5EFUA

Resting state of rat cysteine dioxygenase h155q variant
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
187
structure length
187
Chain Sequence
TELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLQLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Resting state of rat cysteine dioxygenase H155Q variant
rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 52
structure length 187
sequence length 187
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5efuA00
2UY8A 1UIJA 1NE4A 4JTOA 2Z69A 5JAXA 4HBNA 1J3PA 4HN1A 4Q0QA 4ZU4A 1X82A 1WGPA 2ETEA 5CVRA 1O3RA 2XHKA 5EZWA 2GC0A 4UBHA 2HKXA 1CAUB 5E16A 2H6CA 5K8SA 5EFUA 1CX4A 1NZCA 3NL1A 3WW2A 1DZRA 1J58A 5I93A 4I01A 1EY2A 4QGNA 1QY4A 3LOIA 4P9GA 5JCTA 1RC6A 4PIZA 1PM7A 4QM8A 2BGCA 3HT2A 4MX3A 4LUKA 4LUMA 4E2SA 3PVBB 4Q0PA 1O3SA 3DL3A 3H9AA 3L2HA 5I91A 3NSTA 4HSLA 1J3RA 1ZZ9A 4J1WA 3B02A 5BPXA 3SXWA 4D7SA 3LWCA 2FQPA 5T3NA 2XKOA 3EBRA 3IIAA 3OTFA 5BV6A 3M70A 1DGWA 5FLIA 1ZX5A 2O8QA 4J1XA 1OMIA 3RYKA 1H1IA 4BIFA 3TNPB 3LAGA 1L3JA 2QDRA 1ZZ8A 4QGLA 4IEOA 4HMZA 4AVCA 2XLAA 1JUHA 2IXLA 3NJZA 1YFXA 5BXXA 1ZNPA 2HJIA 1CAUA 4QM9A 3U11A 5FQ0A 3IWZA 2QNKA 3U10A 2VECA 1YUDA 3DV8A 3UKTA 1TQ5A 4YYOA 2IXHA 3BALA 3H7YA 4JVAA 2K0GA 3LZZA 3EQEA 1G6NA 2Y0OA 4IEYA 5I8TA 2ZCWA 3H7JA 2B8MA 4Q0VA 1ZREA 2OYZA 1RL3A 3NKTA 5I0UA 1O4TA 1Y9QA 1EPZA 2PA7A 3HIFA 4HVRA 5I0TA 1IPJA 3KGZA 4FAGA 4KU8A 3KCCA 4LULA 1UIKA 2EA7A 3ELNA 2FMYA 3BB6A 3S0MA 3PNAA 4MGIE 1PMIA 4XETA 2IXJA 2PAKA 3I59A 2BNNA 5FLHA 2PHLA 1CGPA 1X8MA 3WW4A 1QXRA 1LKNA 4LA3A 4LLOA 2OPKA 1VP6A 5HI0A 2OZ6A 1RGSA 4QGMA 1RUNA 4EV0A 4IEPA 3E6CC 4UXAA 3IDCB 1VJ2A 3SCFA 5E1RA 3RYPA 4WZCA 2VPVA 4BH9A 4XF9A 1UPIA 4RD7A 3FE5A 4Z82A 1NE6A 4L2NA 4AQ6A 1EYBA 4O9GA 4EROA 2GH2A 2IC1A 3H50A 1SQ4A 3UKVA 4XFGA 1YFYA 4OFGA 3UKNA 4I09A 2H6BA 2GAUA 2Q30A 1YFWA 3EHKA 2D40A 2WFPA 3S7EA 2XKPA 3BPZA 3USSA 2D93A 1U12A 1I5ZA 4MV2A 4XF1A 3I59B 2GU9A 4HN0A 5J3UA 