5EFUA

Resting state of rat cysteine dioxygenase h155q variant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLQLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Resting state of rat cysteine dioxygenase H155Q variant
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5efuA00
2Q4SA 3KCCA 4D7SA 1QY4A 5FLJA 4MGKE 1OI6A 3BCWA 3SHRA 2VECA 4MX3A 3NSTA 4BYYA 1EP0A 3OD0A 1TQ5A 4META 4YYOA 3E5UA 4I02A 2D5HA 1LR5A 1O4TA 5LRRA 2XKOA 4X6QB 2CAVA 4XFFA 5KHKA 2OZJA 4WZCA 3H1WA 1UIJA 4A2UA 1OMIA 4XF3A 2I45A 1O3QA 2WFPA 4PIZA 3ES4A 4YRDA 4MUVA 3NVCA 4PJYA 4XEZA 4X6RB 3CEWA 1CAUA 3E5XA 2HKXA 4KU8A 2Z2SB 1RC6A 1CAXB 2QVSB 3RDIA 1DZTA 3ACLA 3M70A 2CV6A 3UKVA 3BPZA 2BYVE 3H8UA 4IEWA 1LB2A 5FCCA 3E5QA 3S7IA 3HT1A 1J58A 2O1QA 5FLIA 2H0VA 5BPXA 4QM8A 2UY9A 4QM9A 4MGIE 3C3VA 3UKNA 1ZVFA 4HSJA 2OA2A 3TNPB 4Q0VA 4O9GA 1J1LA 3HIFA 4FBFA 2FQPA 4QGNA 1J3PA 3HT2A 4ONUA 4HVOA 3OTFA 5I8YA 2MPFA 4QX5A 1XE8A 3SMHA 4XFIA 3U0ZA 5D1IA 5KHJA 4JV4A 4QXKA 1U12A 3RYKA 1O3TA 4ZU7A 4NVPA 3QACA 1GQGA 2IXHA 4WBBA 2GC0A 3LZZA 2K9ZA 3RZZA 5F1RA 4EWAA 3RYRA 3ETQA 1VR3A 5FDBA 1YUDA 3MZHA 4HZFA 4HVQA 2P17A 4XF1A 2ET1A 2CGPA 3GYDA 1UIKA 4XF9A 1NE6A 1RTVA 5I91A 5I0RA 2XL9A 4R8HA 4YNIA 3RPQA 3LAGA 2XKPA 2F4PA 4F8AA 3R6SA 1DGWA 3EJKA 3L2HA 5JSPA 1J3QA 4JTNA 2E9QA 2IXCA 4IEZA 1ZREA 1YFWA 2D5FA 4TLFA 5I8SA 2V09A 4KWJA 3MDPA 2MNGA 4FT8A 4LLOA 4EWDA 4Q29A 2IXLA 1V70A 4H7LA 1PMIA 1QXJA 4I09A 4AVAA 2CAUA 3I54A 3I59B 3I59A 3ZDSA 3ES1A 2XLAA 4HN1A 1UCXA 4OFGA 2Q30A 2Q0AA 1RUNA 1RUOA 1CAVB 1QXRA 1YFUA 5CVRA 4MH0E 4WVZA 4B29A 4AQ2A 1FT9A 4XFHA 5EFUA 1ZZ7A 4Z07A 4E2SA 1ZZ6A 1LKNA 3OCPA 1CAWA 4OLLA 3G7DA 4HN0A 5I0UA 4QGLA 4HBNA 1VP6A 3OGJA 1NE4A 3WW1A 4IERA 1Y3TA 1J3RA 2XLGA 3H1MA 1ZZCA 1ZRFA 2BGCA 2VPVA 4BH9A 1DZRA 3LWCA 3IIAA 1UD1A 3WW2A 3RYPA 2GC3A 5JAXA 1SQ4A 1XE7A 2H6BA 3PLQA 4XETA 4I01A 4E2QA 3EQEA 4UBGA 5LEJA 5FLHA 3IDBB 3FJSA 5CADA 2HJIA 2BEOA 2GU9A 3BB6A 2EVXA 4Q0SA 2PYTA 1H1MA 3ELNA 2B8MA 2UY8A 1Q3EA 4LA3A 1SEFA 2OYZA 2Y0OA 4N9IA 3KMHA 1RL3A 4EV0A 1SFNA 1CGPA 3S0MA 1WLTA 4IEUA 3D0SA 3BU7A 4XFGA 3GBFA 1YLLA 2OPKA 4HSLA 2B9UA 1ZRCA 4LTAA 1L3JA 1GQHA 5EZWA 3DL3A 2PAMA 2IXJA 5I93A 3MPBA 1EYBA 2QNKA 3BALA 5BXXA 5K8SA 2PAKA 4KWLA 3IBMA 3EHKA 3FFQA 3SXWA 1X8EA 4IESA 2XHKA 2PFWA 2QJVA 4IEQA 1WA4A 4ORFA 4Z82A 2K0GA 3IDCB 5CU1A 1XRUA 5E16A 1HW5A 4FAGA 3FE5A 1UPIA 1UW8A 1WGPA 2UYAA 3EO6A 3U10A 4XF4A 5C6CA 4PIYA 5J3UA 3LA2A 4P9GA 3USSA 3NL1A 1O7FA 3PVBB 3B02A 2PHLA 1ZRRA 2O8QA 4IEPA 4XFCA 3OF1A 4XFAA 4KU7A 1CAUB 1I5ZA 3H9AA 4UBHA 4Q0PA 5T3NA 1NXMA 1PM7A 4IETA 5FPZA 4MV2A 1OD5A 3CL1A 4JTOA 4HMZA 4O9EA 1YWKA 2ET7A 2PA7A 3WW3A 3KGLA 4YSFA 2QDRA 1EPZA 4AQ6A 5KHIA 5BV6A 1I6XA 3FZ3A 4LEJA 4ZU4A 1ZZ9A 3E6BA 4N9HA 2UYBA 2D93A 3O14A 4KWKA 1LRHA 4J1WA 3QOPA 1CX4A 1ZZBA 1O5LA 3ROUA 3I7DA 3H50A 2PQQA 2PAEA 1IPKA 2N7GA 2IC1A 5J48A 5E1RA 3FWEA 4JVAA 1ZRDA 2GC1A 1X7NA 4AVBA 5JSOA 1O3RA 3NKTA 2C0ZA 4DINB 3LA3A 2Z69A 4D7TA 5FPXA 3SCHA 1QWRA 3FX3A 3PNAA 2KXLA 3RNSA 5FQ0B 4IEXA 4LUMA 3ST7A 1O3SA 3E6CC 3N4MA 1YFYA 5FQ0A 1NYWA 5JSRA 2ZCWA 3LOIA 4L11A 4MGZE 4L2NA 2QCSB 3DKWA 3E6DA 4KL1A 2DCTA 2GH2A 3NJZA 1YFXA 2BNMA 1EY2A 1G6NA 3DV8A 4GULA 3KSCA 2MHFA 3D0JA 3U11A 3FHIB 2VQAA 2IXIA 4MGYE 3CLPA 4YARA 1CAXA 4F7ZA 3NW4A 4CYDA 1Q43A 3E97A 2ZKLA 3H7JA 5J7MA 4EROA 2BNNA 4Q0QA 1JUHA 3H3UA 3EBRA 4XFBA 4AXOA 1CAVA 1FXZA 2PTMA 3CJXA 5BY5A 1Y9QA 3JZVA 4QMAA 5LRSA 2XLFA 2IXKA 5HI0A 3H3ZA 4HLTA 4J1XA 1DGRA 4AVCA 3SCGA 4EWEA 1CAWB 5KHHA 4E2GA 4I3PA 2XL7A 4XF0A 4K8FA 3CF6E 4ZU5A 4LUKA 4HVRA 1Q5OA 4IEOA 5I0SA 3LA7A 3MYXA 2XGXA 3S7EA 5I8TA 4I2OA 5LEKA 4LULA 3UKTA 4IEYA 3H1YA 1ZNPA 4FAHA 5BUVA 5JR7B 2OZ6A 2D40A 3DN7A 5I0TA 3IWZA 4PIXA 4UXAA 3HQXA 2B5HA 3TNQA 5C8WA 4RD7A 1NZCA 5KHGA 4MZUA 3D82A 1IPJA 1RGSA 3VHRA 5JCTA 1OFNA 3WW4A 1ZZ8A 2ATFA 4IEVA 4R52A 4QGMA 2FMYA 4I0BA 5AVPA 4Q0UA 1FI2A 1O5UA 2Q1ZB 4BHPA 1VJ2A 3M3IA 1YHFA 4BIFA 2EA7A 1J59A 4I0AA 2BNOA 1ZX5A 2H6CA 2WC2A 2GZWA 2EAAA 2ETEA 5KBFA 1X8MA 2GAUA 2GC2A 4LA2A 3CO2A 3KGZA 3H7YA 1H1IA 1X82A 2PHDA 3SCFA
chains in the Genus database with same CATH superfamily
1XBFA 4Z8BA 1H30A 3NNJA 3BUCA 2QQMA 3KCCA 1N1TA 4RSUA 4N43B 1YIFA 5JVVA 4D7SA 2V73A 5FLJA 3DUIA 4MGKE 1OI6A 3BCWA 2EXIA 2QDNA 1OXCA 2YUEA 3SHRA 4HETA 3CNAA 3NSTA 4ZKTB 2EAKA 1EP0A 4YM2A 5DAQA 2VMCA 2RS32 4QPGB 1N1VA 4JGZA 1TG7A 5BNOA 5A1LA 3VKOA 2V72A 4KGQA 4IE7A 1W2UA 2CAVA 5IK5A 5B4NA 3MV11 1SCRA 5CG8A 2QQKA 3THDA 2PHTA 1H8TA 4WZCA 3H1WA 1K5JA 5A7SA 1DCSA 4Q26A 2JDMA 2FD8A 3R4DB 3WDVA 1UU5A 2A6ZA 2PHFA 4YRDA 4E4HA 2DFBA 4YFWA 5D2AA 5GJ6A 3WSOA 3ZMOA 1VMFA 2ZGPA 4FVVA 3VBUA 3INAA 5EJ1B 1XNAA 3AKPA 3E5XA 2Y8KA 5EYXA 2Z2SB 1TME2 1TMF1 1CAXB 5J09A 3ACLA 5EXOA 2CV6A 3O5SA 4CCDA 4JQTA 1FOD3 3S7IA 3WNOA 1OURA 1JTZX 1F5JA 1OC1A 5DDJ1 1MEC2 4CXWA 4WVMB 2UY9A 3WP5A 2WS91 1QQP3 5CISA 1W99A 3ZFFB 3AX4A 4Y22A 1UPSA 3DF0A 5KC5A 5FZ3A 1AR83 4KGGA 1IS4A 1F4HA 2RDSA 2ZMNA 4UFHA 3VBSB 3VDDB 2OA2A 2VAUA 3VBFC 3N7KA 2O14A 4LBOA 4GAZA 4YG0A 1OOPA 2WLQA 1GP4A 1W6OA 2VZVA 4LO4B 2W95A 4BA6A 2HWF3 4ARXA 4WM8A 1MQTC 