAWB 3OTFA 2PAKA 3M3IA 4Q0UA 4ZU7A 1H1IA 2B8MA 2OZJA 4XFBA 2OYZA 3LA7A 1ZRDA 1FI2A 3KGLA 5FQ0B 4OFGA 2D5FA 1ZZCA 2UYBA 5LEJA 2CGPA 1LRHA 2XKOA 3PLQA 1RUOA 4L2NA 2PHLA 4AVCA 1J58A 5AVPA 1J3QA 1SEFA 2GZWA 3FJSA 2BYVE 3I59A 1ZZBA 2D5HA 3MYXA 5I8TA 4OLLA 4KWJA 5FQ0A 3KMHA 3H1WA 2PAMA 4MZUA 4FBFA 4LUMA 1CAVB 3UKTA 2I45A 5JCTA 3DKWA 4N9IA 5E1RA 2VECA 2ZCWA 1GQGA 1JUHA 2MPFA 1X8MA 3B02A 2O1QA 3LOIA 2XLFA 2IXHA 3I7DA 4HZFA 1I6XA 2BNNA 2K0GA 1DGWA 4XF9A 1O3RA 1YUDA 2PAEA 3EHKA 1J3PA 5J3UA 2XLGA 4BHPA 5FLIA 4QM8A 4QX5A 2FQPA 4J1WA 3S0MA 2IXJA 2Q0AA 1UCXA 1RL3A 1X8EA 2OPKA 3U0ZA
chains in the Genus database with same CATH superfamily
2J1EA 1VBB1 1S0FA 4LT5A 1JS9A 5F8PA 4EZ4A 3O1RA 1OBNA 3ILRA 2FMDA 1W8FA 2W39A 3WHUA 4E2SA 3I4IA 4YM3A 4CVUA 5JOWA 4LKEA 4HPKB 2VMFA 4MGQA 1HRV3 2SLIA 3I54A 1RINA 1UQXA 4H55A 4H7MA 1KGYA 4MO3M 2C9KA 3K3OA 1W8NA 3TEXA 3GCXA 4WM7B 5A3LA 1GWLA 3C7FA 5IVCA 1QJX1 1OA3A 4QT6A 4AQ6A 1YJLA 2ZGOA 4Y4RA 2J1RA 4A42A 1D0HA 4AFAA 2XDVA 1CAXB 4A44A 3EXUA 2X5IA 2WWSA 4FT8A 4PLMA 3PVOA 1O6UA 3W9AA 2VQAA 2Y8KA 4KBZA 2UWBA 3ZPOA 3PMSA 5FXXA 3WD5A 4EWDA 4D94A 3I8TA 2D6PA 4JQTA 2GH2A 5FZOA 1GBGA 5FZCA 3HR9A 4P08A 3T2PA 1U0AA 4QGMA 5J1XA 2WWJA 3RI9A 3TN93 3BTZA 3BUCA 3J8F2 2YGMA 3MUY1 4XF0A 5C4WC 2Y38A 1W6NB 4FOQA 1OLRA 2W68A 3VN4A 2PLV3 4XDPA 1MACA 1REDA 2QQMA 5A7WA 5BYNA 5J48A 1AR72 1ONAA 4OHYA 3FE5A 3ACGA 4N8MA 4P9WA 3HQXA 3OGSA 2NLRA 4XTPA 3WNNA 1PZ9A 3S30A 2E31A 4CXXA 2DVBA 2AYHA 2UURA 3T4VA 4BM8A 1W8ZA 1XNBA 3CIHA 5EXOA 3VBSA 1L7LA 1N3OA 1Y4WA 2Z5WA 4Z07A 4CCLA 4CPBA 4DXRA 1L3JA 3KVBA 4BQ2A 1BMV2 3ECQA 3IBMA 3RPQA 3WP4A 5C4WB 5CYYA 1C4RA 2NP0A 1SBFA 3AX4A 5FZ7A 2IXLA 2KA3A 1HDKA 1VIWB 4CUCA 1S2KA 3N35A 4WZCA 4BE3A 1TG7A 4YZ3A 5FYCA 5FOBB 4J25A 2LM3A 4I09A 4D7TA 1OA4A 5I0SA 2YHJA 5K9YA 1CX1A 4Y24A 4RR3A 4YW6A 1WMXA 3WDVA 2GC0A 5HCBA 3WOGA 5KXBA 4C1XA 4DNYA 5AFBA 3HT2A 1N1TA 1G9AA 2WQ8A 2WSVA 1AXZA 2JENA 3TEYA 3OGJA 1DFQA 5FMDA 1BK0A 3N4MA 3OPZA 1FV2A 2W1UA 4DXZA 2WN3A 1V9U3 2RR11 4HVRA 3LEIA 5LCWL 4N7IA 2WUHA 1ASJ3 2IVJA 3KF3A 4CP9B 5T5JA 1Y43B 5FZEA 1PMJX 3OUIA 1NY71 2QQOA 1ZRCA 4OUMA 2F4LA 4TWTA 1G9DA 5FKBA 2W87A 4IEVA 5A3UA 4QGNA 4I0BA 5EIYB 4K7JA 2DCTA 1D4M1 3KM5A 1WD3A 1XE8A 2AR6A 1PVC2 1EY2A 1WGPA 2QTWB 1JH5A 1HKDA 3VBHA 4CEYB 4XCAA 5FUNA 2W1QA 1JHNA 5A32A 5JAXA 2XJUA 2R6QA 2F4PA 4XVHA 1O5LA 4LA2A 1CONA 3AZYA 1HB3A 1W6MB 2D93A 5H9SA 2Z4FA 4L97A 4XBNA 5IUQA 2WINB 5T54A 2WSUA 1QMJA 3UETA 4COYA 4XUPA 3INAA 1OOPB 2C0ZA 2VCMA 4FCAA 4CE8A 5C3SA 1FT9A 2VMCA 4A2UA 1PO23 4Y33A 2WO2A 1O3QA 2GNMA 4XJZA 2VCCA 4HKWA 5GALA 2WNOA 1JOJA 1R1A3 5J36A 4OUEA 4DOUA 4DXSA 1LODA 3E5UA 3ME2A 1RUE1 5JZGC 3A21A 4IXLA 4IGQA 4XBLA 2ZMNA 1JUIA 1ZBE3 2JECA 3DYPA 1RJ8A 4LBQA 4SLIA 2RR13 3EYPA 4Q4V1 1UOGA 2J1VA 4HN0A 2RS33 2YPDA 2HWE2 1US2A 1RUH1 2VNVA 2Y64A 2Q8CA 1COV3 1MVQA 3PL0A 4WM8A 1MS4A 4Q4X2 4O9GA 5GZEA 3NAPA 4NHLA 1ND3C 3S5AA 3CBNA 4AXOA 2HWC1 1ENRA 4Y5Z0 4EWEA 2EXIA 3BKZA 2WZR2 2YC4A 4XZUG 5BUVA 2BTVC 2PMWB 4CDXA 5GJ6A 1YIPA 1Q3EA 2VW1A 3VZJA 5JWPA 1DCSA 1XOYA 2BZDA 2DYCA 4INDA 3NV2A 4ISQA 4OZXA 4RQPB 4H3WA 4HVOA 1APNA 5LBBA 3U1XA 4LXLA 4NJ4A 3THPA 3AKPA 3OGRA 4JHTA 4HPKA 5CIRA 4YW4A 5LA2A 2Q1FA 1ENXA 4EYUA 4Z1VA 3NJVA 1WA4A 4YFWA 3H42B 5FYTA 4CCJA 4D6SA 3ETPA 1N3QA 1ND3B 2BFUL 5T55A 5FR3A 2X53S 3AYDA 3MIHA 2XH6A 4FP3A 5FZGA 2EIGA 3V64A 4ZKTB 3QBQA 1CAXA 1NQJA 3AC0A 3VKLA 4NPMA 3PVBB 1O4ZA 3GXUA 1NX9A 3KHBA 4NAOA 1QJU2 4MGYE 2XLAA 3UGHA 4QB1A 4D8MA 4XFHA 1AYM2 3RZKA 1Q8QA 1CVNA 2ZGLA 4YW3A 2DV9A 4JGZC 5FZ0A 1TEIA 2OPWA 1W2TA 3CU7A 5FY5A 3MO4A 2RS12 1X7NA 2B39A 4ZPIA 1VBA1 4CUAA 1H8VA 3ROUA 1UY2A 4KNCA 3VHOA 2BDRA 1NOVA 5HCAA 2OX0A 1WUVA 3RSJA 1X33A 2BWAA 4DY5A 1DYOA 4LHNA 5CKNA 2QQPA 3A23A 3IPVB 4JKKA 2VNGA 2ZOEB 1JZ3A 1AR81 3BOPA 4AI2A 1OUXA 1ZZ7A 3B9CA 4CCDA 2WS93 4I3PA 1N3PA 1R64A 1AL21 4BQ5A 1Q8VA 1F4HA 1LCLA 5L73A 1LENA 1QOSA 5E89A 2E53A 3AXEA 4JGZB 3M1HA 1OH3A 5DDJ2 4XCBA 5D8AC 3VDDB 4HK9A 1T6BX 1NCQC 2W1SA 5FZDA 5DG1A 3NO8A 3RJ2X 1I5PA 4COVA 2VZOA 1BEV2 3MF9A 2BWCA 2JKBA 4XFAA 3N7KA 3KGZA 3MPBA 3MI8A 3NV3A 4W6YA 3BTAA 4M01A 2B9VA 3OY8A 2A71A 4CDQC 3RMYA 3LB9A 3WW4A 4D7YA 5ACA2 3V0BB 2A3YA 2ARCA 5HBAA 4AOCA 4GJYA 3JQWA 1CZVA 2WO3A 1NCRC 2YV8A 3T0BA 1OH4A 1UZZA 2OIIA 3A0NA 3TOJA 3VKNA 1MS3A 2VQUA 3BALA 5D8AB 2ZGRA 4I02A 1QIQA 1NCQB 5FLJA 2FDKA 5FZKA 2VVDA 4MHRA 4MV2A 4BISA 1CZTA 2BP6A 4Y1UA 3THCA 5G05L 4XJUA 3VKOA 1NLQA 1OFNA 1PIV1 3FBMA 1J1LA 1RHI2 2AUYA 4MXWB 1ZZ6A 5AVAA 5A7QA 2VW2A 1UYYA 3LIHA 1X82A 3PMEA 4CP9A 2NMNA 4YNIA 3M3CA 4QKBA 4XIKA 1YYNA 1PGW2 3HQRA 3M3QA 3I3QA 5LY2A 1W6QB 1UOBA 5FXVA 1H2MA 4AQ2A 5H9PA 