1O3QA 4KWLA 2CV6A 3ZDSA 4D7TA 2QCSB 4NVPA 3JZVA 1YLLA 1WA4A 2CAVA 3R6SA 1SEFA 3LA2A 3E5UA 1FT9A 4AVBA 4HSJA 4QX5A 1OFNA 3H3ZA 5FPZA 2BEOA 2Q1ZB 4QXKA 2OZJA 2I45A 3I54A 4KL1A 3E6BA 3RYRA 3H1YA 1ZZBA 3MPBA 3HT1A 5FLJA 4MUVA 4Q29A 3OCPA 2IXKA 3N4MA 5LEKA 2UYAA 3GYDA 5KHHA 3NVCA 3SMHA 4R8HA 4EWDA 4FT8A 4IEXA 3ACLA 1ZZCA 4I0BA 3DN7A 3S7IA 5JR7B 5D1IA 4YNIA 2MHFA 2P17A 1OI6A 5F1RA 2ET7A 2PYTA 2PAEA 3QOPA 3E6DA 1NXMA 2CAUA 2VQAA 5BY5A 3FWEA 4N9HA 4YSFA 4LA2A 3GBFA 3E97A 5FPXA 4WBBA 1Q43A 4I3PA 1O5LA 4R52A 3FFQA 5JSRA 2IXIA 3CJXA 4GULA 1OD5A 4HVQA 1ZRCA 1ZZ7A 3EJKA 3DKWA 1GQGA 2BYVE 3ES1A 4A2UA 4F7ZA 1GQHA 1O7FA 3CF6E 4YARA 3H3UA 5J7MA 1CAWA 4WVZA 3EO6A 2PHDA 4MH0E 4HLTA 2IXCA 1RTVA 4Q0UA 1SFNA 1X7NA 3C3VA 3G7DA 2XGXA 2OA2A 3OGJA 5I0RA 5CU1A 3HQXA 3PLQA 3NW4A 1YWKA 4E2GA 1Q5OA 1I6XA 2BNMA 4KWJA 2B9UA 3E5QA 4H7LA 1UW8A 2GC1A 3RZZA 4KU7A 4PIXA 2Q4SA 5LRRA 3KMHA 3RNSA 2GC3A 3CLPA 4HZFA 4XEZA 2PQQA 3RPQA 1J59A 1DGRA 3H1MA 3TNQA 4AVAA 4DINB 3KSCA 4K8FA 1O3TA 2UYBA 4ONUA 1J1LA 4I02A 3BCWA 4XF3A 2ET1A 2GC2A 4IETA 4AXOA 4MGKE 2XLGA 1J3QA 4X6RB 1CAVA 4FAHA 1RUOA 4PJYA 4OLLA 2PAMA 5BUVA 4BHPA 4Z07A 2E9QA 5KHIA 2KXLA 2B5HA 3E5XA 4AQ2A 4L11A 1FXZA 5CADA 1NYWA 4JV4A 4X6QB 3SCHA 1CAWB 1ZRRA 1FI2A 5JSPA 2CGPA 1YHFA 4XF0A 4F8AA 4EWAA 1CAXA 1Q3EA 3IDBB 4KWKA 5KHJA 1V70A 4CYDA 5C8WA 5KHGA 5AVPA 3ROUA 3IBMA 5I8SA 3WW3A 5C6CA 1XRUA 1DZTA 4E2QA 1HW5A 3OD0A 2PTMA 2QJVA 4PIYA 3OF1A 1XE7A 4Q0SA 4N9IA 4XFIA 4IEQA 3BU7A 4ZU7A 1LRHA 1X8EA 2ZKLA 4MGYE 1XE8A 2GZWA 1ZZ6A 4MGZE 1LB2A 2N7GA 4TLFA 2DCTA 4QMAA 4YRDA 2EAAA 2PFWA 1WLTA 3CO2A 4ORFA 1IPKA 5LEJA 2MPFA 3QACA 1YFUA 3FX3A 3LA7A 5JSOA 4IESA 1EP0A 4JTNA 4MZUA 2ATFA 3I7DA 4LEJA 1ZRFA 4IEVA 4FBFA 3ES4A 2Q0AA 3SCGA 4EWEA 4XFHA 4O9EA 4B29A 2V09A 5J48A 2O1QA 2EVXA 3U0ZA 4XFCA 4BYYA 4IEUA 1CAXB 2H0VA 2QVSB 3H8UA 4IEZA 3LA3A 4XFFA 2F4PA 4HVOA 3VHRA 3MDPA 2K9ZA 2Z2SB 3CEWA 2UY9A 3O14A 1VR3A 2BNOA 3FJSA 3KGLA 3ST7A 2XL7A 3FHIB 