1FOD2 2VUDA 3WEZA 4E4SA 2W46A 3OTFA 2MPFA 5CKQA 1QJX2 1JUIA 2WYSA 4OHWA 2C9KA 4ITCA 4XC9A 1BLZA 3U0ZA 3AKTA 1KFUL 1GP5A 1H9WA 1N1YA 4P9XA 4AAXA 1ZM1A 1ENXA 1TME1 2JDAA 1MVEA 1U12A 1UU6A 4GZ9A 4QXKA 1GOGA 3EYPA 1OPOA 3VD7A 4ZU7A 5A7OA 2YU2A 1O3TA 1BK0A 4SLIA 4V2VA 3F95A 2GC0A 1RUD1 1YXWA 2PLV1 3BOWA 3LZZA 3RZZA 1F15A 4B7EA 3JD71 3WUDA 1STMA 2OS2A 5ERLA 3ETQA 3RYRA 4BISA 4D7YA 5F3CA 5DMYA 2FDFA 3MZHA 4HZFA 4LOSA 3VZMA 1UOBA 4TYSA 4W50A 2DVAA 3NJYA 1YEWA 3OGGA 2ET1A 2KM2A 4KBZA 1Y7BA 2XOMA 2HWB1 4XF9A 1RTVA 5I91A 1SBEA 4LHNA 1JU4A 4R8HA 3CJIB 2A7AA 1HN0A 3GJAA 4YNIA 4LBJA 1CPNA 4IV1C 2DBNA 5JSPA 5GZFA 4IEZA 1W9TA 1YFWA 2R0FA 4H14A 1VBA3 1IS5A 1GZWA 3J9SA 1RHI3 1RMU1 2V09A 1S0BA 2MNGA 5EHDA 3R4SA 2VMHA 2WR9A 3RZGA 4LLOA 2ZKNA 5G04L 3RI9A 2GMEA 4RS5A 4CRQA 3BTXA 1ND3B 1VBE2 1D7PM 1Q8QA 4I09A 4DZGA 5FZLA 1F5FA 1MZEA 2VXRA 3DEMA 3POIA 1A8MA 1UAIA 2EXHA 4AVSA 4CDQA 3OJBA 4CP0A 4K6BA 4BWOA 2ZHNA 2VTXJ 1JYTA 4YM0A 2XDVA 4QB6A 4WVMA 3WINE 1H6YA 3VD4A 4D6RA 1ASJ2 5FYTA 4MH0E 3EB7A 4IV3C 2Y6JA 4BMEA 4B29A 1SDDB 2GNTA 2WZR3 4M3CB 3ZKUA 5FZCA 2P3YA 3O1VA 3OSDA 1ACCA 1RUI1 4XFHA 2D6PA 5EFUA 4BE3A 3ZFEB 4R9DA 1BEV2 2XUMA 3C7FA 4CUBA 4ARYA 1ZZ6A 3LEMA 4ZY9A 5H9QA 4OLLA 3VDCA 1H8TB 2W5FA 1VMHA 1W6NB 2R16A 3PUQA 4MXWA 2VCMA 4WM7C 1W8UA 2ZGMA 3I2JA 3BI3A 2XLGA 1V9U2 1KXGA 1ZZCA 4K21A 3VN4A 1ZRFA 4FXKB 1NAEA 2VPVA 2WDBA 3OB8A 2D6NA 3J7MA 1OVPA 2W87A 2DUOA 2XJTA 3NNLA 3LWCA 3VD5A 3UGHA 2XJSA 4AEDC 3UESA 3DXUA 5JPMB 3LB9A 1ENQA 1G86A 1UKRA 1BEV3 1SFPA 4LE4A 5KR7A 2DCYA 4HG6B 1XE7A 3B69A 2H6BA 1A34A 1AL22 5FY7A 4AI8A 2P6CA 3I8TA 3PTYA 5H9SA 4I01A 5T50A 2IUWA 3DXTA 4Q4X1 1UX6A 4XOGA 4E2QA 5B4XA 3K4ZA 2X05A 4AR2A 4YG3A 2FDJA 1PHMA 3MW4A 4R9CA 1BCXA 3N3HA 1WCKA 3M3CA 5DUWA 4B3NA 4CCLA 4KG8A 2HJIA 5T54A 1OA2A 2BEOA 2JD9A 2UWBA 1UN1A 1JOPA 2WZ8A 2QE3A 2YPDA 2BJSA 4NWVA 3OYWA 4QU2A 3WQ7A 3SEPA 4M4RA 3AXEA 2PYTA 4NR1A 1KGYA 3GHNA 1XPWA 1JN2P 1R092 1W6QA 2PMWB 1OLRA 2D6KA 5E6HA 3WF3A 1JXNA 2ZX4A 4XJAA 2R30A 3R0RA 1REFA 4GH4C 3VUOA 4IEUA 5CKNA 1C3HA 1YQ6A 5GZDA 3JUUA 3SEEA 4XHBA 3D0SA 2R062 4BPZA 1AL21 1CN1A 1NLRA 3IMMA 2PHRA 4P9WA 4CP9B 2BWAA 1C5IA 3F2ZA 1OBNA 4H55A 1WW6A 3ZYIB 5LBEA 4LTAA 4JRLA 3ABZA 4QQ2A 5FZEA 3SISA 1D4M3 4RQPB 3DYOA 2IXJA 2JG8C 2JIGA 4RQPA 4AAPA 3MLLA 3OG2A 5FREA 2PAKA 5SV5A 5CFCB 3KHCA 4KWLA 2YGLA 3T1LA 1NCRC 5HXMA 3IBMA 3HNBM 3KV9A 1J1TA 4PQQA 1WD4A 1PVC1 4AHWA 4XQDA 1QIQA 4IESA 4XACA 2DVFA 4A6OA 2ZGQA 5KXDA 5G05L 3THPA 5A6XA 1WA4A 5FQ0A 5E16A 2W0XA 2P3KA 3CZJA 3GZAA 2G19A 1E5HA 3SKJE 3SLIA 3WVJA 3WF4A 1GZCA 2VXJA 5LCWL 1C8NA 1UW8A 1N1SA 3GCWA 1DFQA 4FPKA 1T2XA 3KT7A 5C6CA 5J3UA 1K3IA 3QBQA 1O7FA 3RZJA 2PHLA 3ZFFC 1G8WA 1E5SA 2JKXA 4QXBA 4R4XA 5A7QA 1HRI2 2P4EA 3OF1A 4RR3C 4XFAA 1XYNA 3THTA 4ES8A 4I3GA 3O1MA 3WDWA 4LO7A 3HN3A 2YROA 3LEKA 3J7HA 3T0DA 1EV12 3T1MA 2BFUL 4IQPA 2DDUA 1NA1A 4N7UA 3OEBA 2ZHMA 1EAH3 3TRSB 1PM7A 4GD4A 4Q4W2 3M3QA 4MGSA 2JG9B 4AYUA 4DEQA 1MR5A 1RIRA 2HWE3 5FPZA 4DIQA 4UFKA 1Z7S3 3CDZB 4MV2A 3J4UH 1WUVA 5A3WA 5FZOA 1UX7A 3M8LA 5FYCA 1SLLA 4CCKA 2ZJCA 2RMU3 1OVSA 1ND2A 3PURA 1Q56A 1ND2B 4JDNA 5JIAA 2J1AA 1TVGA 1TME3 2JENA 3C2UA 5FR3A 1GOFA 1APNA 4A3ZA 3ZMNA 2WT2A 2VC9A 1AR91 4Q4Y2 4BK5A 5BNNC 3G6JB 1PNGA 4LBLA 3LEIA 3OUHA 1W2NA 1Q8OA 5LY1A 3OGVA 1KFXL 1F2NA 2L9LA 3QOPA 3PUHA 5JI9A 3VBRA 2ARBA 2BGOA 3MGUA 3VBRB 2CGOA 1IZ3A 2RS33 1ZZBA 1T6BX 3I7DA 2HWB3 3H50A 4CE8A 2BW8A 1ENRA 2D6OX 4UOJA 2A6WA 2BUKA 3ZSLA 4K1ZA 4FPCA 2PLV2 2B9VA 3T30A 1AYM2 5J48A 3B9CA 1K42A 3RWKX 1JZ5A 1QXPA 4K20A 2GC1A 2R6QA 1HJFA 1ND2C 4IGQA 5IT6A 1LTEA 4CDUA 5A80A 5A3MA 3D5OA 5FZ4A 2ZEYA 4FPJA 4AWDA 2F17A 1WCQA 1FMD2 2Y34A 4XDPA 2Y26A 5J98B 4DINB 5FPXA 5BNPC 3SCHA 1QWRA 3PNAA 4LBQD 5C5TA 2G9FA 5FMCA 1QJX1 5FQ0B 4IEXA 4YGEA 3A0KA 1O3SA 2VMFA 3MEPA 3O12A 3N4MA 4ZONA 1NOVA 1Y9MA 1R1A1 5JSRA 2YMZA 2ZCWA 3GNEA 3LOIA 4S2GA 3ZPOA 1UKGA 2Q1FA 5HV4A 1ZBA1 3PIGA 1OLQA 1WCSA 3E6DA 2FDHA 2DCTA 3NJZA 5LWBA 2BU9A 1V0AA 1XOYA 1KS4A 3KV6A 2WO1A 2JWPA 4GULA 3ZSJA 3LPGA 4GQ7A 2MHFA 4OUMA 1XQNA 4Q4V2 4H7MA 4V1PA 1US2A 1NUKA 1S0CA 3U11A 1FATA 3FHIB 2VQAA 2YC2A 1FV2A 3KT1A 1AR81 2YPJA 3AMNA 4LR4A 4YARA 4GKXA 4F7ZA 4FOYA 2XVGA 2HWE2 3AC0A 3ZPYA 4CYDA 4F83A 2Q8CA 2RE9A 3VBOB 3HVDA 4Q0QA 1TEIA 2X09A 2D3PA 3H3UA 2WAOA 4Q8LA 1XJAA 5EV7A 2XWJB 5FUNA 1WWYA 2VMEA 1NCQB 1BVVA 1CAVA 4LK7A 4DRRA 1FXZA 2PTMA 2X5IA 3ASIA 3CJXA 1AF9A 3GBGA 3OY8B 1SHWB 1BXHA 4O7XA 4MHUA 4QPWA 1XXNA 4N8MA 1GKBA 4LO6B 1VBA2 2CY6A 3H3ZA 2OIIA 2WA4A 4HLTA 4XURA 1ZBE2 2I2SA 4EWEA 3K48A 1CAWB 5KHHA 3ZDVA 2R0HA 4E2GA 5C4WB 3POSA 4I3PA 3Q8BA 5B2GB 4AI0A 3I97A 2ZEWA 3CF6E 3HEIA 4ZU5A 2WYFA 4JGYC 2WS93 5L9VA 4FTEA 4DXZA 2XGXA 4Q4X3 3Q9OA 1BZWA 2BRTA 2QQJA 2QQWA 2ZZJA 3WD5A 3IPVA 1S2KA 4LULA 1COV2 3UKTA 1GNYA 3VL8A 4XCBA 4Q4Y1 3GCXA 3ZN5A 2P1BA 4GWJA 3RMYA 2DVBA 3VBUB 1JU3A 1ZNPA 2YHJA 5IVCA 5JR7B 2D40A 1QGLA 3I3DA 3TBDA 4LOTA 5IJRA 1ULPA 2A5ZA 2VNRA 4GA9A 3I2DA 4AHXA 3HQXA 4LQRA 4A42A 1US3A 2R1BA 5C8WA 1NZCA 3WF1A 1AX0A 3I3BA 5APAA 4HFSA 1IPJA 1VBD2 2JD4A 3VHRA 1QEXA 5JCTA 4YW4A 3FL7A 