1GFF2 1QY4A 2KD7A 3QCWA 1AYN3 2DFCA 3AJZA 1DLLA 2RE9A 4KU8A 1ZA4A 2ZEXA 5GM0A 2XQRA 4AYUA 5DPNA 4YSFA 1ENQA 2Y34A 4JAAA 1R083 1RUD1 1W8UA 2R1DA 1C1LA 5F6KA 5F1RA 1FX5A 2RS51 4AK3A 3VZLA 4CEYA 5FCCA 3J7MA 4MSVA 4HSJA 1RUJ3 1RUF1 1Y7BA 2DTYA 3JQXA 4NPRA 2GNDA 3NKGA 3AMNA 1RXGA 4P02B 3UJOA 4BMEA 4FSJA 3OBRA 3LEGA 2ZBJA 2ZGSA 4OUSA 3AZZA 2W9XA 2VZRA 3FBYA 4KMQA 3RWNA 2PHRA 1H4HA 1OOPA 2YBPA 3NRUA 4GKYA 2WDBA 4D69A 2TNFA 3BYWA 3GJBA 4IL7A 2CAVA 2Y6LA 2EIBA 3PUSA 4JDMA 2YXSA 2RJLA 4PCRA 2ZX4A 3TRSB 5A3NA 4QX3A 1S0BA 5FZ1A 5JSPA 1HXS2 4NR1A 4N9HA 4YG3A 3OBZA 2IC1A 2VZTA 2WBKA 3OUHA 2EA7A 4HETA 1VMJA 2RDQA 4QKDA 3ZN5A 2QQKA 5JIUA 3GALA 3VBOA 3VV1A 4XJAA 1AX1A 3H8UA 5J09A 3FFZA 2RM21 4AEKA 2DTWA 3S6PA 4ZU5A 4XUOA 4NROA 4AGRA 4GIQA 1F9KA 4YYOA 1OD5A 2P4EA 5BY5A 4HLTA 3ZYGA 2P34A 1LGBA 3MBWA 4JZRA 2HYKA 4RQPA 4YFZA 3WQ1A 3B93A 4G4FA 3HMYA 1AUYA 1UY4A 3MIGA 1SDDB 3MLKA 4FXGB 1AR62 5FJHA 5CNAA 4UOJA 2C9AA 4Q4W3 3RNSA 4XZPA 3UKNA 3NL1A 1LHNA 2E7AA 4E4SA 4DIQA 1XC6A 4KGGA 1FATA 4LO7A 1EYBA 2WZEA 1ODMA 1OF4A 1A3KA 2XBO3 3MFAA 3OEAA 4X8NA 4XURA 5F3IA 4A4AA 2LTNA 3AL6A 3C2UA 1ZM1A 2XHKA 2HH9A 2XG3A 2WL1A 5LASA 1W6OB 2QNKA 4YPJA 2EICA 3JD72 2VVEA 4GH4C 2B5HA 3J8F1 4C0HA 1HN1A 2YB7A 4NUBA 3FMGA 3CL1A 5FAXA 1POV3 1ZYBA 2X09A 2KR2A 3GDBA 3I2GA 3NVCA 2K9ZA 5BNQA 1AR71 4XDOA 2O8QA 1CAWB 4MVTA 2DU0A 2GMEA 1WW5A 5DAQA 3UK9A 4OYUA 4CCOA 2VZ3A 1W8OA 1W0NA 3QH7A 1QJY3 1ST8A 3O0WA 3IPVA 2OZJA 4PQ9A 1OUSA 1BCXA 4XFBA 1HRI3 2ORXA 3BGAA 4RHV3 2R16A 1BMV1 1ZRDA 4AAPA 4GH4B 1D4M2 1FI2A 1UU4A 1HV1A 1JI6A 3LDBA 4JGZA 2UYBA 3RZMA 4P9XA 1LGCA 3JB4C 3RGBA 3VDDA 2ZAHA 4ZZ5A 2VL4A 5A80A 2V5YA 4LLFA 5C5UA 4PF5A 4B4QA 1XQNA 2R49A 2XUMA 3ZSMA 4NWWA 1LAJA 2FCTA 1FV3A 3TB0A 1H8TA 3V0BA 4M0NA 3WP3A 2VOTA 1MEC3 3MW3A 1ZZBA 1SLLA 4QPIB 2ZKNA 4LBKA 3O5SA 1KS4A 1SCSA 3Q8FA 4AF9A 3BN6A 2JDAA 1Q56A 1CD3G 2A70A 2DBNA 4MZUA 5D8AA 5EWSA 1RMU2 3U4XA 1PO13 2DF7A 2VD7A 5GZDA 3UKTA 3OOXA 5KR7A 3KLSA 5E1RA 3KVAA 3P5BA 5GLVA 1BBT3 4BXSV 3UL2A 4U2AA 2XLFA 2I07B 3AVRA 4FOVA 1RUH2 1I6XA 1VB4A 4HZFA 3NNFA 5E6HA 2BNNA 2HWD2 1DGWA 1KFUL 3VKMA 4CPBD 3W20A 1YUDA 4P5HA 1JZ5A 2BBVA 1J3PA 3MIFA 5J3UA 2WAAA 3L2YA 2XLGA 4Y22B 3MPPG 1OFSA 3DF0A 1FYUA 3N9OA 2ZGNA 5FZ3A 2WR9A 3WXPA 4BU2A 4PDWA 1PVC1 4QWNA 4CZSA 4D0QA 3SITA 2FQPA 2E51A 4K1YA 4NHYA 4PI2A 5IK8A 3BIEA 2F17A 2A6ZA 2B4KA 2W95A 3N7JA 4BQYA 3FLTA 5C71A 4TXWA 1X8EA 4M3CF 4GALA 1J3QA 2YYOA 3MF6A 2V4AA 1W06A 2DUQA 4UT5A 4DFSA 1UYZA 2R32A 2CWSA 2FCUA 5FDBA 1NZIA 3WUDA 1FOD2 1JZ4A 4AVSA 1OVPA 4UFMA 3UYJA 3VHPA 3JUUA 2P3JA 3TNQA 2EAAA 3OPTA 3H50A 2ZHMA 4OI4A 1VPHA 1HIXA 2VXJA 3VBSC 1PZ8A 2AENA 1NUKA 2HKXA 1UIJA 4CEWA 4OMDA 4CU8A 2D3SA 1ZZ8A 1C3HA 1ULFA 3FUOA 2QBXA 2VUJA 2ORZA 4FFIA 1VP6A 2P1BA 2W1WA 3GHNA 3ELNA 2C24A 4V2VA 2HWE1 3HN3A 5A7WB 5LW9A 4XUTA 1QOOA 4RD7A 3GZAA 1S0JA 4KU7A 2ZPXA 1ULCA 3KCCA 1JOPA 3P1IA 5FZ8A 4XACA 4AI3A 2X29A 4RR3C 5FUIA 2WO7A 2WZR1 2WT0A 4JKMA 4WZFA 4XIOA 3VBUB 4HVQA 4GWJA 1PK6C 4LJHA 3VBSB 4LPLA 4YW1A 5FPAA 1AL22 1EP0A 2XL9A 4FFHA 3POFA 1VBC2 4ZU4A 4AG4A 2WLQA 3MZHA 1VBE2 3N9QA 4YZ5A 4YARA 1E5HA 5HCFA 1V6KA 3DPRA 5DAVA 1CAUA 5BNNB 2QJVA 3BB6A 5LBFA 3MW4A 4CCEA 4Q8KA 3LZZA 2CAUA 4MUVA 1VJ2A 4AWDA 1AHSA 4RR3B 2WQ4A 3RI8A 3SCGA 1K45A 2D6OX 1PK6B 3AMHA 3LCPA 3D0JA 5HV0A 1UAIA 3OYWB 1QJU1 3C3VA 4P14A 4LBQD 3IN9A 1VBD3 4EN6B 5DMYA 5CFDC 3ILNA 1UD1A 4YZ1A 1DLCA 5ISLA 3R4SA 1W6OA 1GWKA 1QWRA 2RS11 4CRQA 2WO1A 5FPZA 4GB32 5I0TA 3M7AA 1DP0A 4UBGA 1ZNPA 4XXAA 2ZHKA 2RJKA 2DUPA 4Q4X3 1BLZA 1UZ0A 1UIKA 4Y4YA 2NYYA 1BHGA 3OD0A 3PUIA 3F2ZA 2B9UA 1CAWA 2VNOA 4RN5A 2VTXJ 4W8JA 1YJKA 4I0AA 3RS6A 1YWKA 3GYDA 4K8FA 1RUC2 2DFBA 4KBBA 4XABA 2D40A 3RWKX 1GU3A 2J42A 3I3BA 4B1LA 2E32A 1GNHA 2ZX2A 5CFDB 1FPN3 1SLIA 2D44A 3A7QA 3IKWA 5KC5A 2DDUA 2B42B 5DDJ1 5FP4A 4Y5TA 4CUBA 1GOFA 1SFNA 3W5MA 3CZUA 4QHBA 2ZGPA 4QAWA 3KB5A 4M4PA 5EJ1B 1QXRA 1BEV1 4HG6B 4IE7A 4TN7A 3K77A 5IK7A 2OQ6A 3EMRA 2F6BA 4C1WA 2B7YA 3VDAA 2GC3A 3NJZA 4QQLA 4B3NA 1UX6A 3CNAA 1OD3A 4MGIE 5ACA1 4QDRA 4WM8C 2G1MA 4R52A 3NAPC 2XJSA 2XVGA 4LIUA 3G7DA 3T4HB 5LWBA 3FLRA 2E6VA 4XMAA 1DQ5A 1CPMA 1EV11 3AVSA 4CU7A 4KG8A 4IETA 2UY8A 2WZ8A 4QPIA 4CDXC 5C8CA 1AYM3 3HAGA 2VMGA 1LB2A 4LKDA 3ASIA 4W6WA 1RUI3 3M3OA 3O12A 1WW6A 4OHZA 1GNZA 3IB3A 3OBAA 4IUGA 5IVFA 1XBFA 4MGKE 1UZWA 1XNAA 1WA6X 1RGSA 3AK0A 5FLHA 1RHI1 1WLWA 4O65A 3S7IA 4C91A 5IFTA 4AFBA 4WM8B 1JZ7A 3NAPB 3CHXA 2PHXA 4TZDA 4AVTA 1Q43A 3DN7A 1UU5A 1PGW1 4NO4A 3SC7X 1U5ZA 1MS1A 2HWB1 5DAPA 4CDXB 1KXGA 1BQPA 3KQ4B 4Y22A 2PHDA 4ONUA 3ZSEA 5FWJA 1C8M2 2BNMA 5FP7A 2E63A 2A73B 2VULA 4NRQA 2HEYF 1CX4A 4ZONA 5FV3A 2ZA9A 