1QWRA 4XFAA 5FDBA 1QXJA 5I8YA 5I0SA 4IERA 4UBGA 1O5UA 2WC2A 5KHKA 4I2OA 4IEWA 2XLFA 3FZ3A 3D0JA 4LTAA 3MZHA 1ZRDA 2XL9A 2D5FA 3D0SA 1ZVFA 2C0ZA 3CL1A 5FQ0B 3SHRA 2D5HA 3ETQA 3RDIA 5LRSA 1CAVB 1H1MA 4ZU5A 3D82A 1UD1A 2MNGA 4XF4A 3H1WA 5FCCA 1UCXA 3M3IA 4XFBA 1LR5A 1Y3TA 5KBFA 3MYXA 4META 3WW1A 4I0AA
chains in the Genus database with same CATH superfamily
2XVKA 3WDTA 4JTOA 2Z69A 1RUH3 4HBNA 1RUC3 4LK7A 2XQRA 3POBA 2FHRA 2YC2A 3MW2A 2JICA 1X82A 4LBKA 4ZU4A 3GXUA 2WT1A 3WEZA 1DQ5A 1OQEA 4HPKB 2GC0A 4LBQD 4TSVA 3ON7A 1HXS3 3WX5A 2H6CA 2V72A 2WAOA 4RHV1 3VBOA 5K8SA 2DUOA 2IVJA 2HWD1 3ASIA 3VKLA 3WXPA 4CDXB 3WW2A 3MW3A 1JZ3A 1J58A 5A32B 5I93A 1F5JA 3LOIA 4JGZA 4H55A 4XOGA 1OUXA 4UFMA 4P9GA 1FAYA 2VULA 1W6NA 1GWMA 1RC6A 2BBVA 3F2ZA 1QJY2 3NNGA 4JGYC 4K21A 4UI9L 4XBLA 4PBOA 4RR3B 2ZGOA 5ANNA 3VBUC 5C3QA 5L9RA 3CJIA 2O8OA 3RSJA 4E2SA 3PVBB 2ADDA 3FL7A 4RYDA 4CCNA 1NCQB 3H9AA 1WLDA 3L2HA 5FREA 3UT0A 4O65A 4UT5A 1C28A 2OX0A 2VTXJ 5I91A 2JG8A 4S2HA 2JE7A 2R062 2BVVA 3FC0A 3IZOA 4CDWA 1G9BA 4Y20B 5BNNA 5A3MA 1SFPA 2J1EA 2VU9A 1W6PA 3DYMA 4D7SA 2RE9A 5DAQA 1KRIA 1E5HA 5C33A 3B94A 3MI8A 5A7QA 5T3NA 3WINE 4YFWA 4DXZA 2VQTA 1RHI1 1XPWA 4DY3A 1O4YA 2JDKA 3TN93 1PMJX 4CSWA 3NRUA 5EJZB 2WO1A 1BVVA 1D0HA 2WNUB 3O0VA 5BV6A 4Z92B 2VOKA 3M3QA 4H14A 4LKFA 5C3RA 1AR92 3MV11 1ENRA 4BIFA 3LAGA 3TWIA 1ZZ8A 4QGLA 4UF0B 4HMZA 1WD3A 2XLAA 1JUHA 2DURA 3WDWA 3VBRA 1DIWA 1L7QA 1NT0A 1YFXA 4XVHA 3WNNA 3I97A 4E4ZA 2ARAA 3R4SA 3WQ1A 3WNMA 5K4LA 1OSGA 1MR5A 1S0BA 2BJSA 1FATA 3FLTA 5FY5A 1MS1A 2CTVA 2IXHA 2TEPA 1MZ5A 2K0GA 2X53S 5CIRA 4GQ7A 2RJ2A 3BKZA 1JYXA 1ODMA 5I8TA 2AENA 2UURA 3ECQA 4BQ1A 2AZ5A 4RS5C 4FPYA 4LBMA 2Q8OA 3H7JA 4BIOA 1AR91 2B8MA 4Q0VA 1ZREA 3WF0A 4JGYB 4QD2A 1EPZA 1JZ5A 3IB3A 4HVRA 1IPJA 2RM21 3KGZA 4A3ZA 2XJSA 5FFOC 4Y1YA 1QH6A 2KA3A 4COZA 1ULFA 3SC7X 5GLWA 1YIPA 1AYM3 2XJTA 3CNAA 4XPVA 5FZ3A 3VDDB 1CIWA 1SLCA 4XJWA 1TMF1 2W1SA 4AAPA 2WWUA 2Y0IA 2XR4A 4BQ2A 