4OI4A 1POV0 5AFBA 1WD3A 1X9TA 1UF2C 5FY5A 2XUEA 1ZZ8A 1OH4A 1AYN1 4IEVA 5KC6A 3NAPC 1CQ9A 2ZS6B 4P9YA 2ORXA 3PTRB 4Q4W3 3WOGA 2OPWA 4G4FA 1V6IA 1DU3D 1UYZA 4YGCA 2Q1ZB 4NHMA 4M3CE 3NJXA 3ZYHA 1IG3A 1ODMA 1HB1A 3PU8A 2A3YA 4FXGB 2ZX2A 4QQPA 2H6CA 5FZIA 2EAAA 2GAUA 1WA6X 5A32A 5JI7A 2GC2A 4XJWA 3V0BB 1RUJ2 1COV3 3CO2A 1V00A 3H7YA 5A7WA 3V0AA 2XJVA 5DXDA 1WZXA 1X82A 5DAVA 3VHOA 1JYWA 3BVCA 4LLFA 1WKYA 3IZOA 5IUQA 2ILMA 5T5OA 2Q4SA 1OF3A 4Z2WA 1RXGA 1VBA1 2WAAA 2QUOA 3ETPA 2FCUA 2VL4A 1RMU3 2BP6A 5F5QA 2DTWA 3VD3A 1JI6A 1IS3A 2EXJA 3UT0A 2BVVA 3SKVA 2VNVA 4AI9A 2OQ7A 4META 4XIKA 3LKJA 4AEJA 4CCJA 4D94A 1RUE1 3TN93 2Y60A 4I02A 4FPFA 1EPWA 3KCYA 1ULDA 4UAPA 1FNZA 2JDZA 3AP4A 3PJYA 2EIDA 2GMMA 5FP9A 4BB3A 2E7TA 4NIHA 1O59A 2DTYA 4FO9A 1SBDA 3ZXLA 4CPBD 3VL9A 1I1EA 4OI2A 2K2SA 3IIIA 1UIJA 4A2UA 1OMIA 4XF3A 2I45A 4S2FA 1TE1B 3LPFA 1GQPA 3JQWA 1W8HA 3IMNA 4YZ3A 4PIZA 1W2OA 3AMMA 4NWWA 3O1TA 4K1YA 2NQYA 1C57A 3NWKA 2QQIA 4IV1A 2E53A 2VNOA 2WO7A 4IV1B 4CDXA 1SLAA 2O8OA 2UU8A 4KU8A 3NV4A 1W8TA 1GOHA 3ME2A 5C4WC 4AI3A 1DZTA 3DKQA 2P34A 1RHI1 3TAYA 5DUUA 5GZEA 2YBKA 2BYVE 3BPZA 3JU9A 3LGRA 1GU3A 1LU1A 2JG9A 3MFAA 5IFTA 4IEWA 1LB2A 1SG3A 2R073 3MICA 5JZGB 5FOJB 2VQUA 1J58A 5IWFA 1GZTA 1AUYA 3ZIXA 2H0VA 2FZ2A 4QAWA 4YVSA 2YB7A 2HEVF 5IVBA 4Y22B 3AVRA 2E6VA 3P6BA 2I07B 5CFCC 4MADA 5FZ9A 2Z5WA 3FUQA 3BU0A 3FHAA 4HSJA 5A1AA 4FPHA 1CZSA 4DEVA 1JYVA 4O9GA 5CYYA 5FXWA 2XG3A 3HIFA 5LBFA 4AFAA 2HBTA 2AEZA 2Z79A 2YGMA 3I3QA 2FQPA 1S0DA 1RJ7A 1UZYA 2OVUA 4FPLA 2VOVA 3HT2A 3P3PA 2A73B 1AJKA 2LROA 1UZVA 2C5DA 2R072 4HXCA 4RYDA 5FZ1A 5ABJB 4K3UA 4W6WA 2QQVA 1QOOA 4P5YA 4QX5A 3T0AA 1GYKA 2X29A 3AYCA 3KF3A 2ZA9A 4XUTA 3SMHA 1PK6B 2YDEA 1KS5A 4N43A 5FMBA 3VZLA 1CR7A 4D6SA 2JECA 2JB4A 2CHHA 4XJ9A 3VBSC 3ACGA 3MFCA 2A6XA 5L19A 1B35C 3RYKA 4BQ5A 5H9PA 3N7MA 1RJ8A 1BBT3 5FBZA 1H0BA 1LHNA 2GNBA 1UYYA 2X53S 3K4DA 1PGSA 4M0NA 1M4WA 3NQHA 5F1RA 4QX3A 1V9U3 5DPNA 3I3MA 4D3WA 3M4FA 5FDBA 1UMZA 1UU4A 1WBLA 2QQUA 3A21A 2P17A 2ZXQA 2DWRA 2VULA 4XF1A 1S0IA 1VAVA 3GYDA 4GKYA 4JC1A 1WLWA 5C71A 1DQ6A 4XPVA 4MGTA 3WF0A 4QX8A 4F8AA 2F4PA 4P9LA 2ADDA 5F8PA 3EJKA 5BNQA 3IKWA 1ONAA 4JTNA 5IVVA 1ENSA 4COZA 4XVHA 3NAPA 3POYA 2D5FA 4OMDA 5T5LA 3T0BA 5HCHA 1RXFA 5I8SA 4KWJA 3MDPA 1ASJ3 2J1RA 3GALA 1KITA 2TUNA 1CIWA 2R071 2WFF2 5F37A 5LA1A 3RZMA 4CPBA 1UYXA 3I2FA 4H7LA 1PMIA 1AX1A 1O6UA 2CAUA 2OUHA 1ULOA 1F35A 4Q4V1 5A7WB 5CBLA 5L7OB 3I54A 4NIDA 2A70A 3MF6A 5FP8A 1PIV2 3MIGA 4NUBA 1HJGA 2XLAA 1W03A 2AREA 5J36A 1AR82 2ZAHA 4OFGA 2Q30A 2YFZA 2FDKA 5GALA 2Q0AA 3WT3A 1RUJ3 1UY0A 4BLIA 1RUNA 4GH4B 4XCAA 4XJZA 1Y4WA 5DZEA 5FZAA 1RUOA 1W0OA 1XNKA 4V2WA 1SPPA 1W6PA 2D6LX 4AL9A 4CA9A 4BQ3A 4FP2A 5JLVA 2AH2A 4WVZA 3K77A 4M3CA 1FT9A 4AVTA 2XQXA 5M0TA 3LOBA 1UY3A 5J96B 5FY1A 1IQDC 1OT5A 5LA0A 1ODNA 1H2LA 1EAH1 3UGFA 3OCPA 4E4ZA 3WZ1A 1RINA 1UNBA 1VBC2 4FOQA 1URXA 2WSVA 3AZWA 1UOJA 3GDBA 4OUEA 1DYPA 2D44A 4OZXA 4RR3A 5FP7A 3OGJA 1NE4A 3VKFC 4IERA 3S5QA 5FTTC 1J3RA 2A1XA 5ISLA 3H1MA 5FYSA 1DP0A 5T5PA 4XZPA 1PVC2 4MG2A 3B7MA 5FUPA 2OW4A 1LU2A 1AR93 1RUG3 3K46A 4UFIA 1PIV1 1W06A 1LULA 1ZBE3 3MIDA 3LD8A 4XETA 2ZGNA 3VBHC 3WR0A 1QOTA 2CWSA 2WS92 2RS31 2LW8A 3GBWA 4XILA 1IS6A 2JE9A 4G9SB 2W2IA 5FXXA 1COV1 4A7ZA 3AJZA 2ZGKA 3EQEA 5FZDA 5LW9A 1D2QA 4RFRB 5A33B 3W58A 2JG8A 4HKWA 5LEJA 1MEC3 1XB9A 2OX0A 3NMBA 1HV1A 3ACHA 5FLHA 3UYJA 4AEKA 4YGBA 4BQ2A 5CADA 1IPSA 1PO11 4XZUG 2VNGA 3OYWB 4YLZA 3VDAA 1C28A 1C8M2 3ZFEC 3LQCA 2YFUA 1GZWB 5I0DA 1YYNA 3RVHA 2PHWA 2VD7A 3VHNA 2Y33A 4Z2AA 1Q8VA 1SEFA 2Y0OA 4N9IA 1EUTA 2ZTNA 2RJLA 4WV8A 2BV4A 1RL3A 4NIAA 1R1A3 1RUD2 3VBHB 3BN6A 1VLNA 4XABA 1PZ8A 1VBD3 2OQ6A 4NPMA 3HJRA 5EP9A 1RUG2 3WG1A 5DAXA 2W1UA 5DG2A 4BZ4A 4AEMA 1HRI1 2ZACA 3VBFB 3PL0A 1AYM3 1L3JA 1NKGA 4Y1UA 5EZWA 2IVJA 4AGVA 3DL3A 5I93A 2VU9A 2OUJA 3FLTA 1AYN2 5BXXA 2DYCA 3RZLA 2XB6C 2ENRA 2R063 2XJRA 4A3XA 5CFDB 4ZHNA 2PN5A 3EHKA 3SXWA 4C1XA 2VG9A 4YWAA 5JWPA 2XHKA 4YPJA 4WM7A 1RUH2 4FAHA 3M1HA 4JKLA 4RFT0 5CU1A 4YG6A 2K0GA 3IDCB 1ST8A 3N35A 3TNPB 1HW5A 4W6XA 3FE5A 4JKKA 1UMIA 4JHZA 1QOSA 3SQOA 3ZM8A 4S2HA 2JB8A 1WGPA 5KXBA 4NE9A 3CJIA 3AK0A 1LNSA 2RS13 3NV1A 2CDPA 5KXEA 5SV8A 3AKQA 4XW3A 5ANQA 1S55A 4PIYA 3ZYPA 5ACA2 3LA2A 1DG6A 4OULA 5LA9A 2AR6A 1NY71 1NCRB 2HWF2 2O8QA 1VB4A 4IEPA 4XFCA 3RQ0A 2ZMKA 2QQOA 3PVEA 5HXVA 1D0HA 4GJZA 4DQAA 5CG9A 3THCA 1CAUB 2DU0A 1ND3A 3C7GA 4NAMA 1RUC3 1G9FA 1GR3A 1CESA 2WWJA 5FFOC 4CCMA 1I5ZA 4XMIA 2Q8OA 3PHMA 4UBHA 4LORA 4DY3A 1NXMA 1JHNA 1GNZA 2GP5A 4JHTA 4LBQA 2BOJA 2WFF3 4JDOA 2WQZC 4CDWB 3ZIWA 3AYDA 1YWKA 2QTWB 2PA7A 2DUQA 1AZDA 1OUXA 1ULEA 2EXKA 1W05A 4FFHA 4RHV2 4HONA 4N43C 3ILRA 5CKMA 4HK9A 4Y1YA 3MBWA 3C7HA 3KV5A 1KDMA 4LEJA 3HR9A 2Q1MA 2VZ3A 3E6BA 4IW3A 4N9HA 4QHZA 3CIHA 5FPAA 3I2HA 1HRI3 4LXLA 3LSDA 4RR3B 4OI1A 4AGRA 3MLJA 1O91A 5JR2A 4FI9A 2EIBA 3N36A 4LIVA 3TWIA 2PQQA 2WABA 3HWJA 2C26A 4OZOA 1IPKA 1JS9A 5HCFA 1D4M2 2G1MA 2X8KA 5E1RA 2CTVA 3JD72 4IXLA 5IATA 1G9BA 3BTYA 1N3QA 1SMVA 1ZRDA 1YQ5A 4DY5A 3MLKA 1XC6A 2F4LA 1RUH1 4AVBA 2Y6HA 3B93A 4NO4A 