2GC1A 1JXNA 2D7FA 3SMHA 5IVJA 4UFLA 1ULGA 2WFF3 4DB5A 3EO6A 2Z42A 5LZ6A 1WLTA 1J59A 2WNVB 5L36A 4B29A 1NE6A 2JJ6A 4M0HA 3T1MA 2BGCA 2D6LX 2XUEA 5FY7A 2HLEA 1GZWB 5HCHA 2V4VA 3LPFA 1LJ7A 2MEV3 4L0PA 2UWCA 3CMGA 1RIRA 5AC92 5L19A 2JG8C 4GULA 1XU2A 1FMD2 4IEWA 5EHDA 1JBCA 3LA2A 2HBUA 1HXS1 4Z2WA 4KWUA 5DZGA 1NLRA 2SBAA 4J6GA 3OCPA 3JU9A 1O4TA 1XRUA 2HBTA 3GCWA 2FMYA 2VQTA 3VD4A 2XJQA 3H8OA 1RC6A 5GLZA 2I74A 4PIZA 1FNZA 1Z7S3 5A3OA 4BA6A 1GZCA 2G4IA 2PHWA 5C9AB 1AR92 1QH7A 2WAOA 4GWMA 2XPJA 1CJDA 5ANQA 2G9GA 1UW8A 4FOYA 3WV6A 1OPMA 1VBB3 1DQ4A 2JG8B 2DVDA 2O14A 4K3UA 1YFYA 4YGDA 4NIIA 3SEPA 3U10A 2VR4A 2YU1A 3PU3A 5F6LB 2TUNA 3ATGA 3VBUA 1DYKA 3DXUA 4Q4Y2 4A7YA 3O1MA 4XF1A 3ZSLA 1QXPA 2NMOA 1BVP1 2ZEYA 1KITA 3K3NA 3U14A 4GQ7A 4IEOA 4Y1ZA 3POIA 3KD4A 1UMZA 1KJRA 2Y6HA 2Z69A 5F5CA 1AR61 5A70A 4XQDA 1XNKA 3U4SA 1B35A 4KWKA 2DU1A 1ZVFA 3POJA 5I0UA 1QJX3 4M3CA 1Q8SA 3OY8B 5BNNA 2P3IA 1LOFA 4EN9B 1OLMA 5T50A 2VBBA 5IVYA 2Y6KA 5F7UA 2PQQA 2YC2A 3MICA 4IEUA 4V2WA 3WNPA 2XXZA 2ZMLA 4QHZA 2AEZA 3BU7A 1ZA7A 1PK6A 2D6KA 1HJGA 4F3JA 4HSLA 3OYWA 4X6QB 5CADA 2ARBA 5DAWA 5IK4A 1IOAA 1C28A 2WNUA 1C57A 4YWAA 5J37A 4IE5A 1H1MA 3VD3A 3JD71 4NHKA 2JDKA 5A7NA 4CDWC 4NAMA 5FUPA 1GOGA 4LHKA 4RS5B 5JPMB 4CEYC 5C3OA 1GQHA 5FYSA 5FP9A 1VB2A 2R062 4LHSA 2HWF2 1O8SA 5FZ9A 4IGOA 1H6YA 3ZYHA 5A3TA 2XGXA 4E9KA 2ZGQA 3AXDA 2XWJB 1WD4A 3N9MA 4HBNA 4LE4A 4UAPA 2VOWA 5T52A 3J4UH 1OOPC 1W2NA 1L7RA 1POQA 3POBA 1W6PB 3PUHA 1YFXA 5CFDA 4QU2A 2BGOA 1GSLA 2OS2A 4CDWB 2GAUA 1HJFA 3W58A 2ARAA 4HXCA 4QDQA 2ZHNA 5F9TA 2FCVA 4Q2FA 5FY8A 3LKJA 2WLPA 2WA4A 3H7YA 5FZLA 5D1IA 2IFRA 1UOJA 4UBHA 3VDCA 1OPOA 4XF3A 2QQIA 3VBOC 3FX3A 3WQBA 1QJZA 1PX3A 4I2OA 4PJYA 2Z79A 3CJXA 1XXNA 1XPWA 4XHXA 1ZBA2 2VXRA 2R041 4UYBA 3KQRA 3LPGA 1I1EA 5DG2A 2IVIB 3MIBA 1RUG2 3OGVA 3POYA 1UY0A 1AVBA 4KG0A 4MOAA 3KCXA 2VU9A 1TME2 4HONA 2R072 1L7QA 2P5BA 3IZOA 5FYUA 3IM0A 1RMU1 2P3KA 3JCIA 4QQOA 1ZZ9A 4RQPC 1O5UA 3MEPA 3KT7A 1KDMA 2RDSA 3POGA 4OQ9A 1LOEA 2WZPP 3VBOB 1EAH1 1XSRA 5FP3A 2FDGA 2GSYA 2FZ2A 4RFRB 4TYSA 2HWD1 2ZKLA 2XR4A 1O7FA 2ZGKA 3HNYM 3Q8AA 1YQ6A 5FPBA 3JZVA 1VRH1 2VOXA 4LKFA 4YVSB 2FHRA 4BPZA 4FAGA 4MGSA 2DVAA 3ON7A 1F2NA 2OKXA 3K4DA 1TNRA 1D4M3 3VZNA 4BMBA 1WWYA 3V0AB 4K9SA 2ZZJA 5A6ZA 4OI2A 1AJKA 4LR4A 3WQ7A 4AFCA 4LBLA 5EYXA 1U5YA 3VGIA 3BCWA 1WLDA 3SCHA 2IWGB 3BODA 3PUAA 4LBJA 4QX8A 3CJIB 1R091 3VD9A 2GNTA 2VQ0A 1O91A 1QOTA 2WNVA 4ZS3A 4AAXA 1AL0G 4LO5B 3V65A 4CCMA 5C70A 4Z92B 1FOD1 2VOKA 5GLUA 4DXTA 5IJRA 1JOBA 3RDIA 1HQWA 1PM7A 3GNEA 4DMIA 1GZWA 3MDPA 4LBNA 3PJQA 3D0SA 1SLAA 3LWCA 1A34A 2WWUA 3KZ4C 3GHMA 1YNAA 4BQWA 4E27A 3LDKA 2CWMA 2VUCA 2PYTA 2NQYA 3Q9OA 1YFWA 1RUE3 4KWLA 4E4ZA 4IEZA 5JMCA 1AJOA 2GN7A 4W50A 3VDDC 1ZX5A 3I2DA 2D98A 4P9GA 4Q0QA 3IDBB 1QQP2 2VUAA 1S4CA 4Q4V3 1ULPA 1RUH3 4I01A 1NE4A 3HEIA 3FHIB 1I5ZA 5HI0A 2IZWA 4AW7A 1H8TC 3SHRA 2HWC3 3T1LA 5C9AA 1SMVA 4J1XA 3BVCA 2E9QA 5CFCA 4BWOA 2E7TA 3B01A 3WX5A 2JG8A 3I3MA 5KWRA 1VE0A 4LEJA 1WMEA 2OA2A 1VBC1 2VH9A 4HOOA 5G04L 3WDTA 3L9JT 3IDEA 1VBE1 5BNOB 3O0XA 1T6GC 1OQDA 2R0FA 3LGRA 3OTFA 2PAKA 3M3IA 1SPPB 1G8WA 3LEMA 4Q0UA 4AR2A 3ORJA 3MLLA 3WINE 1W9YA 3KCYA 4XXPA 2DUOA 2B8MA 3U78A 1FOD3 1H8TB 2AREA 2IUWA 5ABJA 3ZYBA 4COWA 5CKQA 4B1MA 2WT1A 3B94A 3KGLA 3KT1A 1T2XA 4LHLA 4OFGA 5F39A 4OCTA 5FJKA 1EV12 5FO7B 3W59A 3X29B 1SHWB 1DIWA 1LRHA 2CGNA 1NLSA 3ZR5A 4PDWC 3DYOA 1OA2A 3AYAA 5F5QA 2PHLA 1SDWA 4YLZA 2RV9A 3MLJA 4GB31 1X50A 4UFHA 4BZ4A 1SEFA 3MIEA 5FK7A 4B8EA 4DZGA 1VBA3 2BBAA 4NRMA 5FK8A 4RS5A 5I8TA 2P3YA 1D2QA 1W8WA 4BIOA 5FQ0A 4BQ3A 3KMHA 3H1WA 4HFSA 3JB8A 1RUC1 2A6VA 2R7EB 1AR83 1W8TA 4LUMA 2HWB2 1CAVB 1AL23 5D2AA 5FY1A 1YI7A 1V6OA 3JXSA 5JCTA 4PDWB 3DKWA 4DS0A 3O1TA 2EXJA 1E5IA 1W6PA 4B7KA 4FQ4A 4CEWC 1GQGA 2ZAAA 1H9PA 1STMA 1VBE3 5FYIA 2X8KA 3TN92 5APAA 4CDWA 3LOIA 2IXHA 3R4DB 4HT1T 5F3GA 1IS4A 2WYSA 3K2OA 3UJQA 1WCDJ 2PAEA 5A1FA 1WCUA 2PLV2 1HQNA 3TWIA 4TLGA 2FZ1A 5FP8A 3R05A 4OULA 4IV3C 3URFA 1GZTA 4FPKA 4YVWB 4FTEA 1K42A 1CR7A 1QDCA 3QLQA 4QM8A 4GD4A 4QX5A 2JG9C 2K46A 2IXJA 3E1F1 4CEWB 2Q0AA 4ITCA 3ZMNA 3ZPYA 4DEQA 4NIHA 5JXIA 1XYPA 4UW3A 2CU5A 1K5MC 3ZKYA 2LROA 4IERA 4CP2A 2TBVA 3DPRC 4F83A 3SXWA 4E2GA 1PIV3 3J7NA 5CG9A 2DURA 2VY0A 2VZSA 4IV3B 3AB0A 4Y1XA 5GZCA 3B00A 4R9BA 2R0HA 4WBBA 1W28A 5FPVA 1ULEA 5FWEA 2PHFA 3UESA 4JV4A 1OXCA 5E16A 5JXGA 2JG9B 4QQ2A 5FO9B 3ACFA 5LEKA 5EFUA 1G9FA 4XF4A 5DAXA 3THDA 2JEMA 4YVSA 4BB3A 1C8M1 1ND2C 3AP7A 1UYPA 3MHZA 3WDWA 1TMF2 4Q0SA 1K5MB 2WJSA 5DUVA 5CU1A 1W03A 5F5IA 1LTEA 2GNBA 2V5DA 2YROA 3V0AA 2P6HA 4H14A 4NIGA 1RUD3 3DPRB 2QVSB 4IE0A 1CAUB 2ARXA 1SQ4A 1BJQA 1LHWA 