1JODA 3I59A 1YQ6A 1YI9A 1JZ6A 1XNBA 3ZXGA 4Q4Y1 4KGGA 5K0UB 3AZVA 2A70A 1LOBA 4GMP3 4ITCA 4LA3A 1XC6A 3TN91 4AGVA 4ZHNA 3VHNA 2W3JA 2ZGPA 2UWBA 2W2IA 2YPDA 4LITA 2PLV3 5IVCA 1SZBA 4XUTA 4QGMA 1C4RA 1RUNA 1RUJ3 1YQ8A 2JXAA 1H8TB 1WMXA 4B4RA 2P3JA 4ISQA 1GP4A 4UXAA 1WKYA 2UWCA 1H4HA 3GJAA 3SCFA 1RXGA 4ATEA 4RSUA 3VBOC 2GNTA 3ZPOA 2W87A 5C3OA 1Y7BA 4URTA 5FIXA 4S2DA 1JN2P 1UMHA 2VUJA 5GZDA 1Y4WA 1WCDJ 1HIXA 1DYOA 4BH9A 4QQPA 5AC93 5K7PA 3WF2A 4BK4A 1MEC1 4Z82A 1XNAA 2WO3A 4M4PA 3TEYA 4S2GA 2J7MA 2B9VA 4XHXA 4EROA 5B4NA 1VBC2 4CXXA 2PHFA 2IC1A 4CEWC 4C1WA 2BV4A 1YFYA 3VDBA 3ACFA 1H2NA 2GAUA 1MZEA 4MGSA 4XIKA 3EHKA 4XTMA 1FNYA 4AW7A 3KVAA 2PHUA 3SH3A 1TME1 4G9SB 3GZAA 1Z7S2 4GA9A 3BPZA 2VZVA 4ZXKA 4FPJA 5L7OB 3VBFB 1QJY1 5DMYA 4FQZA 2JDZA 1I5ZA 4FPHA 2Y33A 4PQQA 1VBC3 3BN6A 1BEV1 3JBG1 3ZR6A 3AYAA 2X29A 3WR0A 5C3PA 2C4XA 4KWLA 3QD6A 1VBC1 3KLSA 2R061 2V73A 4AF9A 1YNAA 2QCSB 1SG3A 1UY2A 3WDYA 4EN6B 1CONA 1ULDA 1Z78A 4IE4A 4RGKA 1K5MB 3JZVA 1UOFA 1YJLA 2VY0A 4FO9A 4OI2A 2GH8A 2AGSA 2HEWF 2SLIA 4XAEA 1KJLA 3LA2A 3MIBA 3E5UA 2RMU3 3AMHA 1OFNA 2EAKA 4CEYA 1W6NB 3I3DA 3WCSA 3K77A 4N53A 1WD4A 2D44A 1JMUB 3AYDA 4KL1A 4LR4A 4NHKA 5JWPA 1R64A 1JBCA 1PZ8A 3RYRA 3MPPG 3N9LA 4D6RA 1PVXA 1QJEA 2ZEWA 3PTRB 2ZGRA 2Y6FA 5D2AA 4CDUC 5EQUA 5LEKA 5CKQA 3WF4A 2W1QA 4OULA 3DUIA 5FYIA 2DFCA 4CEWB 3GALA 2QQIA 1RUJ1 2W47A 4QU2A 3BTYA 2D6PA 4COWA 5EWSA 5FYTA 3S30A 4IEXA 3U4XA 4XHBA 4ZKTB 3ACLA 3OUJA 2DBIA 1J83A 4I0BA 1ALYA 2DCYA 2UU8A 5T5LA 1SBFA 1DU3D 3VBFC 4YNIA 4XXPA 1OI6A 5LBCA 5FZBA 3AKTA 3UGGA 5CAZA 5DDJ3 2PAEA 3ZFFB 1AF9A 2RM22 3AXEA 1BK0A 1NXMA 2QFEA 2CU5A 2PELA 4KNCA 4AEMA 1ND3C 1AR93 5D8AA 2QQVA 1VLNA 2R30A 2YC0A 2ZACA 5BY5A 3U75A 2JG8B 4YSFA 2OPWA 1PNFA 2PQSA 3T3YA 2WS92 2J1RA 1G9DA 4A41A 4XACA 5FPXA 1SBEA 1F5FA 1VE0A 4CU8A 4QQLA 1YC61 4HVQA 3M3OA 1O59A 2QQOA 2XUMA 4LKDA 5JUVA 4OQ8A 4PI2A 2BYVE 5IJRA 2VMCA 5FP7A 5IWFA 1GQHA 4F7ZA 4YG3A 1HN0A 1RUH2 1GOGA 