2JE8A 1W8ZA 5FO8B 1O3RA 3NKTA 4AG4A 1PO21 4UW5A 4DUVA 2C0ZA 2YYOA 3LCPA 1NZIA 1I3HA 2DFCA 1IHMA 2KXLA 3S57A 1RUF1 4LUMA 3L2YA 2YC0A 2W1QA 3E6CC 3GZUC 1YFYA 4L9BA 4LITA 5BNNA 3O1RA 4FSJA 1WW5A 1HQLA 1WW4A 1O8PA 2EF6A 2XONA 3PDQA 2JDHA 4KL1A 2BNMA 4BQYA 1HB3A 1EY2A 1LHWA 3V64A 1MZ5A 5HPOA 1NCRA 1GV9A 2E63A 3KSCA 1KRIA 2WA3A 4UF0A 1S2EA 4UYBA 3WX5A 2BZDA 2C9AA 4MVTA 4WM8C 1W9WA 4FFGA 1MVQA 2A6YA 1R093 1DQ5A 5CB7A 3CLPA 3BYWA 1AR72 4UI9L 4TSVA 2RM23 5FP3A 3NW4A 1MEC1 4ZS2A 1YRZA 3A22A 3VBOA 1Q43A 3E97A 3UJQA 4QDSA 3MIFA 5J7MA 1PO13 4Y5TA 2BNNA 4Z1VA 4Y4RA 1NQDA 4AQSA 1G7YA 2VQ0A 1VRH1 1YJKA 2P37A 4E8CA 3VDDC 3RRDA 1ALYA 3FN9A 3ZN6A 2DURA 5DQ0A 4E27A 2VUJA 5IK4A 4YVWC 4NPRA 5C9AA 4IE6A 3PIJA 3R4UA 4AF9A 4N53C 1JZ4A 3OY8A 2AACA 1LOGA 1R1ZA 1V6NA 3UGGA 2GNDA 2WKKA 3GZTB 3JZVA 1UWWA 2OT7A 3J26N 2XLFA 5LRSA 5LBBA 4QB2A 2CYFA 2V4AA 4JGYB 4XHXA 2P5BA 3RMXA 1AX2A 1R083 4KG0A 1QNWA 1UY2A 4AZZA 1GLHA 5C4WA 3AMQA 3WLUA 5JXHA 1HRV3 4MXVA 4XF0A 4XXAA 2PLV3 1LOFC 4HVRA 3ZFGB 1RVF2 4BJ0A 5I0SA 1QQP1 1DZQA 1RUH3 3BPSA 3LA7A 3MPPG 4CTEA 3S7EA 1OKQA 1HN1A 3RZHA 5I8TA 1Z7S1 3BKZA 2E7QA 5IK8A 2IFWA 1RVF1 4IEYA 1MACA 4K7JA 1IKQA 2RDQA 5BUVA 2BBAA 5FZBA 3DN7A 4EE2A 3CMGA 4LO5B 4PQ9A 3WDYA 4DB5A 4UXAA 5EPAA 4PLNA 3IDEA 2WZEA 4XAAA 1VB2A 3TNQA 4D69A 4R4ZA 4A4AA 5KHGA 1CD3G 4J25A 3D82A 4ET7A 1RGSA 4LBQB 4COYA 1M06G 4MSVA 2P6HA 1OFNA 1P8JA 4FPEA 3H42B 3K3OA 3JB8A 3AYAA 2YZ4A 4A7KA 3TOJA 3QLQA 2R32A 2J42A 3POWA 4Q4V3 5FZMA 2FMYA 3U07A 5GLTA 5AC93 4RGAA 4XMAA 2FHRA 1W0NA 5F3GA 3U4SA 3VHPA 3VBSA 1NQJA 4PHZA 1LODA 3H8XA 1RYYA 4QX2A 2WZPP 2EA7A 2ZHKA 3M7AA 3KD4A 1WLCA 1LEMA 1W04A 1ZX5A 2X10A 5C8CB 2GZWA 2YG0A 5KBFA 2Z42A 3RS6A 1KJRA 1SLBA 1IGOA 2HWD1 1L7LA 5DAWA 5A32B 4CCEA 1HXS2 4OUSA 4XXPA 2BGPA 2PHDA 3QD6A 3POEA 5F5AA 4DO0A 4NOTA 2VZOA 1S0EA 3VBFA 1BMV2 3VBUC 3KQ4B 2ZX3A 2CDOA 3WG3A 3AM2A 1TZOA 5A6ZA 1OH3A 2VECA 1F4AA 3A0NA 1POV3 3IDAA 1W2AX 2IVIB 3K51A 3MO4A 5EJZB 3OD0A 4GXLA 4I0WB 5A3LA 2XWBB 1O4ZA 3VKLA 3SH5A 3DYPA 4A44A 3GM8A 2VBBA 1LR5A 4LHKA 1NY72 2TEPA 3HOBA 5LRRA 4CU8A 4F3JA 4JGYA 2PHXA 1RMU2 4Q2FA 5IAXA 2XKOA 5A3UA 2D97A 4HK8A 3WNXA 4OHXA 4E8DA 1DIWA 1F9KA 1O4YA 2PXJA 2B7YA 1JYCA 5KHKA 2OZJA 4LHLA 3D6EA 4MXWB 1C1FA 4NMIA 2BDRA 4JCKA 2ZHLA 3I2KA 1PNFA 3N7JA 4NJ4A 3TB0A 5K9YA 4AI1A 4WZFA 4Y33A 1O3QA 4OVEA 5FPVA 2WFPA 4YFZA 1CJDA 2DVDA 3AXDA 2RMU1 4MUVA 3ZXGA 1NX9A 1X9PA 3NVCA 4PJYA 5K4LA 4X6RB 4MYEA 1DBNA 2VMIA 2WQ4A 3AKRA 3W20A 4M3CF 4BQ4A 4DPNA 4JRAA 5IFPA 3RDIA 1OUSA 1J84A 1E5IA 3ZYFA 4P14A 1NA1B 3H8UA 1C8M3 4QU1A 4LK6A 4M4PA 3WCSA 2XJUA 3ZSEA 1U5YA 3E5QA 1V6MA 2ARAA 3HT1A 5GZCA 5FLIA 1IKPA 2WO3A 4FCAA 5BPXA 1ULFA 2VZTA 4QM8A 4YGDA 4OHVA 1OQ1A 4MGIE 2WWUA 1UL9A 3HD8B 5C8CC 4ISRA 2BFUS 3NJVA 3UKNA 4JX0A 2RM21 1ZVFA 1PIV3 1ZBE1 5C9AC 3O1OA 1RVF3 4DXTA 2HEWF 3PVOA 4Q0VA 1VBB2 1AYM1 3J7LA 2MEV3 1J1LA 5A6YA 4FPGA 4FQ4A 5FZ7A 5FRAA 1K45A 5D8AC 3UNPA 2NYYA 3C8XA 4LJHA 3ZO0B 3TEWA 1W2TA 3KV4A 3FFZA 1W8FA 1RUI3 2WLPA 2ZGRA 4HVOA 1F8VA 2CWMA 3N9QA 3WG4A 3WNLA 1XSQA 1NLSA 1PVC3 1KDKA 4RGGA 5I8YA 3O1PA 3OUJA 3KS7A 1DHKB 5CIRA 3U75A 1DLCA 3FBYA 1GBGA 5T52A 3K3NA 4XFIA 4KMQA 4Y1XA 1WW7A 2E32A 4QKDA 5D1IA 4L92A 4JV4A 4EN8B 4Y4YA 5F39A 4NVPA 2VZSA 5HV0A 1FNYA 3QACA 1GQGA 1QDCA 2IXHA 2HWC1 2TNFA 1GWLA 2K9ZA 5EJ3A 4ZZ5A 2ZGTA 3RWNA 4EWAA 2ZAAA 2ARCA 4Y5Z0 1YUDA 2RM22 4NAOA 4Y26A 1N47A 2FZ1A 4CEYB 1E57A 5T5JA 1A8DA 2GP3A 3BGAA 2CGPA 1N3OA 1PZ7A 1X50A 4A6SA 1UIKA 4AFDA 1O8SA 3H3LA 1LHOA 4ISQA 2QKDA 2VW0A 1GP6A 2W1SA 4CU6A 2IWGB 3VBOC 3AZZA 2XL9A 4QX1A 3RPQA 1G9CA 1UZWA 2P3IA 3WNKA 2OKXA 1PX4A 4FFFA 2VM9A 2Q8DA 4HANA 3PMSA 1J83A 4RN5A 4CDUC 3SNMA 1VAKA 1ZRIA 3N9NA 1LOEA 2YBSA 3NAPB 1PO23 4TLFA 4XE9A 5FZ0A 3GXUA 2G9GA 4N53B 1H8VA 4FT8A 4N53A 4EWDA 4Q29A 2VOXA 1CZTA 1FOD1 2IXLA 2VCAA 4EYUA 1V70A 4ZXEA 2XPJA 1HDKA 5DABA 3V0BA 1CIYA 3VZKA 2B46X 3P5BA 5L7OA 3LDBA 1LGBA 3USUB 2VVFA 4CDQB 3ZDSA 5F5IA 1Z78A 4SBVA 1UCXA 2XJPA 4QPIC 2GN7A 1B35B 5LBCA 4G3YC 3WF2A 4LPLA 5HCAA 3H8OA 1CAVB 4YM3A 5C3OA 1NCQA 1OQDA 1QXRA 4CVUA 4BQXA 3IT8A 1S2BA 1W6PB 3ILNA 5JPNB 4JKMA 4QHOA 2QQLA 4NRQA 4CDWC 3ZSMA 4IGOA 3UETA 3I49A 1HB4A 4IE4A 5K0UB 2ERFA 4Z07A 4XJ8A 5F5CA 5FK7A 4WM7B 3RFRA 3WXPA 3NV2A 4ZXKA 4E2SA 4K8RB 1CAWA 2ZABA 3G7DA 2ZPXA 4DXSA 4NHXA 3PUSA 4B4PA 4HN0A 4QGLA 4HBNA 4C8DA 4P02B 5BNOC 2NLRA 3WW1A 5L7OC 3VZJA 1W6NA 4OYUA 1Y3TA 2WNVC 1PZ9A 1SBFA 4EZHA 2BGCA 4LKSA 1DZRA 3AL5A 1SLTA 2NPIA 4TXWA 5DDJ3 4CU7A 1QNYA 3RG0A 2B42B 2JDPA 3IIAA 2VUAA 4QB1A 1UD1A 5T55A 5A3NA 3TEZA 2HWD2 4QDQA 3RYPA 2R1DA 5D21A 1QJZA 5JAXA 3OGRA 4OQ9A 2JDNA 3IAPA 2EICA 5FYVA 1JYNA 2WNUA 1R64A 3JQXA 2XVLA 1V6OA 3PLQA 4BOWA 3WDTA 2G9ZA 3HPNA 2JJ6A 1BJQA 3AZVA 3ZLIA 2D43A 1PM4A 2VTFA 3S5AA 4ATEA 1RUC1 1BQPA 2VW2A 4JGZC 4LMFA 4XTPA 2E31A 5C3SA 2BBVA 1WMXA 3IDBB 5FV3A 3FLRA 5EQUA 2P3JA 5A7NA 1H2NA 1WCUA 2GU9A 3NRUA 4LE3A 5CNAA 1JH5A 5FYZA 1EUUA 1XNDA 2E26A 3MHZA 4QPIA 4RHV3 3ECQA 2EVXA 4Q0SA 3AL6A 2R041 1LJ7A 2B8MA 5FMOL 1Q3EA 1H6XA 5FAXA 4MHRA 4N7IA 2WBKA 3K75B 2OYZA 1MS5A 4DUXA 2QZ3A 3KMHA 3ENRA 