2QUOA 5BNPB 2RS53 1V9U2 1QEXA 3N7LA 1HN0A 3ZIWA 4A6OA 3CJIA 4XJ9A 1ASJ2 3DEMA 1RUF3 3W21A 1W2UA 1RJ7A 1SCRA 2VZPA 4BYYA 1CN1A 3WW2A 3BTXA 2QDNA 4P9JA 3U11A 4YRDA 4ZXEA 5AC91 1ND2B 3PNAA 3AFGA 1FMD1 3T08A 4GAZA 4AVVA 4S2HA 1DU3D 4AVAA 2BEOA 4DRRA 3ZXEA 3PHMA 1Q8OA 3WG2A 3WNMA 4QD2A 3WG4A 4XE9A 1W90A 3JBG2 1LHOA 5FPXA 4AVBA 4JRAA 1DDLA 1UPIA 1QKQA 1V70A 2Z2SB 5FYMA 2CSGA 4L99A 2IXKA 2ENRA 5A7SA 1PM4A 2BQPA 3ZXJA 2W52A 1AR91 2RM23 1K5JA 4Q0VA 4AEJA 1JYNA 1W2AX 1YC61 2J1TA 4UW5A 3H8XA 5KHHA 3DL3A 2ZTNA 5T3NA 4AQTA 4META 4Q4Y1 2VW0A 2ZEWA 3R6SA 4O61A 4QPIC 5C8CC 4TLFA 1R1A2 4P5YA 1DGWX 4AHWA 4ISRA 1HV0A 1WBLA 3J9SA 1N1SA 1ULOA 1H9WA 3D82A 5LY1A 3I2OA 2RDNA 1ZBE2 2QDRA 4M3CE 5BNOA 2WA3A 5CEHA 3HIFA 4UWDA 4IV1A 3FC0A 1OLME 1OKOA 3EJKA 1SPPA 2UWAA 4PIXA 4YGEA 5FZHA 1COV2 4URAA 1A78A 2Q1MA 2ZGUA 4LE3A 4QMAA 4QXCA 1QU0A 1B09A 1W04A 4UW6A 4NE9A 1MZEA 4D7SA 1HX6A 1KDKA 2N7GA 5LBCA 2R042 4QDSA 3VZKA 1PMIA 2OUHA 5C8CB 2AH2A 4TTGA 5IT6A 1LHVA 3HVDA 4R9DA 3WNLA 3CF6E 1CPNA 3ES1A 1RB8G 2GDFA 5LBEA 3HD8B 3USSA 5LA0A 2FBEA 3NV4A 3J8F3 2LALA 4HK8A 3ZLIA 2WKKA 2XJRA 4XDQA 2D97A 2R061 1NQDA 1BYHA 1W8HA 1IKQA 1ULDA 2HWF1 3E97A 3OPWA 4XHBA 2CGOA 1EAH2 3N3HA 1AR73 3P3NA 1LGNA 2BGPA 3IIAA 1TE1B 3WT3A 3C7GA 1JYVA 2Y60A 2GMMA 4QPGA 4AGGA 1Z0HA 4IE6A 3DCQA 2A6YA 1G9CA 5HV4A 2YU2A 1AX0A 3AP6A 1VRH2 4XFCA 4EV0A 1PGSA 3ZYFA 4NHXA 4CCCA 3O1VA 5EZWA 1CAVA 1UZYA 2QQVA 5GZFA 2ES3A 1CIYA 5FMCA 4Q26A 1DF0A 2YBSA 4O7XA 4JRLA 5LRSA 5KHJA 3FN9A 3B69A 3G6JB 1W39A 1QGLA 2ZX3A 1YI9A 5JR2A 3FHAA 5IYYA 3U75A 3WDXA 3KS7A 1DQ0A 2DBIA 2A1XA 1Y9MA 3Q8EA 5FBZA 1R092 3UKVA 1FNYA 3WP6A 2ZHLA 4E2QA 1H2NA 1UZVA 1ZBA1 4L11A 2J1UA 5FMOS 5JSRA 5FY4A 3CQOA 3LD8A 1RUG1 1LR5A 3K51A 4IQPA 4YVWA 1AZDA 2WS92 3GZEA 3O1UA 1IPKA 4D3WA 1TME1 3ENRA 3VBUC 4EJRA 1HLCA 2R071 2WRAA 3ILFA 5C8WA 1DZRA 4M4RA 4CTEA 5KBFA 3VDBA 4XETA 4PIYA 1JW6A 2BVVA 2JX9A 1GANA 2P17A 1OVSA 4L8QA 4QB6A 4RFT0 3VBRB 2R1BA 3IMMA 4QB2A 3I2JA 2XMLA 5JUVA 1YLLA 1OT5A 1YEWA 1B35C 1W9FA 1YHFA 4LULA 1QJFA 2P6CA 5BNNC 2ET7A 3NJXA 2OW4A 1LOFC 2BUKA 4FPCA 2XVLA 4IV3A 4N7UA 1IPJA 2RMU1 4A7KA 4JTNA 5FZMA 2W46A 1HB1A 4QKFA 1J3RA 3MV01 5IW0A 1GMMA 1OURA 2JG9A 2D43A 2YC0A 3PU8A 3BIWE 3EBRA 1XNDA 1PVC3 1PX4A 2WNUC 2K2SA 5KXDA 1SFPA 1GQPA 2J7MA 4HN1A 5FXZA 1K5MA 4DINB 3QOPA 4UF0B 1F5FA 5DABA 1B35B 2PHTA 1BXHA 3HNMA 5TSWA 2GMPA 2XVKA 4M3CB 1CESA 4HL0A 4XAEA 1WLCA 1G7YA 3WQ0A 5BNPA 2PTMA 5DZFA 5L9RA 3RZZA 3T0AA 4BK5A 5DUUA 1NA1A 2I2SA 2H6BA 4RA0A 4MGZE 2EAKA 3H9AA 3HT1A 4MH0E 4C0BA 2GU9A 3H3LA 3ZOIA 4JHZA 5IFPA 4V1PA 3ITQA 3ACLA 2FD8A 1W0OA 2XKPA 3BI3A 3C7OA 4EZHA 1UNBA 1A8DA 1MZ5A 2CDPA 2WNUB 4QM9A 1ND2A 1AYN2 1UO9A 1FXZA 4QHOA 4NIDA 1O59A 3AP4A 2P2KA 3THTA 2HYXA 2YUEA 4MHUA 4Y26A 4ORFA 3ZSKA 3NV1A 1R082 3AL5A 4Q1PA 4XFFA 2Y33A 5DN2A 1QQP1 3RYPA 4XFGA 1YQ2A 2HWE3 3D4KA 2XB6C 4FFFA 4FXKB 3RZJA 3NQHA 2C5DA 1GV9A 1RUJ2 1UOFA 4XC9A 4B7EA 4COZA 3OGGA 1PVXA 5EP9A 3WW1A 4LK6A 3WNXA 2OZ6A 1MPXA 3TAYA 3TYJA 2WZR3 4DQAA 1RVF1 3HQUA 4XEZA 1O3SA 3U07A 4OHWA 5C3PA 2ETEA 2BV4A 3FHQA 2GP3A 3ZVXA 4RSUA 3H3ZA 3LA3A 3PURA 2NPIA 5FTTC 1G9BA 3I59B 4ASKA 2DWRA 3OJBA 3NWKA 4K40A 1RXFA 5C3RA 1CQ9A 2VE1A 4EN7B 2NN8A 2VTFA 1CGPA 3WF1A 5FOJB 1RTVA 4OHXA 3GJAA 3WDUA 1RUNA 2GP5A 4IEPA 1GWMA 3M4FA 4QGLA 4WVZA 3ZX7A 4BXFA 3LEKA 2ZX0A 1C5HA 2JB4A 1J1TA 3B3QE 3CLPA 4YM2A 4EN8B 4AI1A 5FZ4A 3WHTA 4A45A 4P9IA 1QJU3 5DQ0A 1H2KA 3ACIA 3RFRA 2EVXA 2YDEA 2VBPA 1JZ8A 3CZJA 1GYKA 3SQOA 3APBA 4TSVA 1JU4A 4U36A 3WF4A 1GOHA 1PNFA 5AFEA 3SNMA 2RS13 4NN0A 3KT4A 3ZYRA 1C8NA 3HWJA 1SLTA 1TQ5A 2QE3A 1SACA 2VPVA 1D0GA 2WYFA 4AEDB 1YQ5A 1UX7A 1YFUA 2W91A 3K4AA 4Q4W2 3H1MA 2Y6JA 2WNVC 5GKAC 1KD7A 3CEWA 4XUQA 3RZHA 3RJRA 2OVUA 3C8XA 4ASMB 4LMFA 1QDOA 2H0VA 5IATA 3T2QA 5JSOA 2DCJA 2XBO2 5GLTA 4AEMA 2ATFA 2CV6A 3PTYA 4AI0A 4Q5OA 1MS8A 3OSDA 4WVWA 1M4WA 2A3XA 3T30A 3TNPB 5DDJ3 4AGVA 4AHYA 1E5SA 5JPNB 3TN91 2Y0OA 4GWNA 3MV11 1OHFA 1BEV3 2NZ9A 2ADDA 3SH5A 1PMHX 3CKHA 1VRBA 3UT0A 1G86A 2PLV1 1W9WA 2NM1A 2VC9A 5FY9A 5J96B 2ZEZA 3ZXAC 5ACA3 3KHCA 3B5LB 4LO4B 4DUWA 2QFEA 2RDRA 1TNFA 3DECA 1UY3A 4Q29A 5KXEA 5C9AC 3FLPA 1QJY2 3J7LA 3LQCA 1DQ6A 1HW5A 1EV13 2DCKA 4CDUA 5CFCC 4G3YC 3AYCA 1HRI2 3D6EA 2BVBA 3NW4A 1D7PM 4RHV2 1IQDC 4GMP1 5D21A 5A7OA 1CZSA 3ABZA 1YQ8A 3AM2A 2IXIA 5CB7A 1S0GA 3VBRA 1JYWA 3O14A 2UU8A 3POWA 3H7JA 1WMDA 1H4GA 3P6BA 4URTA 4XILA 4ZY9A 1OI6A 1XNTA 1RHI3 2WFPA 3A0KA 3ZXLA 2YFUA 2XONA 2JICA 4XPVA 2JE9A 4BQ1A 2W5FA 3IDCB 2PFWA 3O1OA 4MG2A 1WMFA 1MR5A 2VMDA 5ABJC 5EJZB 1JYCA 4AI8A 1MEC2 4YM1A 5CFCB 1UMIA 2HWB3 5JXHA 1UKRA 3OG2A 3DV8A 1YRZA 4AHXA 1S0EA 4FPHA 1IKPA 3E5QA 3NNMA 3ZXGA 1TMF1 3AKSA 1Y9GA 4FPEA 1NT0A 4XW3A 1PO12 2ZJCA 1HQLA 4Y1YA 2R30A 1GNYA 1V9U1 4N43A 5K4LA 4UF0A 3SLIA 4YG0A 1Q5OA 1BBT2 2JKXA 2PELA 3NSTA 2JD4A 3GZTB 2VAUA 1ASJ1 5A33A 4RS5C 5F2SA 3VUOA 2G9ZA 4KH9A 5ABJB 3ACHA 3N36A 4FFGA 3RYKA 1CJPA 2RVAA 3CDZB 2X05A 4F7ZA 5CA6A 4EQVA 5IVBA 5IVEA 1RITA 4JKLA 5SV5A 4CU9A 1VAMA 2XWBB 3K4ZA 1TVGA 5BPXA 3T2OA 4GMP3 1XJAA 2PQSA 3F95A 5BV6A 4K8RB 4DO0A 1EUTA 2VZQA 4KGQA 1HXS3 4LKSA 5IWFA 2Q5TA 2Q8OA 3ZFFC 3H0OA 4ZXKA 3JBG1 1CIWA 5FMBA 3S5QA 5A3MA 1UYXA 4QPWA 4RGGA 2WT2A 1E57A 2PN5A 2QZ2A 2OYZA 3WVJA 4COUA 4FI9A 3LA7A 2XOMA 3C7EA 2A75A 4ASLA 5JOXA 5FQ0B 5CZKA 1JYTA 5LEJA 2CGPA 1XB9A 1MQTA 2XKOA 1C5IA 1PO21 2AEYA 3PLQA 3K46A 3A22A 4GXLA 3LFIA 1DHKB 4L2NA 1R1A1 1QJEA 4AVCA 3D8CA 1TMF3 5AVPA 2WN2A 3ZFGA 3ZFFB 1GP4A 2E26A 2GZWA 3NNJA 3ZIXA 4JC1A 4OMCA 4Z8BA 1ZBE1 2OXBA 3I59A 1AR63 4RGKA 2CNAA 3WY6A 4KWJA 1UXXX 1LOBA 3ZYJB 2RS31 4ARXA 1GLHA 1KFXL 4D6QA 4PLOA 1COV1 1AXKA 1OC1A 1V6MA 5JIAA 4S2GA 4FBFA 2CDOA 4K1ZA 4N9IA 5JI7A 2VECA 2HEWF 2ZCWA 1RYYA 3GZUC 3ZFEC 1US3A 4HKOA 1QF3A 2W08A 1WCQA 1X8MA 2JWPA 4Q8LA 4QXBA 2C1FA 4DPNA 3N9LA 2O1QA 4YVSC 5FMOL 3AKTA 5H9RA 4NIAA 2A6XA 3T2TA 2K0GA 2QQUA 2X10A 4Y20A 3JD73 4XF9A 3HNBM 1O3RA 3DUIA 3JBG3 1DBNA 2W2IA 3EHKA 1LU2A 1OSGA 4EE2A 4XJ8A 3USUA 2O8OA 4BHPA 4XQWA 5CG8A 1A8MA 5FY0A 1SLBA 4IW3A 1D4VB 2CYFA 3P3PA 1DQ2A 1JHJA 1UY1A 2VM9A 3CJIC 3ZDVA 4AEDA 5A1AA 1Q8PA 4J1WA 5LK5A 1JMUB 3ZFEB 1ACCA 1O4YA 2JDMA 3RVHA 3WZ1A 1UCXA 5JMOA 1H30A 2AACA 1RL3A 4CU6A 3AFKA 2ZZQA 2RMU2 1WBFA 4P9YA 4FOWA 3HBZA 4QKNA 1VBD2 3RRDA 3U0ZA 3KV5A 3M2MA 5M0TA 3S57A 2IFWA 3I2HA 2J1SA 3POSA 3MIDA 2VCAA 4JGYC 5FYHA 2E7QA 4W6XA 1XE7A 2MHFA 2VZUA 4FPGA 4Y3OA 5JVVA 1NXD1 3ZN4A 4AHZA 4FTBA 2ID4A 2PHUA 3H1YA 2BRTA 2H6CA 1XNCA 4IDZA 2QQNA 3N7MA 4LIVA 4XBQA 3UV9A 5DUWA 1KQRA 3AJYA 2R043 2WS91 3BPSA 3NJYA 3AP9A 2UY9A 3AZWA 4CSWA 2BJSA 1V6JA 1FPN2 4EN0A 2VVFA 4CA9A 4YGBA 1AF9A 1IHMA 2QQJA 4JGYB 5JZGB 5K0UC 2VOVA 5E8AA 3SCFA 1RMU3 3BPZA 1H2LA 1S0DA 5JLVA 2VGDA 2VMEA 4R8HA 5C3QA 4LORA 4YM0A 1H1AA 1J84A 1MZFA 3Q8BA 4CCNA 1VAKA 5BNOC 4IE4A 2QCSB 4WM7A 2VO5A 1EAH3 4IV1C 2MNGA 4H7LA 5DZEA 4ES8A 5CBLA 2HWD3 2RJ2A 5GLWA 3FWEA 3WLUA 4GMP0 1NXMA 1PGL2 4MX3A 3M8LA 4BCUA 2J22A 1VRH3 1LEMA 1RVF2 2RG4A 3GBGA 2OUJA 3OEBA 3VZOA 3POEA 3ZDSA 2D6MA 2A3WA 5K0UB 2V73A 4IESA 5FKCA 3UGFA 3WNKA 4A7ZA 1JYIA 4YG6A 3RZLA 1RUI2 1XYNA 4LQRA 3I2FA 3OB8A 1REEA 1ZRRA 1ENSA 1V6NA 5LK7B 2G9FA 2XJPA 3LAGA 2WNEA 3I3EA 4QX0A 4QPYA 2W94A 4IV1B 3SH4A 4AFMA 2DVGA 1W6NA 4AE2A 2VMIA 2B45X 1R093 1DGLA 4WVMB 3AKQA 3K75B 3GGLA 2VUDA 2XL7A 3VHNA 3WEZA 3L2HA 1R1ZA 2O0OA 3QH6A 3IAPA 4PLNA 2VZ1A 5T5OA 1AXYA 4RYDA 5FO8B 1M06G 4QPGC 2GALA 4EROA 1Y9QA 3BU0A 3SH3A 5H9QA 2EIEA 1MZ6A 1YO8A 1DQ1A 5IK5A 1AYN1 1LECA 1EPWA 3HN1A 4FVVA 5K8SA 3WSOA 1WW7A 4UW4A 5FZ6A 4DUXA 1I3HA 1LU1A 2ZGTA 4GA9A 4XUNA 2XQXA 1R081 1HRV2 1UKGA 2YZ4A 5C4WA 4ATFA 4RGAA 1ZRFA 1WKYA 4S2FA 5JR7B 2YGLA 4LLOA 2WFF2 2Y26A 3IAQA 4BIFA 3HPNA 2WC2A 5EQUA 1RUJ1 1ALYA 4QQHA 5A7PA 1LULA 3PJYA 4FPOB 2HEVF 3MFCA 1W3XA 4NOTA 1LOCA 1DYPA 2BNOA 5A1LA 1WCKA 4QPGB 3K48A 5I0RA 4D6RA 3E6CC 4YZ4A 1S0CA 2CY6A 4QXKA 1BVVA 1WW4A 2DCYA 2MEV2 3GF6A 2D3RA 4WVVA 4YVWC 3SKJE 5FZIA 5I0DA 5JOYA 3OF1A 2D6NA 1W99A 4NWVA 5FZFA 4GJZA 4OI1A 3NMBA 2GN3A 2JDHA 3AMMA 1X36A 1VBC3 5FZAA 3IDAA 1KEXA 2IXCA 3ZFFA 1SLCA 4A3ZA 2C4XA 2JDYA 4FAHA 5EV7A 4N53C 2CL2A 1F4AA 1JTZX 1U5XA 3N9NA 5KHKA 4NPLA 2KXLA 4ARYA 4CDQB 5A6XA 3NNLA 2EALA 1Z7S2 4ES9A 1PHMA 4LITA 5LATA 2DCZA 3O0VA 2PXJA 1NCRB 1S55A 2WABA 2VJXA 4KI5M 2ZX1A 5I8SA 4NVPA 1NYWA 1UF2C 1VBB2 4E4HA 4BLIA 5FZBA 4YW2A 3LF7A 1OLQA 2AC1A 1W9TA 4UFKA 5CKMA 3B9IA 2EF6A 2Y6FA 4N53B 1REFA 2EXKA 3M70A 2VG9A 1YCIA 1F5JA 1W0PA 2EIDA 4GB33 3VZMA 3ST7A 3WG1A 1XU1A 3AZVA 2ERFA 5BNPC 1QJX2 4Q4W1 4H2AA 2QQLA 1W6MA 1ZRIA 1UPSA 3ETQA 1NA1C 1W3VA 5A3PA 2VTXA 2C6SA 2WIIB 3ZSJA 1BK1A 5KHIA 1RUC3 3T09A 3RQ0A 1V0AA 3ZFEA 4JDNA 2XBO1 4X6RB 3H8RA 4IEXA 5SV8A 3LOBA 4BQXA 3I97A 4IGPA 1LEDA 5EPAA 2QQWA 3ZXKA 5JDBA 4YZ2A 3DKQA 4DRVA 2ZGMA 4XMIA 2Q30A 1LESA 5IAVA 4UFJA 4FPFA 2GH8A 3WG3A 3FZ3A 4Q0PA 5IVVA 4I3GA 3PVEA 2YPJA 1Z78A 1POV1 4LOSA 4XJWA 2BOIA 2VNRA 3AP5A 4JVAA 2Q1ZB 4OQ8A 2ET1A 4I30A 3WF0A 2JIJA 3R4UA 5JI9A 1UN1A 1NA1B 5T5PA 4IEQA 3ES4A 3ZYPA 2YBKA 1NZCA 4GWIA 4Q27A 2VZVA 4QX1A 1QJY1 5JOZA 1IZ3A 3LFMA 4NMIA 4OVEA 4HMZA 4PBOA 1A6CA 1HRI1 4PBPA 3LSEA 3FL7A 4RHV1 4ZS2A 3BOWA 3ZXFA 5C6CA 2YY1A 2JE8A 4JGYA 5JZGA 4XTMA 3ALQA 1U12A 3UGGA 1S2EA 5L7OC 2GC2A 3VHRA 2EXHA 4JTOA 5HXVA 2Q8EA 4R9AA 2VBDA 2G19A 2Y6GA 1XSQA 2JDPA 5L9BA 1IS3A 4LA3A 3KV4A 4X8PA 3WR0A 2BPA2 3EQEA 