4HT1T 2RR13 4NPLA 5DDJ2 1D4VB 4EV0A 1LHUA 1SFNA 2J1EA 1CGPA 4WM8B 5F32A 3NNFA 2JE7A 4XUNA 4FOWA 4XBNA 4QXHA 2DCZA 1LOAA 2UWAA 4Q1PA 1H9PA 1UY4A 1AR61 1B35A 1YLLA 2R49A 3GBFA 4Q27A 4XFGA 1DLLA 1CPMA 2A3WA 4HKOA 5IK7A 1GQHA 1QJY2 5FMDA 2BVBA 4P5HA 3HN1A 4CSWA 1EYBA 3BALA 3ZOIA 3QH7A 5CA6A 1QMJA 2ZEZA 3FFQA 1YCIA 1X8EA 1S0JA 3AMHA 2PHUA 5K0UA 1LGCA 4Y20A 4Y24A 3V65A 5BNOB 2PFWA 4IEQA 1OQEA 2WRAA 4ORFA 1VBC3 1K5MA 5CZKA 1XRUA 4UFJA 5HCBA 4DRVA 5C3PA 4JDMA 5JZGC 2R042 4OMCA 4LT5A 1VRH3 2W3JA 3M3OA 3ZXJA 2SLIA 5D8AB 4Q5OA 2RJKA 5D8AA 1LESA 3AP9A 2RJ2A 1BBT1 2IFRA 1RUD3 3OPZA 2HBUA 4Q4X2 4P9GA 1AXKA 3USSA 1DGWX 3NL1A 3MIHA 5AFEA 3PVBB 4I30A 5IW0A 1RUE3 4FTBA 2DCKA 1SLCA 1SFYA 1ZRRA 4XTMA 5FO9B 3OBRA 4YVWB 5AC91 2Y6LA 5JDBA 4QHBA 3DPRA 3O1SA 2GDFA 4LNVA 4EJRA 1AL0G 1H4HA 1HRV1 4XAEA 3H9AA 1QF3A 4UFLA 4LHSA 5J37A 1PK6C 2GN3A 3X29B 2XBO1 5DZGA 4IETA 5JOXA 4ASLA 3WDXA 1DQ4A 1OD5A 1Z0HA 4FTSA 3ZN6B 3VLBB 1PMHX 3ZYRA 4O9EA 1OA3A 4A41A 4CDXC 5GZGA 4Y1VA 3WW3A 2YV8A 3KGLA 4YSFA 5CEHA 4PDWC 3VDDA 4QXCA 1EV11 1EPZA 3OBAA 2ZMLA 2ORZA 2DU1A 2W08A 4P9IA 5BV6A 3WP3A 3FHQA 5C8CA 3NNGA 3ON7A 1ZZ9A 1LEDA 1W90A 3NNMA 1WMEA 3FMGA 1KJLA 2UYBA 1LRHA 2ZGLA 3DPRC 2DBIA 4J1WA 2DUPA 2ES3A 4PT6A 4CCOA 1FMD1 2D98A 1CX1A 1D4M1 1DDLA 1CX4A 1MPXA 5L36A 3ROUA 1MS0A 1Y9GA 1NXD1 2PAEA 4CP9A 2GNMA 4HPKA 2RVAA 2XR4A 2IC1A 2XBO2 3WHTA 3WQ0A 1H1AA 4OHYA 2JEMA 3FWEA 4JVAA 1UXZA 1HRV2 1S0FA 3OGSA 3B94A 1YC61 2MEV2 1AXYA 1UMHA 3PU3A 4AEDA 1UZ0A 2DV9A 3FBMA 4IV3B 4D7TA 2WNUB 3PUIA 4JAAA 2FDIA 3FX3A 2DCJA 4AHYA 3I2IA 1PVXA 2JG9C 2Z4FA 3WV6A 2ADEA 2NMOA 4AGGA 1LENA 1ULCA 2J1UA 3DGTA 5E8AA 1DGRN 2RS51 1NYWA 4CCNA 3I2OA 4WVWA 3ZXAC 2ID4A 4L11A 4MGZE 4CDQC 4L2NA 2ZGSA 4W8JA 2J1TA 4BLJA 4IL7A 3UJOA 4PF1A 2GH2A 1POV1 2HWB2 4GMP3 4QQLA 1VPHA 5F9TA 5DAPA 4QT6A 1G6NA 1W9SA 1GWKA 2D3SA 3CKHA 1HXS3 2VBPA 1XSRA 3VB9A 1ZA7A 3D0JA 3IM0A 1SCSA 1XNTA 4Q4W1 4B1LA 2IXIA 5KWRA 3JBG3 4MGYE 2PELA 1D0GA 5F6KA 2CNAA 1CAXA 4AFBA 4BU2A 3WP6A 2JKBA 2WNUC 4PBPA 3BIEA 1S0GA 3HNMA 2ZKLA 5ACA1 2GSYA 2RV9A 1JZ7A 1AR92 5FZGA 1JUHA 4RS5C 1GSLA 4TWTA 2E7AA 2HWD3 2XJQA 2YU1A 1PGW2 1NLQA 2RR12 1RUF2 3D3AA 3EBRA 2ARXA 2XQRA 4LIUA 4XDOA 3K2OA 5FY4A 3VKMA 3KZ4C 2YY1A 2RS11 4QKFA 5HBAA 1GMMA 2X5IB 4FPYA 2KD7A 2WNVA 4YW3A 4AVVA 4BCUA 3PMEA 2WNVB 3OPTA 2Y6GA 1XU2A 2ZX0A 4ASMB 4B1MA 4GWMA 4QMAA 4RQPC 1HLCA 4NHLA 3AZYA 4GJYA 3RJ2X 4KNCA 3ZFGC 4YW1A 2Y6FA 4A45A 4COWA 3URFA 1W8OA 2AYHA 3SCGA 2QBXA 4LKFA 1DYKA 2XL7A 2XXZA 1GICA 2VR4A 4K8FA 3ILFA 1W9FA 3JD73 4M0HA 5FXVA 1MZFA 3KVBA 4IEOA 2XBO3 1REDA 2WZR2 4YW7A 5LATA 1IOAA 4DS0A 1JYXA 4CUGA 1QH6A 3Q8FA 1RUI2 4I2OA 5LEKA 5JXIA 3CU7A 5FPUA 2NZ9A 1MS4A 4DXRA 1JZ2A 3NV3A 1YQCA 5IVEA 4YVWA 1SDWA 4W6YA 5F2WA 3W5MA 3IWZA 3HAGA 2VZPA 3AYEA 5DUVA 3EXUA 2B5HA 2BQPA 5GLZA 1XYOA 3WP4A 3S30A 3DCQA 1XYPA 1XNBA 3AZXA 3T4VA 2BPA2 4MOAA 4ZS3A 5IVYA 1HB2A 4GMP1 5JZGA 2WO2A 5BNPB 3VGIA 3ZN4A 4B4QA 4DNYA 1OOPC 1VBE1 3PVNA 4MGQA 2RMU2 2W52A 3JB4C 2ATFA 1G9AA 1H2MA 1QJU1 4BQWA 1VBD1 4QGMA 4R52A 4CEWC 2W92A 1DGLA 4YZ2A 1KD7A 4Z92B 1A78A 3H8RA 2W91A 4URTA 3JBG1 4AHZA 4D0QA 4Q0UA 1O5UA 1BYHA 1AR73 1OA4A 4D6QA 1SACA 5C7GA 1W8NA 1YHFA 1YQ8A 1J59A 2IZWA 3D8CA 4C90A 4PDWA 4U36A 2BNOA 4Q8KA 5LASA 1SZBA 2JX9A 4RGKA 2ETEA 2X5IC 3LIHA 2I74A 4W65A 3M2MA 3R05A 4LA2A 1JMUB 1QJU2 3KGZA 1VALA 3TEXA 3ZYBA 4B4RA 1H1IA 3ZSKA 1OLME 3T2OA 4YZ5A 5A6QA 1JBCA 3RI8A 4EZ4A 3KM5A 5FWEA 3ITQA 4C91A 4S2DA 1QY4A 3PUAA 3POBA 1DQ2A 2VOTA 3DECA 1PGL2 1SPPB 3WDUA 2RDNA 4CP1A 4TLGA 5FPLA 4CEWA 1A3KA 4MX3A 2R043 3HQUA 4P08A 1GANA 1TQ5A 4IE5A 1GWMA 3D4KA 2VCCA 4NHYA 4IV3A 4YYOA 1FMD3 4BQ1A 5JIUA 3E5UA 2WSUA 3N9PA 2D5HA 1O4TA 5F7UA 2XHNA 4TN7A 1OKOA 2HYKA 2O0OA 4CEYA 2WT0A 4X6QB 1JODA 2HWC3 2QFEA 1WMFA 1BEV1 1QKQA 3MUZ1 4XFFA 3B3QE 3AVSA 2LRPA 1LOBA 1BKZA 2WN3A 4J6GA 4Y1ZA 2HWE1 4C0BA 4O61A 3T2TA 3CHXA 2CGNA 4QX0A 1HQNA 4FFIA 5ANNA 4YW6A 1UXXX 1U5ZA 5FBJA 4P9JA 3ZR6A 1S1AA 4BK4A 4W4ZA 2ZEXA 2WINB 3AJYA 3ES4A 2AUYA 4LBKA 3WCRA 5BYNA 2WIIB 3A7QA 3T2QA 1HKDA 1UO9A 3ZYJB 1DYOA 1RITA 1JW6A 1AVBA 2GH8A 4XEZA 3CEWA 3SH4A 2JIJA 5IHRA 1CAUA 4H3WA 2HKXA 5EIYB 1RC6A 2QVSB 5F6LB 2NMNA 4OCTA 1U5XA 3M70A 3SH3A 5FYUA 3RJRA 3IB3A 3UKVA 1A6CA 4DUWA 5AC92 5K7PA 3KQRA 1TNFA 2J1VA 2XH6A 3JBG2 5FCCA 2E51A 4YW5A 5BNPA 2GALA 4GALA 2LTNA 1AR71 2O1QA 2A6VA 2K46A 4K40A 2ZOEB 5FZOB 2V5YA 3VZOA 4AE2A 1REEA 4QM9A 3T2PA 3C3VA 4CZSA 5JUVA 2VZRA 3GHMA 1R091 3MIEA 2C1FA 1U0AA 1MZ6A 1AR63 1XU1A 4XIOA 1F31A 1NCQC 4PDWB 5GKAC 4HOOA 3DYMA 3JCIA 4FBFA 4C0HA 5LZ6A 3I4IA 2QQPA 1R082 1W3XA 4QGNA 1J3PA 3UV9A 1DQ0A 4ONUA 4GIQA 4QKNA 1JZ8A 5FUIA 2WJSA 2D7FA 1XE8A 4P00B 1VBC1 4HPKB 3MUY1 2NP0A 2JICA 5CFDC 4NHKA 3FC0A 5KHJA 1ZBA3 2AC1A 5A1FA 1YI9A 1VRH2 2C6SA 3MW3A 3BTAA 3ATGA 2QQNA 1V6LA 4WBBA 5FZFA 1L7RA 3OUIA 5JOZA 5FZHA 4E4DX 3AKSA 1MS9A 2WL1A 4CCCA 4INDA 5L9BA 4OI0A 1VR3A 1GNHA 2D6MA 3ZXEA 2Q8EA 4JGZB 3J8F1 1X33A 5H9RA 1ZYBA 4HVQA 3U37A 5ABJC 4YZ1A 2BERA 2WT1A 3L9JT 1C5HA 3AFGA 1NE6A 3I2GA 1DF0A 5FJKA 5I0RA 2UWCA 3I3EA 3LFIA 1GUIA 3FUOA 4GB32 2G4IA 