5I91A 5HPOA 1ND3A 5FPLA 5F37A 1W9SA 4BH9A 5FYYA 2LS6A 1VLNA 3E6BA 1MEC1 4PQQA 3DGTA 1Y3TA 3NKTA 4XFIA 5KHGA 1XE0A 4KL1A 1PO22 5KC6A 5ERLA 2AGSA 4CXYA 1C8M3 3WUCA 5K0UA 4KQ7A 1V6IA 4F8AA 1PO11 5L7OB 2WQZC 5F5AA 4ATEA 1DGRN 3VD7A 3D3AA 2LUWA 3ZYIB 3RG0A 1F31A 4XQ4A 1BBT1 4G9SB 3MGUA 2RR12 2JDUA 2RS32 4BQ4A 5ANNA 3PIGA 1SFYA 2C26A 3KV6A 4WVMA 2JE7A 2DVFA 4AL9A 3Q8CA 1KJLA 1NY72 2BW8A 3EB7A 2KM2A 4LTAA 4P00B 1MS5A 3AKRA 1WCSA 4Y5SA 3QD6A 1D2SA 5AC93 4IEYA 4MADA 1FMD3 2YFZA 1LOGA 1URXA 2J1AA 5B4XA 5GZGA 1DZTA 4LUKA 2A6WA 2BOJA 4JQRA 5LA9A 5T5LA 5A3WA 3WW3A 4E8CA 3KSCA 5FPUA 1MVEA 4JX0A 2VMHA 1X9PA 3R0RA 3VL9A 2UYAA 1VMHA 2CTVA 4GKXA 3E5XA 1QNWA 4AZZA 5B4NA 4B4RA 1EUUA 5C7GA 1F35A 1ZREA 5CAZA 3MUZ1 4BLJA 3V56A 1W2OA 5L9VA 5IHRA 3VBFC 1P8JA 1AR93 1SZBA 4OZOA 5FYBA 3FFQA 4QQPA 1LKNA 1HB2A 4ZHNA 5A6YA 5FYVA 2XHNA 2W92A 2D3PA 4PF1A 1IS6A 4CDUC 4Q4Y3 5KXCA 1O3TA 3HJRA 4C90A 5LRRA 1GZ9A 4PI0A 3C7HA 1EPZA 1NCQA 2JDNA 3AMPA 5I8YA 1RUE2 4YW5A 1JYXA 3VBRC 3ZM8A 3N9PA 1BKZA 4Q4V2 2PA7A 4UXAA 1YIFA 1SBEA 4E4DX 3WF3A 3ZR6A 4MYEA 3VBFB 4CDQA 4MXWA 2B46X 3ZN6B 3O1SA 4K21A 1VALA 2LW8A 4DY3A 1OQEA 2L9LA 2X5IC 2E33A 1F8VA 2ZACA 5A6QA 1JZ6A 2HWC2 1NCRA 3D5OA 5DXDA 3WCSA 3RZGA 1O8PA 3PIJA 4CDUB 2BERA 4L9BA 4RL7A 1DZQA 4FP2A 1DGRA 1K3IA 3IWZA 1W6QA 5I93A 3M3EA 1LOAA 1GP6A 2JXAA 1GR3A 4JDOA 1C1FA 4CCKA 1S0IA 1UMHA 1S1AA 4O9EA 2W0XA 1VR3A 5J7MA 2Y0IA 1IS5A 1XYOA 2V09A 3E6DA 5E88A 3KF5A 4XOGA 1UWWA 2LRPA 4N53A 3RYRA 3GBWA 3S7EA 3ZO0B 3AYEA 2ZABA 3J26N 4LOTA 3VKFC 4N43C 3VL8A 1N1YA 1JZ2A 2Q4SA 1CWPA 2R063 2HWF3 3O1PA 3LDRA 1H6XA 3HBKA 4R4ZA 1WZXA 3IMNA 3CO2A 2X5IB 1OQ1A 3I2KA 4P9LA 3VB9A 2A5ZA 5FBJA 5HXMA 5CVRA 4BK4A 1OF3A 4E8DA 4SBVA 2JB8A 1SBDA 3GM8A 4FPLA 2YG0A 4QU1A 3PVNA 4XAAA 5FZOB 3RMXA 1X9TA 4MXVA 3ZKUA 1VBD1 4OI0A 5IAXA 3LIGA 4GZ9A 2VCBA 4B4PA 3A4UA 3KWVA 4BDVB 2QKDA 4CXWA 4DEVA 5CISA 1QHDA 5FYZA 4N43B 5EYYA 1KRIA 3OUJA 1GICA 3GBFA 4PHZA 2RHPA 1VBA2 4CYDA 2W3JA 4C8DA 5A33B 5EJ3A 4Q4X1 1NG0A 5FIXA 1QH6A 1S2BA 2JDZA 1FAYA 1YQCA 1QXJA 3W5NA 2HJIA 4S2DA 1LHUA 1LNSA 2JD9A 1ZBA3 4LBMA 1JODA 3QACA 3BTYA 4Z82A 2ZMKA 1MQTC 1AR82 1RUG3 3DYMA 5FXWA 1V00A 3J7HA 1IQAA 1FPN1 2A7AA 1YXWA 4PT6A 2Q8DA 4A3XA 1TME3 1POV0 3WDYA 2R073 3KV9A 4A6SA 1G6NA 4AFDA 1H0BA 3ZFGC 3H3UA 2TEPA 4M00A 2V72A 3AZXA 5F3EA 1OMIA 3NNGA 5BXXA 4Z2AA 1TZOA 3IT8A 2BFUS 2QZ3A 4QXHA 4EWAA 4FPJA 4JCKA 3I49A 4LO8A 1IG0A 3O7OA 2FDFA 2ZXQA 4CP0A 3DXTA 1E5RA 3IIIA 4LK7A 3WCRA 1PGL1 2ZS6B 1MQTB 3OBTA 5F32A 1N47A 2RMU3 1W05A 4FQZA 4R4XA 1H1IA 4ZU7A 1SG3A 1JN2P 4AQSA 4FO9A 5LB6A 1AYM1 3ZFGB 1IGOA 1K12A 4QX2A 3AMQA 4FPYA 4K20A 1N1VA 1RUI1 4ET7A 4FTSA 5LA1A 4W4ZA 1OKQA 5FREA 2ILMA 3VBHC 2CHHA 5L7OA 1UL9A 1PZ7A 3I2IA 3HOBA 1DG6A 3LE0A 4WV8A 2D5FA 1ZZCA 1GUIA 1BZWA 1PIV2 1V6LA 5C5TA 1AX2A 3WNOA 3UNPA 2BU9A 4AEDC 1JU3A 1NAEA 2ADEA 4R9CA 3VD5A 1RUOA 4NRPA 1J58A 1IPSA 1ODNA 4UI9L 2YMZA 5DUXA 2JIGA 4N90A 3FJSA 4Y1VA 4YW7A 3ZMOA 1PNGA 1UU6A 4I0WB 2BYVE 2D5HA 3B7MA 1QNYA 3MYXA 4Y20B 5F3CA 4OLLA 2AZ5A 3VBHB 4GH4A 4ZZ8A 1KS5A 1J83A 1HRV1 5C33A 1I9RA 4YGCA 3TBDA 1MS0A 2OQ7A 5A32B 2PAMA 1RUD2 3USUB 2WFF1 1HB4A 1QQP3 3U37A 2H0BA 2RS52 4K6BA 3VLBB 1U5IA 4XYXA 2I45A 2XJVA 3WF2A 4LNVA 5FRAA 3WP5A 1RUF2 1NKGA 4QX7A 4DUVA 1UXZA 1JUHA 2MPFA 2W47A 3B02A 3FUQA 3SEEA 3ZXDA 2P37A 1F15A 1RVF3 3I7DA 2MEV1 4A41A 3OD4A 4BJ0A 4CP1A 5J98B 1MS9A 4MLOA 1GP5A 5B2GB 3T0DA 3T3YA 1GKBA 4BOWA 1VMFA 4LBOA 4HKLA 4OHVA 3PDQA 4Q1RA 4LBQB 4LO6B 5JXJA 3SKVA 5FLIA 2FDHA 3SISA 3PTRB 3S0MA 3PUQA 3LSDA 2OT7A 3TEWA 4HANA 4WM7C 2FDJA 1Z7S1 1IG3A 1VAVA 4W65A 4NHMA 5F2WA 4CUGA 3TEZA 2FDIA 4MGTA 4UFIA 5FFOC 3VBFA 3MW2A 2RM22 2XJTA 4L92A 3ZN6A 2OPKA 4AI9A 5K7PA 3I3DA
chains in the Genus database with same CATH topology
1VBB1 1S0FA 4LT5A 3ILRA 2FMDA 2W39A 4E2SA 3WHUA 3I4IA 4YM3A 5JOWA 4HPKB 1HRV3 2SLIA 3I54A 1RINA 4H7MA 4H55A 4WM7B 5A3LA 1QJX1 1OA3A 4QT6A 4AQ6A 1YJLA 2ZGOA 1D0HA 4AFAA 1CAXB 3EXUA 2X5IA 2WWSA 4FT8A 4PLMA 3PVOA 3W9AA 2VQAA 2UWBA 3PMSA 3WD5A 4EWDA 4D94A 3I8TA 2D6PA 2GH2A 1GBGA 3HR9A 1U0AA 4QGMA 3RI9A 3TN93 3J8F2 2YGMA 4XF0A 5C4WC 2Y38A 1W6NB 4FOQA 1OLRA 2W68A 3VN4A 2PLV3 5BYNA 1MACA 1REDA 5J48A 1AR72 1ONAA 4OHYA 3FE5A 4P9WA 3HQXA 2NLRA 4XTPA 1PZ9A 3S30A 2DVBA 2AYHA 2UURA 4BM8A 1XNBA 5EXOA 3VBSA 1N3OA 4Z07A 2Z5WA 1L3JA 1BMV2 3ECQA 3IBMA 3RPQA 3WP4A 5C4WB 1C4RA 2NP0A 1SBFA 3AX4A 2IXLA 2KA3A 1HDKA 1VIWB 1S2KA 3N35A 4WZCA 4BE3A 4YZ3A 5FOBB 2LM3A 4I09A 4D7TA 1OA4A 5I0SA 2YHJA 5K9YA 4Y24A 4RR3A 3WDVA 2GC0A 5HCBA 3WOGA 5KXBA 4C1XA 4DNYA 5AFBA 3HT2A 1N1TA 1G9AA 2WSVA 1AXZA 2JENA 3OGJA 1DFQA 3N4MA 3OPZA 1FV2A 4DXZA 1V9U3 2RR11 4HVRA 4N7IA 1ASJ3 5T5JA 1Y43B 1ZRCA 1NY71 4OUMA 4TWTA 1G9DA 4IEVA 4QGNA 4I0BA 4K7JA 2DCTA 1D4M1 3KM5A 1WD3A 1XE8A 2AR6A 1PVC2 1EY2A 1WGPA 1JH5A 1HKDA 3VBHA 4CEYB 1JHNA 5A32A 5JAXA 2XJUA 2R6QA 2F4PA 1O5LA 4LA2A 1CONA 3AZYA 1W6MB 2D93A 5H9SA 4L97A 4COYA 4XBNA 5IUQA 2WINB 5T54A 2WSUA 1QMJA 3INAA 1OOPB 2C0ZA 4FCAA 1FT9A 4A2UA 1PO23 1O3QA 2GNMA 4XJZA 4HKWA 5GALA 1JOJA 1R1A3 5J36A 4DOUA 1LODA 3E5UA 3ME2A 1RUE1 5JZGC 4IXLA 4XBLA 2ZMNA 1JUIA 1ZBE3 2JECA 4LBQA 1RJ8A 4SLIA 2RR13 4Q4V1 4HN0A 2RS33 2HWE2 1RUH1 1COV3 1MVQA 4WM8A 5GZEA 1MS4A 4Q4X2 4O9GA 3NAPA 4NHLA 1ND3C 4AXOA 2HWC1 1ENRA 4Y5Z0 4EWEA 2EXIA 2WZR2 5BUVA 2BTVC 4CDXA 5GJ6A 1YIPA 1Q3EA 2VW1A 3VZJA 5JWPA 2DYCA 4INDA 3NV2A 4ISQA 4OZXA 4RQPB 4H3WA 4HVOA 1APNA 3THPA 3AKPA 4HPKA 5CIRA 4YW4A 1ENXA 4Z1VA 1WA4A 4YFWA 1N3QA 1ND3B 2BFUL 5T55A 2X53S 3AYDA 3MIHA 2XH6A 4FP3A 2EIGA 3V64A 4ZKTB 3QBQA 1CAXA 1NQJA 3VKLA 3PVBB 1O4ZA 1QJU2 4MGYE 2XLAA 4XFHA 1AYM2 1Q8QA 1CVNA 2ZGLA 4YW3A 2DV9A 4JGZC 1TEIA 3CU7A 2RS12 1X7NA 2B39A 1VBA1 1H8VA 3ROUA 4KNCA 3VHOA 1NOVA 5HCAA 1WUVA 3RSJA 1X33A 2BWAA 4DY5A 4LHNA 2QQPA 3IPVB 2VNGA 2ZOEB 1AR81 3BOPA 4AI2A 1ZZ7A 3B9CA 2WS93 4I3PA 1N3PA 1AL21 1Q8VA 1LCLA 5L73A 1LENA 1QOSA 5E89A 2E53A 3AXEA 4JGZB 3M1HA 5DDJ2 5D8AC 3VDDB 4HK9A 1NCQC 5DG1A 3NO8A 3RJ2X 4COVA 1BEV2 3MF9A 2BWCA 2JKBA 4XFAA 3N7KA 3KGZA 3MPBA 3MI8A 3NV3A 4W6YA 3BTAA 4M01A 3OY8A 2A71A 4CDQC 3RMYA 3LB9A 3WW4A 4D7YA 5ACA2 3V0BB 2A3YA 5HBAA 3JQWA 1NCRC 2YV8A 1UZZA 2OIIA 3A0NA 3TOJA 3VKNA 1MS3A 3BALA 5D8AB 2ZGRA 4I02A 1NCQB 5FLJA 2VVDA 4MV2A 4Y1UA 4XJUA 3VKOA 3FBMA 1OFNA 1PIV1 1J1LA 1RHI2 2AUYA 4MXWB 1ZZ6A 5AVAA 2VW2A 3PMEA 1X82A 2NMNA 4YNIA 3M3CA 4XIKA 1YYNA 1PGW2 3M3QA 1W6QB 1H2MA 4AQ2A 5H9PA 1GFF2 1QY4A 3QCWA 1AYN3 2DFCA 3AJZA 1DLLA 2RE9A 4KU8A 1ZA4A 5GM0A 4AYUA 4YSFA 1ENQA 4JAAA 1R083 1RUD1 2R1DA 1C1LA 5F6KA 5F1RA 1FX5A 2RS51 4AK3A 3VZLA 4CEYA 5FCCA 4MSVA 4HSJA 1RUJ3 1RUF1 1Y7BA 2DTYA 3JQXA 4NPRA 2GNDA 3NKGA 3AMNA 3UJOA 4BMEA 4FSJA 3OBRA 2ZBJA 2ZGSA 4OUSA 3AZZA 3FBYA 3RWNA 2PHRA 1H4HA 1OOPA 4GKYA 4D69A 2TNFA 4IL7A 2CAVA 4JDMA 2YXSA 2RJLA 4PCRA 2ZX4A 3TRSB 1S0BA 5JSPA 1HXS2 4NR1A 4N9HA 4YG3A 2IC1A 2EA7A 4HETA 3ZN5A 5JIUA 3GALA 3VBOA 3VV1A 4XJAA 1AX1A 3H8UA 5J09A 3FFZA 2RM21 4AEKA 2DTWA 3S6PA 4ZU5A 4AGRA 4GIQA 1F9KA 4YYOA 1OD5A 5BY5A 4HLTA 3ZYGA 2P34A 1LGBA 2HYKA 4RQPA 4YFZA 3WQ1A 3B93A 4G4FA 3HMYA 1AUYA 3MIGA 3MLKA 4FXGB 1AR62 5CNAA 2C9AA 4Q4W3 3RNSA 4XZPA 3UKNA 3NL1A 1LHNA 2E7AA 4E4SA 4KGGA 1FATA 4LO7A 1EYBA 2XBO3 1A3KA 4X8NA 3MFAA 2LTNA 3C2UA 1ZM1A 2XHKA 2XG3A 2WL1A 1W6OB 2QNKA 3JD72 2VVEA 4GH4C 2B5HA 3J8F1 4C0HA 3FMGA 3CL1A 5FAXA 1POV3 1ZYBA 3NVCA 2K9ZA 5BNQA 1AR71 2O8QA 1CAWB 4MVTA 2DU0A 2GMEA 1WW5A 3UK9A 3QH7A 1QJY3 3O0WA 3IPVA 2OZJA 4PQ9A 1BCXA 4XFBA 1HRI3 4RHV3 2R16A 1BMV1 1ZRDA 4GH4B 1D4M2 1FI2A 1UU4A 1HV1A 4JGZA 2UYBA 4P9XA 1LGCA 3JB4C 3VDDA 2ZAHA 2V5YA 4LLFA 4PF5A 1XQNA 2R49A 2XUMA 3ZSMA 4NWWA 1FV3A 3TB0A 1H8TA 3V0BA 4M0NA 3WP3A 1MEC3 3MW3A 1ZZBA 1SLLA 4QPIB 2ZKNA 4LBKA 3O5SA 1KS4A 1SCSA 4AF9A 1Q56A 1CD3G 2A70A 4MZUA 5D8AA 5EWSA 1RMU2 3U4XA 1PO13 2DF7A 3UKTA 5GZDA 3KLSA 5E1RA 5GLVA 1BBT3 3UL2A 4U2AA 2XLFA 2I07B 4HZFA 4FOVA 1RUH2 1I6XA 1VB4A 4B7EA 2BNNA 2HWD2 1DGWA 1KFUL 3VKMA 1YUDA 4P5HA 2BBVA 1J3PA 3MIFA 5J3UA 3L2YA 2XLGA 4Y22B 3MPPG 1OFSA 3DF0A 1FYUA 2ZGNA 3WXPA 4PDWA 1PVC1 4CZSA 3SITA 2FQPA 2E51A 4K1YA 5IK8A 2A6ZA 3N7JA 3FLTA 1X8EA 4M3CF 4GALA 1J3QA 2YYOA 3MF6A 2DUQA 4DFSA 2R32A 2CWSA 5FDBA 3WUDA 1FOD2 4AVSA 3VHPA 3JUUA 2P3JA 3TNQA 2EAAA 3H50A 2ZHMA 4OI4A 1HIXA 3VBSC 1PZ8A 2AENA 2HKXA 1UIJA 4CEWA 2D3SA 1ZZ8A 1C3HA 1ULFA 3FUOA 2VUJA 1VP6A 3GHNA 3ELNA 2HWE1 1QOOA 4RD7A 3GZAA 1S0JA 4KU7A 2ZPXA 1ULCA 3KCCA 4AI3A 2X29A 4RR3C 2WZR1 2WT0A 4WZFA 4XIOA 3VBUB 4HVQA 3VBSB 1PK6C 4YW1A 1AL22 1EP0A 2XL9A 1VBC2 4ZU4A 4AG4A 2WLQA 3MZHA 1VBE2 4YZ5A 4YARA 5HCFA 1V6KA 3DPRA 1CAUA 5BNNB 2QJVA 3BB6A 3MW4A 4Q8KA 3LZZA 2CAUA 4MUVA 1VJ2A 4AWDA 1AHSA 4RR3B 2WQ4A 3RI8A 3SCGA 2D6OX 1PK6B 3AMHA 3LCPA 3D0JA 1UAIA 3OYWB 1QJU1 3C3VA 4P14A 4LBQD 3IN9A 1VBD3 4EN6B 5CFDC 3ILNA 1UD1A 4YZ1A 3R4SA 1W6OA 1QWRA 2RS11 4CRQA 5FPZA 4GB32 5I0TA 3M7AA 4UBGA 1ZNPA 4XXAA 2ZHKA 2RJKA 2DUPA 4Q4X3 1UIKA 4Y4YA 2NYYA 3OD0A 2B9UA 1CAWA 2VNOA 1YJKA 4I0AA 3RS6A 1YWKA 3GYDA 4K8FA 1RUC2 2DFBA 4KBBA 2D40A 1GNHA 2ZX2A 5CFDB 1FPN3 1SLIA 2D44A 3IKWA 5KC5A 2B42B 5DDJ1 1SFNA 4QHBA 2ZGPA 3KB5A 1QXRA 1BEV1 5IK7A 2F6BA 4C1WA 2B7YA 2GC3A 3NJZA 4QQLA 4B3NA 1UX6A 3CNAA 4MGIE 5ACA1 4WM8C 4R52A 3NAPC 2XJSA 2XVGA 3G7DA 3FLRA 2E6VA 4XMAA 1DQ5A 1CPMA 1EV11 4KG8A 4IETA 2UY8A 4QPIA 4CDXC 5C8CA 1AYM3 3HAGA 2VMGA 1LB2A 3ASIA 4W6WA 1RUI3 3M3OA 3O12A 