3LAGA 2CSGA 2XKPA 2LUWA 1W39A 1YJLA 2WNOA 3R6SA 1DGWA 1AHSA 3L2HA 3ZXKA 1J3QA 2OXBA 3T4HB 5JXJA 2E9QA 2IXCA 1R1A2 1WMDA 2WFF1 2R061 4UW6A 1W0PA 3BOPA 4AOCA 4PLOA 5JMOA 5FWJA 5FZKA 1IG0A 2BWCA 2ZZQA 2V4VA 5FY0A 4FPOB 5FJHA 2VW1A 2FDGA 3DPRB 3FLPA 1QXJA 4AVAA 4EQVA 4BIOA 4RHV1 2RS53 2VVDA 4KI5M 5EYYA 4E9KA 2VTXA 4XUQA 3I59B 1PO22 4R9AA 1VBB1 1YO8A 4Y5SA 2SBAA 3I59A 1CVNA 3ES1A 3OOXA 5E89A 3VZNA 4HN1A 3W5NA 3AB0A 1FYUA 1OLMA 1QDOA 4TTGA 4BM8A 2VO5A 4GH4A 1VMJA 1K5MC 1FPN3 4QQHA 4EN6B 2GMPA 3QH6A 5JOYA 1YFUA 4M00A 5CVRA 4QPGC 3ZXFA 3WQ1A 4CEWB 2B45X 5EWSA 3WG2A 5KXCA 1AL23 2C24A 2HLEA 1JHJA 1QJFA 5DN2A 3W59A 4EN7B 2ZGUA 2EIGA 4AQ2A 1K12A 3OD4A 1ZZ7A 2HH9A 4AW7A 1W3VA 4AK3A 1CZVA 4Y20B 2AEYA 2VE1A 1TNRA 4B7KA 1LKNA 3N9MA 4KBBA 5IVJA 5A3OA 2W94A 1QJY3 4GB31 4COVA 1FV3A 3VD9A 5I0UA 1C1LA 1VP6A 4C1WA 5JMCA 3KLSA 3W9AA 4XBLA 3KHBA 2JDKA 1GFF2 3BIWE 3WHUA 1OSGA 3ZFGA 1VIWB 1QJX3 1D2SA 3U78A 3Q8EA 1Y43B 1CJPA 4LBNA 3IPVB 1QU0A 1RB8G 5FO7B 1BHGA 3W21A 5C3QA 1W9YA 3P1IA 1T6GC 4LBMA 3AFKA 2C4XA 2ZGOA 2VH9A 4UFMA 3WW2A 4BXFA 1ZBA2 2AGSA 3O0XA 2GC3A 4A7YA 3WQBA 5A3TA 2KA3A 3MF9A 4AEDB 2RDRA 1SQ4A 1AXZA 1UY1A 2JXAA 5FPBA 1C4RA 3LSEA 1JYIA 4YW2A 4QQOA 4NIGA 3V56A 2A3XA 2VZ1A 4CEYC 3A4UA 4UBGA 4BYYA 1CWPA 2HWF1 2YBPA 3T08A 1ZREA 3POGA 1XNCA 2VZUA 3VV1A 3ZXDA 3H0OA 4XYXA 2CL2A 3FJSA 1JZ6A 3AP7A 4R9BA 5FOBB 4ES9A 4DOUA 1XE0A 1Q8PA 3BB6A 4BH9A 3JXSA 2ZX1A 3LFMA 2RG4A 3ZX7A 1KEXA 3P3NA 5C33A 2W1WA 1OF4A 2B39A 3VKNA 1H1MA 2Y64A 3ELNA 3B00A 4NIIA 5A7PA 2FCVA 2UY8A 4RL7A 3O0WA 1QH7A 4LA3A 1LHVA 2E33A 3GF6A 4KQ7A 1LOFA 1E5RA 1HV0A 2VY0A 5E88A 1MS8A 3GGLA 1V9U1 3S0MA 1WLTA 2VMGA 3C7OA 5A3PA 3VBHA 2RS12 4ATFA 1PO12 5FKBA 5J1XA 3POJA 4XBQA 3BU7A 1OHFA 3LIGA 4NRPA 4HSLA 2OPKA 3K4AA 4XUPA 5FY9A 2B9UA 5GM0A 5LY2A 2ZBJA 2VCBA 4AFCA 1ZRCA 3B9IA 3O1UA 3WNMA 1LAJA 4CUAA 1TMF2 2PAMA 2WN2A 3MPBA 2QNKA 4BMBA 5CFCA 5K8SA 1JOJA 4YVSC 2A71A 4M01A 3KT4A 1ASJ1 4H2AA 1W28A 3Q8CA 5LA2A 2QJVA 4Z82A 4GWIA 2DVGA 3B5LB 4IE0A 4FAGA 2D3RA 1JOBA 1UPIA 4Q1RA 4NRMA 4YM1A 1BMV1 1ULGA 4MLOA 2NM1A 2H0BA 5GLUA 4EN0A 1L7QA 1VBB3 3UL2A 2UYAA 3EO6A 3T09A 3U10A 4XF4A 3O0VA 4PBOA 5IAVA 3GZEA 3TN92 4AFMA 3CQOA 2RS52 3KVAA 3SITA 2F6BA 3HQRA 2R7EB 1JZ3A 1VBE3 4LKDA 1QQP2 3B02A 4UF0B 5TSWA 4CP2A 1AYN3 1V6KA 4L97A 2Y38A 2DF7A 4D8MA 1CONA 4KU7A 1PGL1 5LK5A 4LKEA 2LALA 1YNAA 2VUCA 1FAYA 1QJEA 4K9SA 3J7NA 3O7OA 4O65A 1H8TC 2MEV1 2A75A 2XMLA 2VQTA 4Q0PA 5T3NA 3VDBA 2QZ2A 2YXSA 1N3PA 2VGDA 2WQ8A 4WVVA 2V5DA 5GLWA 1H2KA 5FZ8A 3CL1A 5A70A 3N9OA 3NO8A 4JTOA 4HMZA 4XQ4A 5C5UA 2VOWA 4IGPA 3ACFA 4Q4Y3 2ET7A 5ACA3 2W47A 1LOCA 2QDRA 2W39A 1VRBA 4LO8A 5JOWA 2XVKA 1WCDJ 2RR11 4AQ6A 5JXGA 3AP5A 5KHIA 2AENA 1YQ2A 2KR2A 1I6XA 3FZ3A 1W6OB 4L99A 4ZU4A 1RUC2 4HL0A 1OOPB 1POQA 3POFA 4BDVB 2J7MA 3C7EA 3KB5A 2D93A 3AP6A 3O14A 4KWKA 5AVAA 1ND3C 2LS6A 1Z7S2 3V0AB 4MO3M 4XJUA 2FCTA 3J8F3 3TN91 2VJXA 4FP3A 3M3EA 1O5LA 4JZRA 1PK6A 1R081 4Y3OA 5F3IA 3OEAA 5F3EA 1UOFA 3EMRA 1MS1A 3OBZA 4NROA 2J1SA 2N7GA 2RHPA 4PF5A 3WNPA 4U2AA 5LB6A 3MI8A 3KWVA 1UYPA 1QHDA 1ZA4A 3APBA 3RSJA 1DQ1A 5FMOS 1X7NA 4N90A 4CDUB 3CJIC 3B01A 4UW3A 5JSOA 4L0PA 1IQAA 3LEGA 4URAA 3MW2A 5CFDA 2FBEA 3E1F1 1HIXA 4BXSV 3LA3A 2Z69A 4QPGA 1HX6A 4TZDA 4EN9B 4XQWA 5GLVA 2WWSA 3AMPA 3RNSA 1Q8SA 3ST7A 1K5MB 2EALA 1UQXA 4JQRA 2BOIA 3T3YA 1VAMA 1PX3A 3KF5A 2JG8B 5DUXA 2QCSB 3LDKA 1OFSA 2HEYF 3ZKYA 3DKWA 3OPWA 1BK1A 3UK9A 4QD2A 1NG0A 1WLDA 4RA0A 1YFXA 1BVP1 5K0UC 3S6PA 1I9RA 3DV8A 4CU9A 5FKCA 3J8F2 1QJU3 2LM3A 1V6JA 2Q5TA 5L9RA 5FXZA 4CDXB 1NT0A 3GJBA 3CZUA 5FK8A 3WNNA 4RS5B 5F2SA 3ZVXA 4AI2A 5LK7B 5IVFA 1LGNA 1MQTB 3BODA 1PGW1 4ZPIA 1MQTA 4CXYA 1I5PA 3H7JA 4EROA 1QJY1 4GB33 2VMDA 4KH9A 1H4GA 5FIXA 3SC7X 1MS3A 1EV13 1W8WA 5DZFA 4FQZA 1S4CA 4QX7A 4XUOA 4AQTA 4IUGA 4X8NA 4XFBA 5FYIA 4YVSB 4AXOA 3HMYA 5C9AB 1VE0A 2BTVC 4NN0A 4QKBA 3ZFFA 2Y0IA 5CAZA 1GZ9A 4IDZA 4UW4A 5BY5A 4HKLA 4YZ4A 1RHI2 3PJQA 1SLIA 1Y9QA 3ZFEA 2Y6KA 5FZ6A 2IXKA 3U14A 4OQ8A 4QDRA 5HI0A 4PLMA 1NA1C 1C8M1 4J1XA 4L8QA 1DGRA 4GMP0 2B4KA 2HWC2 4QPYA 4AVCA 3ACIA 3U4XA 2P2KA 2W68A 4PI2A 2EIEA 1W6MA 2YC4A 1KQRA 2J22A 1W6MB 2VZQA 3U1XA 4GWNA 4LUKA 2FMDA 1FPN1 3HBZA 1Q5OA 1UZZA 3MYXA 4PI0A 3ALQA 3IN9A 3IAQA 3ZR5A 5FYYA 3CBNA 5L73A 2W9XA 2HYXA 3LDRA 3N9LA 1FPN2 3NKGA 4KWUA 1YIPA 2JDUA 4DFSA 2WUHA 3H1YA 1AJOA 1PMJX 1BBT2 2WNEA 2CU5A 2AZ5A 4FOVA 1RUF3 2OZ6A 1LECA 4QWNA 3WUCA 1G9DA 4CUCA 5I0TA 4PIXA 3BTZA 5C3RA 3HNYM 1B09A 4ZZ8A 4COUA 3LE0A 4RD7A 4X8PA 5FYMA 3N7LA 1WBFA 4MZUA 2PQSA 3VBRC 1U5IA 1X36A 3WY6A 4ASKA 4PCRA 3WW4A 2VBDA 3LF7A 1TMF3 2UURA 5BNNB 3KCXA 3RZKA 5A33A 5FYBA 4CDWA 5FY8A 1HXS1 3MIBA 4I0BA 2VOKA 3QCWA 5AVPA 1FX5A 3HBKA 1UOGA 1FI2A 5FYHA 1RUG1 4QPIB 1EAH2 3MV01 4OHZA 2NN8A 1VJ2A 1OD3A 3M3IA 4BHPA 2JDYA 1RUJ1 4XDQA 1AR62 3TYJA 4BIFA 4I0AA 3ZYGA 3TEYA 1HQWA 4DMIA 1OPMA 1LCLA 2WC2A 1W6QB 3A23A 3OBTA 1X8MA 1YI7A 2VVEA 2WZR1 3RGBA 5IYYA 4UWDA 3Q8AA 5C70A 1RUE2 4B8EA 2TBVA 3ORJA 4CXXA 3USUA 5ABJA 5FP4A 4UT5A 5DG1A 3SCFA
chains in the Genus database with same CATH topology