1WW6A 4OHZA 1GNZA 4MGKE 4C91A 1RGSA 3AK0A 5FLHA 1RHI1 1WLWA 3S7IA 4AFBA 4WM8B 3NAPB 2PHXA 4TZDA 4AVTA 1Q43A 3DN7A 1UU5A 1PGW1 4NO4A 1U5ZA 1MS1A 2HWB1 4CDXB 1KXGA 1BQPA 4Y22A 2PHDA 4ONUA 3ZSEA 1C8M2 2BNMA 2E63A 2A73B 2VULA 2HEYF 1CX4A 2ZA9A 2GC1A 1JXNA 2D7FA 3SMHA 1ULGA 2WFF3 4DB5A 3EO6A 2Z42A 1J59A 1WLTA 2WNVB 5L36A 4B29A 1NE6A 2JJ6A 4M0HA 3T1MA 2BGCA 2D6LX 1GZWB 1LJ7A 2MEV3 2UWCA 1RIRA 5AC92 5L19A 2JG8C 4GULA 1XU2A 1FMD2 4IEWA 1JBCA 3LA2A 1HXS1 4Z2WA 5DZGA 1NLRA 2SBAA 4J6GA 3OCPA 3JU9A 1O4TA 1XRUA 2FMYA 2XJQA 1RC6A 5GLZA 2I74A 4PIZA 1FNZA 1Z7S3 4BA6A 1GZCA 2G4IA 2PHWA 5C9AB 1AR92 1QH7A 4GWMA 2XPJA 1CJDA 2G9GA 1UW8A 4FOYA 3WV6A 1OPMA 1VBB3 1DQ4A 2JG8B 2DVDA 4K3UA 4YGDA 1YFYA 3U10A 4B4QA 5F6LB 3VBUA 2TUNA 3ATGA 1DYKA 4Q4Y2 4A7YA 4XF1A 3ZSLA 1QXPA 2NMOA 1BVP1 1KITA 4GQ7A 4IEOA 4Y1ZA 3KD4A 1UMZA 1KJRA 2Z69A 1AR61 4XQDA 1XNKA 1B35A 4KWKA 2DU1A 1ZVFA 5I0UA 1QJX3 4M3CA 1Q8SA 3OY8B 5BNNA 2P3IA 1LOFA 4EN9B 5T50A 2PQQA 3MICA 4IEUA 2ZMLA 3BU7A 1PK6A 2D6KA 4F3JA 4HSLA 3OYWA 4X6QB 5CADA 2ARBA 5IK4A 1IOAA 1C28A 2WNUA 1C57A 5J37A 1H1MA 3JD71 4NHKA 4CDWC 4LHKA 4RS5B 5JPMB 4CEYC 1GQHA 1VB2A 2R062 2HWF2 2XGXA 4E9KA 2ZGQA 3AXDA 2XWJB 1WD4A 4HBNA 4LE4A 2VOWA 5T52A 3J4UH 1OOPC 1W6PB 1YFXA 5CFDA 4QU2A 1GSLA 4CDWB 2GAUA 3W58A 5F9TA 2ZHNA 4Q2FA 3LKJA 2WLPA 2WA4A 3H7YA 5D1IA 2IFRA 4UBHA 1OPOA 4XF3A 3VBOC 3FX3A 1QJZA 4I2OA 4PJYA 2Z79A 3CJXA 1XXNA 4XHXA 1ZBA2 2VXRA 2R041 3KQRA 1I1EA 5DG2A 3MIBA 3POYA 1RUG2 1AVBA 4KG0A 3KCXA 2VU9A 1TME2 2R072 3IM0A 1RMU1 2P3KA 3JCIA 4QQOA 1ZZ9A 4RQPC 1O5UA 3MEPA 3KT7A 1KDMA 1LOEA 2WZPP 3VBOB 1EAH1 2GSYA 2FZ2A 4TYSA 2HWD1 2ZKLA 1O7FA 2ZGKA 3JZVA 1VRH1 2VOXA 4YVSB 2FHRA 4BPZA 4FAGA 2DVAA 1F2NA 1TNRA 1D4M3 3VZNA 4BMBA 3V0AB 4K9SA 2ZZJA 4OI2A 1AJKA 4LR4A 3WQ7A 4AFCA 4LBLA 5EYXA 1U5YA 3VGIA 3BCWA 1WLDA 3SCHA 2IWGB 3BODA 4LBJA 3CJIB 1R091 2GNTA 2VQ0A 1O91A 1QOTA 2WNVA 1AL0G 4LO5B 3V65A 4Z92B 1FOD1 2VOKA 5GLUA 3RDIA 1HQWA 1PM7A 3GNEA 4DMIA 1GZWA 3MDPA 4LBNA 3PJQA 3D0SA 1SLAA 3LWCA 3KZ4C 3GHMA 1YNAA 4E27A 2CWMA 2PYTA 2NQYA 3Q9OA 1YFWA 1RUE3 4KWLA 4E4ZA 4IEZA 5JMCA 1AJOA 2GN7A 3VDDC 1ZX5A 3I2DA 2D98A 4P9GA 4Q0QA 3IDBB 1QQP2 2VUAA 4Q4V3 1RUH3 4I01A 1NE4A 3FHIB 1I5ZA 5HI0A 2IZWA 4AW7A 1H8TC 3SHRA 2HWC3 3T1LA 5C9AA 1SMVA 4J1XA 2E9QA 5CFCA 4BWOA 2E7TA 3B01A 3WX5A 2JG8A 5KWRA 4LEJA 1WMEA 2OA2A 1VBC1 2VH9A 3WDTA 3L9JT 3IDEA 1VBE1 5BNOB 3O0XA 1T6GC 1OQDA 2R0FA 3LGRA 3OTFA 2PAKA 3M3IA 1G8WA 4Q0UA 3MLLA 3WINE 3KCYA 4XXPA 2DUOA 2B8MA 1FOD3 1H8TB 2AREA 5ABJA 4COWA 2WT1A 3B94A 3KGLA 3KT1A 4LHLA 4OFGA 3W59A 4FTSA 5FO7B 1EV12 3X29B 1DIWA 1LRHA 2CGNA 1NLSA 4PDWC 1OA2A 3AYAA 5F5QA 2PHLA 1SDWA 4YLZA 3MLJA 4GB31 1X50A 4BZ4A 1SEFA 3MIEA 4DZGA 4B8EA 1VBA3 4RS5A 5I8TA 1D2QA 4BIOA 5FQ0A 3KMHA 3H1WA 4HFSA 3JB8A 1RUC1 2A6VA 1AR83 4LUMA 2HWB2 1CAVB 1AL23 1YI7A 1V6OA 5JCTA 4PDWB 3DKWA 4DS0A 2EXJA 4B7KA 1W6PA 4FQ4A 4CEWC 1GQGA 2ZAAA 1H9PA 1VBE3 2X8KA 3TN92 4CDWA 3LOIA 2IXHA 3R4DB 4HT1T 1IS4A 3UJQA 1WCDJ 2PAEA 2PLV2 1HQNA 3TWIA 2FZ1A 3R05A 4OULA 4IV3C 3URFA 4FPKA 4YVWB 4FTEA 1CR7A 1QDCA 3QLQA 4QM8A 4QX5A 2JG9C 2IXJA 4CEWB 2Q0AA 4ITCA 3ZMNA 3ZPYA 1XYPA 4UW3A 1K5MC 4IERA 4CP2A 2TBVA 3DPRC 4F83A 3SXWA 4E2GA 1PIV3 5CG9A 2DURA 2VY0A 4IV3B 3AB0A 4Y1XA 5GZCA 3B00A 4R9BA 2R0HA 4WBBA 1ULEA 2PHFA 4JV4A 5E16A 2JG9B 4QQ2A 5FO9B 5LEKA 5EFUA 1G9FA 4XF4A 2JEMA 4YVSA 1C8M1 1ND2C 3AP7A 3WDWA 1TMF2 4Q0SA 1K5MB 2WJSA 5DUVA 5CU1A 5I91A 1LTEA 2GNBA 2YROA 3V0AA 4H14A 1RUD3 3DPRB 2QVSB 1CAUB 2ARXA 1SQ4A 1BJQA 1LHWA 2QUOA 5BNPB 2RS53 1V9U2 3N7LA 3ZIWA 3CJIA 4XJ9A 1ASJ2 1RUF3 1W2UA 1RJ7A 1SCRA 4BYYA 1CN1A 3WW2A 2QDNA 4P9JA 3U11A 4YRDA 5AC91 1ND2B 3PNAA 3AFGA 1FMD1 4AVVA 4S2HA 1DU3D 4AVAA 2BEOA 4DRRA 3ZXEA 3PHMA 1Q8OA 3WG2A 4QD2A 3WG4A 4XE9A 5FPXA 3JBG2 1LHOA 4AVBA 4JRAA 1DDLA 1UPIA 1QKQA 1V70A 2Z2SB 4L99A 2IXKA 2ENRA 2BQPA 3ZXJA 2W52A 1AR91 2RM23 4Q0VA 4AEJA 4UW5A 5KHHA 3DL3A 2ZTNA 5T3NA 4AQTA 4META 4Q4Y1 2VW0A 3R6SA 4QPIC 5C8CC 4TLFA 1R1A2 1DGWX 4AHWA 4ISRA 1HV0A 1WBLA 3J9SA 1N1SA 1H9WA 3D82A 1ZBE2 2QDRA 4M3CE 5BNOA 2WA3A 3HIFA 4IV1A 3FC0A 3EJKA 2UWAA 4PIXA 4YGEA 1COV2 1A78A 2Q1MA 2ZGUA 4LE3A 4QMAA 1QU0A 1B09A 4UW6A 4D7SA 1MZEA 1HX6A 1KDKA 2N7GA 2R042 3VZKA 1PMIA 2OUHA 5C8CB 2AH2A 5IT6A 1LHVA 4R9DA 1RB8G 3CF6E 1CPNA 3ES1A 2GDFA 3HD8B 3USSA 2FBEA 3NV4A 3J8F3 2LALA 4HK8A 2WKKA 2XJRA 4XDQA 2D97A 2R061 1NQDA 1BYHA 2HWF1 1IKQA 1ULDA 3E97A 4XHBA 2CGOA 1EAH2 3N3HA 1AR73 3P3NA 1LGNA 3IIAA 1TE1B 3WT3A 4AGGA 2GMMA 4QPGA 1Z0HA 1G9CA 2A6YA 1AX0A 3AP6A 1VRH2 4XFCA 4EV0A 1PGSA 5EZWA 1CAVA 1UZYA 5GZFA 2ES3A 4Q26A 1DF0A 4JRLA 5LRSA 5KHJA 3B69A 3G6JB 1W39A 1QGLA 2ZX3A 1YI9A