4Z8BA 1H30A 3KCCA 1N1TA 4RSUA 4N43B 1YIFA 5JVVA 4D7SA 2V73A 5FLJA 3DUIA 4MGKE 1OI6A 3BCWA 2EXIA 2QDNA 2YUEA 3SHRA 4HETA 3CNAA 3NSTA 4ZKTB 2EAKA 1EP0A 4YM2A 2RS32 4QPGB 1N1VA 4JGZA 5BNOA 3VKOA 4KGQA 1W2UA 2CAVA 5IK5A 1SCRA 5CG8A 2PHTA 1H8TA 4WZCA 3H1WA 4Q26A 3R4DB 3WDVA 1UU5A 2A6ZA 2PHFA 4YRDA 2DFBA 4YFWA 5GJ6A 3ZMOA 2ZGPA 3VBUA 4FVVA 3INAA 3AKPA 3E5XA 5EYXA 2Z2SB 1TME2 1TMF1 1CAXB 5J09A 3ACLA 5EXOA 2CV6A 3O5SA 1FOD3 3S7IA 1JTZX 1F5JA 5DDJ1 1MEC2 4WVMB 2UY9A 3WP5A 2WS91 1QQP3 3ZFFB 3AX4A 4Y22A 1UPSA 3DF0A 5KC5A 1AR83 4KGGA 1IS4A 2ZMNA 3VDDB 3VBSB 2OA2A 3VBFC 3N7KA 4LBOA 4YG0A 1OOPA 2WLQA 1W6OA 4LO4B 4BA6A 2HWF3 4WM8A 1MQTC 1FOD2 4E4SA 3OTFA 2MPFA 1QJX2 1JUIA 4OHWA 4ITCA 3U0ZA 3AKTA 1KFUL 1H9WA 1N1YA 4P9XA 1ZM1A 1ENXA 1TME1 4QXKA 1MVEA 1U12A 1UU6A 1O3TA 4ZU7A 1OPOA 4SLIA 2GC0A 1RUD1 1YXWA 2PLV1 3BOWA 3LZZA 3RZZA 4B7EA 3JD71 3WUDA 4D7YA 3RYRA 3ETQA 3MZHA 4HZFA 3VZMA 4TYSA 2DVAA 3OGGA 2ET1A 2KM2A 1Y7BA 2HWB1 4XF9A 1RTVA 5I91A 1SBEA 4LHNA 4R8HA 4YNIA 3CJIB 2A7AA 4LBJA 1CPNA 4IV1C 5JSPA 5GZFA 4IEZA 1YFWA 2R0FA 4H14A 1VBA3 1IS5A 1GZWA 3J9SA 1RHI3 1RMU1 2V09A 1S0BA 2MNGA 3R4SA 2VMHA 4LLOA 2ZKNA 3RI9A 2GMEA 4RS5A 4CRQA 1ND3B 1VBE2 1Q8QA 4I09A 4DZGA 1F5FA 1MZEA 2VXRA 1A8MA 1UAIA 2EXHA 4AVSA 4CDQA 3OJBA 4CP0A 4K6BA 4BWOA 2ZHNA 4YM0A 4WVMA 3WINE 1ASJ2 4MH0E 4IV3C 4BMEA 4B29A 2GNTA 2WZR3 4M3CB 1RUI1 4XFHA 5EFUA 2D6PA 4BE3A 3ZFEB 4R9DA 1BEV2 2XUMA 1ZZ6A 5H9QA 4OLLA 1H8TB 1W6NB 2R16A 4MXWA 4WM7C 2ZGMA 2XLGA 1V9U2 1KXGA 1ZZCA 4K21A 3VN4A 1ZRFA 4FXKB 2VPVA 4BH9A 2D6NA 2XJTA 2DUOA 3LWCA 2XJSA 4AEDC 5JPMB 3LB9A 1ENQA 1G86A 1UKRA 1BEV3 4LE4A 2DCYA 1XE7A 3B69A 2H6BA 1AL22 4AI8A 5H9SA 3I8TA 3PTYA 4I01A 5T50A 4Q4X1 1UX6A 4XOGA 4E2QA 4YG3A 1PHMA 3MW4A 4R9CA 1BCXA 3N3HA 1WCKA 3M3CA 5DUWA 4B3NA 4KG8A 2HJIA 5T54A 1OA2A 2BEOA 2UWBA 1UN1A 4NWVA 2QE3A 4QU2A 3WQ7A 3OYWA 3AXEA 2PYTA 4NR1A 3GHNA 1JN2P 1R092 1W6QA 1OLRA 2D6KA 1JXNA 2ZX4A 4XJAA 2R30A 3R0RA 1REFA 4GH4C 3VUOA 4IEUA 1C3HA 5GZDA 3JUUA 4XHBA 3D0SA 2R062 4BPZA 1AL21 1CN1A 1NLRA 2PHRA 4P9WA 2BWAA 1C5IA 4H55A 1WW6A 3ZYIB 4LTAA 4JRLA 4QQ2A 3SISA 1D4M3 4RQPB 2IXJA 2JG8C 4RQPA 3MLLA 5FREA 5SV5A 2PAKA 5CFCB 4KWLA 2YGLA 3T1LA 1NCRC 3IBMA 1J1TA 1WD4A 1PVC1 4AHWA 4XQDA 4IESA 2DVFA 2ZGQA 5KXDA 3THPA 5FQ0A 1WA4A 5E16A 2W0XA 2P3KA 3GZAA 3SLIA 3WVJA 1GZCA 1C8NA 1UW8A 1N1SA 1DFQA 4FPKA 3KT7A 5C6CA 5J3UA 3QBQA 1O7FA 2PHLA 3ZFFC 1G8WA 4R4XA 1HRI2 3OF1A 4RR3C 4XFAA 1XYNA 3THTA 4ES8A 4I3GA 3WDWA 4LO7A 2YROA 1EV12 3T1MA 2BFUL 4IQPA 1NA1A 4N7UA 2ZHMA 1EAH3 3TRSB 1PM7A 4Q4W2 3M3QA 4AYUA 2JG9B 1MR5A 1RIRA 2HWE3 5FPZA 1Z7S3 4MV2A 3J4UH 1WUVA 3M8LA 1SLLA 2ZJCA 2RMU3 1ND2A 1Q56A 1ND2B 4JDNA 5JIAA 2JENA 1TME3 3C2UA 1APNA 3ZMNA 2WT2A 1AR91 4Q4Y2 5BNNC 3G6JB 1PNGA 4LBLA 1Q8OA 1KFXL 1F2NA 3QOPA 5JI9A 3VBRA 2ARBA 3MGUA 3VBRB 2CGOA 1IZ3A 2RS33 1ZZBA 3I7DA 2HWB3 3H50A 2BW8A 1ENRA 2D6OX 3ZSLA 2A6WA 2BUKA 4K1ZA 4FPCA 2PLV2 5J48A 1AYM2 3B9CA 1QXPA 4K20A 2GC1A 2R6QA 1ND2C 5IT6A 1LTEA 4CDUA 5A3MA 3D5OA 4FPJA 4AWDA 1FMD2 5J98B 4DINB 2Y26A 5FPXA 5BNPC 3SCHA 1QWRA 3PNAA 4LBQD 2G9FA 1QJX1 5FQ0B 4IEXA 4YGEA 3A0KA 1O3SA 3O12A 3MEPA 3N4MA 1NOVA 1R1A1 5JSRA 2YMZA 2ZCWA 3GNEA 3LOIA 4S2GA 1UKGA 1ZBA1 1OLQA 1WCSA 3E6DA 2DCTA 3NJZA 1KS4A 4GULA 3ZSJA 4GQ7A 2MHFA 4OUMA 1XQNA 4Q4V2 4H7MA 4V1PA 1S0CA 3U11A 1FATA 3FHIB 2VQAA 1FV2A 3KT1A 1AR81 2YPJA 3AMNA 4LR4A 4YARA 4GKXA 4F7ZA 4FOYA 2XVGA 2HWE2 4CYDA 3ZPYA 2RE9A 3VBOB 4Q0QA 1TEIA 2D3PA 3H3UA 4Q8LA 5EV7A 2XWJB 1NCQB 1BVVA 1CAVA 4DRRA 1FXZA 2PTMA 2X5IA 3ASIA 3CJXA 1AF9A 3GBGA 3OY8B 1BXHA 1XXNA 1GKBA 4LO6B 1VBA2 2CY6A 3H3ZA 2OIIA 2WA4A 4HLTA 1ZBE2 2I2SA 4EWEA 3K48A 1CAWB 5KHHA 2R0HA 4E2GA 5C4WB 3POSA 4I3PA 5B2GB 4AI0A 3CF6E 4ZU5A 4JGYC 2WS93 4FTEA 4DXZA 2XGXA 4Q4X3 3Q9OA 1BZWA 2ZZJA 3WD5A 3IPVA 1S2KA 4LULA 1COV2 3UKTA 3VL8A 4Q4Y1 3ZN5A 1KRIA 3VBUB 3RMYA 2DVBA 1ZNPA 2YHJA 5JR7B 2D40A 1QGLA 3TBDA 2VNRA 2A5ZA 4GA9A 3I2DA 4AHXA 3HQXA 5C8WA 2R1BA 1NZCA 1AX0A 4HFSA 1IPJA 1VBD2 2JD4A 3VHRA 5JCTA 4YW4A 4OI4A 1POV0 5AFBA 1WD3A 1UF2C 1ZZ8A 1AYN1 4IEVA 5KC6A 3NAPC 1CQ9A 2ZS6B 4P9YA 3WOGA 4Q4W3 4G4FA 1V6IA 1DU3D 4YGCA 2Q1ZB 4NHMA 4M3CE 4FXGB 2A3YA 2ZX2A 4QQPA 2H6CA 2EAAA 2GAUA 5A32A 5JI7A 2GC2A 4XJWA 3V0BB 1RUJ2 1COV3 3CO2A 1V00A 3H7YA 3V0AA 2XJVA 5DXDA 1X82A 3VHOA 4LLFA 5IUQA 2ILMA 5T5OA 2Q4SA 4Z2WA 1VBA1 2QUOA 1RMU3 5F5QA 2DTWA 1IS3A 2EXJA 2BVVA 4META 4XIKA 4D94A 3LKJA 4AEJA 1RUE1 3TN93 4I02A 4FPFA 1EPWA 3KCYA 1ULDA 1FNZA 2JDZA 3AP4A 3PJYA 2GMMA 2E7TA 2DTYA 4FO9A 1SBDA 3ZXLA 3VL9A 1I1EA 4OI2A 2K2SA 1UIJA 4A2UA 1OMIA 4XF3A 2I45A 4S2FA 1TE1B 3JQWA 3IMNA 4YZ3A 4PIZA 3AMMA 4NWWA 4K1YA 2NQYA 1C57A 3NWKA 4IV1A 2E53A 2VNOA 4CDXA 4IV1B 1SLAA 2O8OA 2UU8A 4KU8A 3NV4A 3ME2A 5C4WC 4AI3A 1DZTA 2P34A 1RHI1 3TAYA 5DUUA 5GZEA 3BPZA 2BYVE 3JU9A 3LGRA 1LU1A 2JG9A 3MFAA 4IEWA 1LB2A 2R073 5JZGB 3MICA 5FOJB 1J58A 3ZIXA 1AUYA 2H0VA 2FZ2A 4YVSA 2HEVF 4Y22B 2E6VA 2I07B 5CFCC 2Z5WA 3FUQA 4HSJA 4FPHA 4O9GA 2XG3A 3HIFA 4AFAA 2Z79A 2YGMA 2FQPA 1S0DA 1RJ7A 1UZYA 2OVUA 4FPLA 2VOVA 3HT2A 3P3PA 2A73B 1AJKA 2R072 2C5DA 5ABJB 4K3UA 4W6WA 1QOOA 4QX5A 1GYKA 2X29A 3AYCA 2ZA9A 3SMHA 1PK6B 2YDEA 1KS5A 4N43A 3VZLA 1CR7A 2JECA 3VBSC 4XJ9A 5L19A 3MFCA 2A6XA 1B35C 3RYKA 5H9PA 3N7MA 1RJ8A 1BBT3 5FBZA 1H0BA 1LHNA 2GNBA 2X53S 1PGSA 4M0NA 1M4WA 5F1RA 1V9U3 4D3WA 3M4FA 5FDBA 1UMZA 1UU4A 1WBLA 2P17A 4XF1A 2DWRA 2VULA 1S0IA 1VAVA 3GYDA 4GKYA 4JC1A 1WLWA 1DQ6A 4XPVA 4F8AA 2F4PA 4P9LA 3EJKA 5BNQA 3IKWA 1ONAA 4JTNA 1ENSA 4COZA 5T5LA 3NAPA 3POYA 2D5FA 5I8SA 4KWJA 3MDPA 1ASJ3 3GALA 1KITA 2TUNA 1CIWA 2R071 2WFF2 4H7LA 1PMIA 1AX1A 2OUHA 2CAUA 5CBLA 4Q4V1 5L7OB 3I54A 2A70A 3MF6A 1PIV2 3MIGA 2XLAA 2AREA 5J36A 1AR82 2ZAHA 4OFGA 2Q30A 5GALA 2Q0AA 3WT3A 1RUJ3 4BLIA 1RUNA 1RUOA 4GH4B 4XJZA 5DZEA 1W0OA 1XNKA 1W6PA 2D6LX 4FP2A 5JLVA 2AH2A 4WVZA 4M3CA 1FT9A 4AVTA 3LOBA 5J96B 1H2LA 1EAH1 4E4ZA 3OCPA 3WZ1A 1RINA 1VBC2 4FOQA 1URXA 2WSVA 3AZWA 1DYPA 2D44A 4OZXA 4RR3A 3OGJA 1NE4A 3VKFC 4IERA 5FTTC 1J3RA 3H1MA 5T5PA 4XZPA 1PVC2 3B7MA 2OW4A 1LU2A 1AR93 1RUG3 1PIV1 1ZBE3 1LULA 3MIDA 4XETA 2ZGNA 3VBHC 3WR0A 1QOTA 2CWSA 2WS92 2RS31 3GBWA 4XILA 1IS6A 2JE9A 4G9SB 4A7ZA 1COV1 3AJZA 2ZGKA 3EQEA 1D2QA 5A33B 3W58A 2JG8A 4HKWA 5LEJA 1MEC3 5FLHA 1HV1A 4AEKA 4YGBA 5CADA 1PO11 2VNGA 3OYWB 4YLZA 1C28A 1C8M2 3ZFEC 1GZWB 1YYNA 2PHWA 3VHNA 1Q8VA 1SEFA 2Y0OA 4N9IA 2ZTNA 2RJLA 4WV8A 1RL3A 1R1A3 1RUD2 3VBHB 1VLNA 1PZ8A 1VBD3 1RUG2 3WG1A 5DG2A 4BZ4A 4AEMA 1HRI1 2ZACA 3VBFB 1AYM3 1L3JA 4Y1UA 5EZWA 4AGVA 3DL3A 5I93A 2VU9A 2OUJA 3FLTA 1AYN2 5BXXA 2DYCA 2XB6C 2ENRA 2R063 2XJRA 4A3XA 5CFDB 2PN5A 3EHKA 3SXWA 4C1XA 2VG9A 5JWPA 2XHKA 4WM7A 1RUH2 4FAHA 3M1HA 4RFT0 5CU1A 4YG6A 3TNPB 2K0GA 3IDCB 3N35A 1HW5A 4W6XA 3FE5A 1QOSA 4S2HA 1WGPA 5KXBA 3CJIA 3AK0A 3NV1A 2RS13 5KXEA 5SV8A 3AKQA 4XW3A 1S55A 4PIYA 3ZYPA 5ACA2 3LA2A 1DG6A 4OULA 2AR6A 1NY71 1NCRB 2HWF2 2O8QA 1VB4A 4IEPA 4XFCA 3RQ0A 2ZMKA 3PVEA 5HXVA 1D0HA 4DQAA 5CG9A 1CAUB 2DU0A 1ND3A 1RUC3 1G9FA 1GR3A 1CESA 5FFOC 1I5ZA 4XMIA 2Q8OA 3PHMA 4UBHA 4DY3A 1NXMA 1JHNA 1GNZA 4LBQA 2WFF3 4JDOA 2WQZC 4CDWB 3ZIWA 3AYDA 1YWKA 2PA7A 2DUQA 1AZDA 1ULEA 2EXKA 4RHV2 4N43C 3ILRA 4HK9A 4Y1YA 4LEJA 1KDMA 3HR9A 2Q1MA 3E6BA 4N9HA 1HRI3 4RR3B 3LSDA 4OI1A 4AGRA 3MLJA 1O91A 3N36A 3TWIA 2PQQA 3HWJA 1IPKA 5HCFA 1D4M2 2X8KA 5E1RA 2CTVA 3JD72 4IXLA 1G9BA 1N3QA 1SMVA 1ZRDA 4DY5A 3MLKA 1RUH1 4AVBA 3B93A 4NO4A 5FO8B 1O3RA 3NKTA 4AG4A 1PO21 4UW5A 2C0ZA 2YYOA 3LCPA 1I3HA 2DFCA 1IHMA 2KXLA 1RUF1 4LUMA 3L2YA 2YC0A 3E6CC 3GZUC 1YFYA 4L9BA 5BNNA 4FSJA 1WW5A 1HQLA 1WW4A 2EF6A 4KL1A 2BNMA 1EY2A 1LHWA 3V64A 1MZ5A 1NCRA 1GV9A 2E63A 3KSCA 2WA3A 3WX5A 2C9AA 4MVTA 4WM8C 1MVQA 2A6YA 1R093 1DQ5A 5CB7A 3CLPA 1AR72 4TSVA 2RM23 3NW4A 1MEC1 1YRZA 3VBOA 1Q43A 3E97A 3UJQA 5J7MA 3MIFA 1PO13 2BNNA 4Z1VA 1NQDA 4AQSA 1G7YA 2VQ0A 1VRH1 1YJKA 2P37A 3VDDC 3RRDA 1ALYA 3ZN6A 2DURA 4E27A 2VUJA 5IK4A 4YVWC 4NPRA 5C9AA 3R4UA 4AF9A 4N53C 3OY8A 1LOGA 1R1ZA 1V6NA 2GNDA 2WKKA 3GZTB 3JZVA 3J26N 5LRSA 2XLFA 2CYFA 4JGYB 4XHXA 3RMXA 1AX2A 1R083 4KG0A 1QNWA 1GLHA 5C4WA 3AMQA 3WLUA 1HRV3 4MXVA 4XF0A 4XXAA 2PLV3 1LOFC 4HVRA 3ZFGB 1RVF2 5I0SA 1QQP1 1DZQA 1RUH3 3LA7A 3MPPG 3S7EA 1OKQA 5I8TA 1Z7S1 2E7QA 5IK8A 2IFWA 1RVF1 4IEYA 1MACA 4K7JA 1IKQA 5BUVA 3DN7A 4LO5B 4PQ9A 3WDYA 4DB5A 4UXAA 4PLNA 3IDEA 1VB2A 3TNQA 4D69A 4R4ZA 5KHGA 1CD3G 3D82A 1RGSA 4LBQB 4COYA 1M06G 4MSVA 1OFNA 4FPEA 3JB8A 3AYAA 2YZ4A 4A7KA 3TOJA 3QLQA 2R32A 3POWA 4Q4V3 2FMYA 3U07A 5GLTA 5AC93 4RGAA 4XMAA 2FHRA 3VHPA 3VBSA 1NQJA 1LODA 2WZPP 2EA7A 2ZHKA 3M7AA 3KD4A 1WLCA 1LEMA 1ZX5A 5C8CB 2GZWA 5KBFA 2Z42A 3RS6A 1KJRA 1SLBA 1IGOA 2HWD1 5A32B 1HXS2 4OUSA 4XXPA 2PHDA 3QD6A 4NOTA 1S0EA 3VBFA 1BMV2 3VBUC 2ZX3A 3WG3A 3AM2A 2VECA 3A0NA 3K51A 1POV3 4BYYA 3OD0A 4GXLA 4I0WB 5A3LA 2XWBB 1O4ZA 3VKLA 3SH5A 1LR5A 4LHKA 1NY72 2TEPA 5LRRA 4F3JA 4JGYA 2PHXA 1RMU2 4Q2FA 2XKOA 2D97A 4HK8A 3WNXA 4OHXA 1DIWA 1F9KA 1O4YA 2B7YA 1JYCA 5KHKA 2OZJA 4LHLA 3D6EA 4MXWB 1C1FA 4JCKA 2ZHLA 3TB0A 1PNFA 3N7JA 5K9YA 4AI1A 4WZFA 1O3QA 4OVEA 4YFZA 2WFPA 1CJDA 2DVDA 3AXDA 2RMU1 4MUVA 3ZXGA 3NVCA 4PJYA 4X6RB 4MYEA 1DBNA 2VMIA 2WQ4A 3AKRA 4M3CF 4DPNA 4JRAA 3RDIA 4P14A 1NA1B 3H8UA 1C8M3 3WCSA 2XJUA 3ZSEA 1U5YA 3E5QA 1V6MA 3HT1A 5GZCA 5FLIA 1IKPA 4FCAA 5BPXA 1ULFA 4QM8A 4YGDA 4OHVA 1OQ1A 4MGIE 1UL9A 3HD8B 5C8CC 4ISRA 2BFUS 3UKNA 2RM21 1ZVFA 1PIV3 1ZBE1 5C9AC 1RVF3 2HEWF 3PVOA 4Q0VA 1VBB2 1AYM1 2MEV3 1J1LA 4FPGA 4FQ4A 5FRAA 5D8AC 2NYYA 3ZO0B 3FFZA 1RUI3 2WLPA 2ZGRA 4HVOA 1F8VA 2CWMA 3WG4A 1NLSA 1PVC3 1KDKA 4RGGA 5I8YA 3KS7A 1DHKB 5CIRA 3FBYA 1GBGA 5T52A 4XFIA 4Y1XA 1WW7A 5D1IA 4L92A 4JV4A 4EN8B 4Y4YA 4NVPA 1FNYA 3QACA 1GQGA 1QDCA 2HWC1 2IXHA 2TNFA 2K9ZA 5EJ3A 2ZGTA 3RWNA 4EWAA 2ZAAA 4Y5Z0 1YUDA 2RM22 4Y26A 1N47A 2FZ1A 4CEYB 1E57A 5T5JA 1A8DA 2CGPA 1N3OA 1PZ7A 1X50A 4AFDA 1UIKA 1LHOA 4ISQA 2QKDA 2VW0A 2IWGB 3VBOC 3AZZA 2XL9A 3RPQA 1G9CA 2P3IA 4HANA 3PMSA 4CDUC 3SNMA 1VAKA 1LOEA 3NAPB 4TLFA 1PO23 4XE9A 2G9GA 4N53B 1H8VA 4FT8A 4N53A 4EWDA 4Q29A 2VOXA 1FOD1 2IXLA 1V70A 2XPJA 1HDKA 3V0BA 3VZKA 2B46X 5L7OA 1LGBA 3USUB 2VVFA 4CDQB 3ZDSA 1Z78A 4SBVA 1UCXA 2XJPA 4QPIC 2GN7A 1B35B 4G3YC 5HCAA 1CAVB 4YM3A 1NCQA 1OQDA 1QXRA 3IT8A