3N7KA 2ZAHA 4R9DA 2QKDA 3CF6E 4YARA 1XOYA 1QGLA 3H3UA 3MIFA 2R1BA 4OHWA 1BQPA 1W04A 4QQHA 4W8JA 1JS9A 2ZHLA 3I2IA 4MXWA 1UXXX 2FDJA 2PHDA 5FK8A 3VD5A 4DEVA 2IXCA 4QHZA 4AEKA 2R32A 4AI3A 3W5MA 1BBT3 1W6QB 4IV1C 2VOXA 5A33B 3AKRA 3U4SA 4IE5A 1US3A 2OA2A 2ZOEB 4CEWA 1X36A 1RMU3 3PMEA 4YZ5A 2GNDA 2BFUS 2ZPXA 1AL0G 4INDA 1XBFA 2ZABA 3MIEA 3Q8BA 1GQPA 4KWJA 2CY6A 2B9UA 4Y1XA 1W6OA 1OD3A 1UOBA 4OI1A 1MEC2 4QHOA 3IAQA 4LNVA 2GC1A 2WSVA 2P37A 5FZ8A 3RZZA 2NP0A 4PIXA 3LQCA 1T6BX 3VD7A 5JI9A 1REEA 3KHBA 4XURA 4W6WA 5FYZA 4YPJA 4EN0A 5LRRA 3RZJA 1W6OB 3KMHA 2RDSA 1C1LA 2GC3A 1IKQA 1SACA 2CSGA 4HZFA 4JC1A 4XEZA 4OYUA 3ZN4A 3FBYA 3H1MA 4JAAA 4AVAA 1W8FA 5FKBA 1LOGA 1GP5A 4CDQA 2UYBA 4HOOA 1UZVA 2K46A 4FTSA 4COUA 3FN9A 3ZKYA 5GZCA 3PUHA 3GHNA 3HEIA 1PGSA 5HCHA 3GF6A 3SEEA 3UETA 3C2UA 3NV1A 5C8CA 2RM23 1WMFA 1OA4A 2Y64A 1GU3A 3WOGA 1J3QA 4QPYA 2UWAA 1TME3 5F5CA 3RI9A 4OLLA 2BERA 2PAMA 3AFGA 5F6LB 5BUVA 1POV1 4Z07A 4QQOA 5FPAA 4ES9A 1JU3A 2XJRA 3E5XA 4AQ2A 5IATA 3I2KA 4QKNA 2B4KA 3A21A 3ENRA 4DFSA 4IL7A 4JV4A 3T2PA 4X6QB 3AL5A 2XXZA 5JXIA 4U2AA 4CDWC 2VXJA 1FI2A 3I3QA 1AR62 4GKXA 3ZXJA 4DUVA 2DVGA 3DGTA 3RJRA 4XUPA 4L9BA 3T1MA 1F31A 1RHI3 2VTXA 1GANA 5KHJA 1LEMA 5KHGA 2GMPA 4JDMA 2HWB2 2Q1MA 4IV1B 4QXBA 1RUE2 3K46A 5M0TA 1UKRA 1AYN1 1U5IA 4FPEA 4QX7A 5C9AB 1XRUA 4NIGA 1DZTA 1ONAA 3I8TA 4E2QA 1LOFC 1COV3 5DUVA 1ULPA 4JGZB 4BLIA 1CZVA 5ACA2 1FNZA 1XE7A 3MLLA 1JHNA 4N9IA 5KXCA 4ZU7A 1S0GA 1COV1 4YW5A 4N7UA 3ZN5A 1XE8A 1WLCA 3B9IA 1PIV1 2GZWA 3T0DA 1IOAA 1S55A 1LB2A 2N7GA 2RS32 3U37A 5BYNA 4NE9A 4CDQB 3LGRA 4YRDA 2PFWA 1JU4A 2C1FA 2HWB1 2B42B 2E7TA 2WLPA 3AP7A 3HN3A 4ORFA 4OMCA 4PDWA 1KFXL 3VZMA 2WZ8A 4QDRA 5LY2A 4CUAA 5H9QA 1JYNA 2DUQA 2JDYA 3QACA 4WM7B 2CDPA 2JG9A 3LA7A 3ZXFA 4IESA 1KFUL 1LOCA 2BW8A 1FMD1 5IHRA 4Q26A 5ACA1 1HRI1 1PK6B 4LEJA 5GLTA 4EQVA 4IE6A 3W9AA 3MF9A 2WFF2 1DYPA 3ZN6A 3LDRA 3ZR5A 2Q0AA 4FPFA 4NO4A 4QXHA 4U36A 3SCGA 5LA0A 4O9EA 2FZ2A 2VOTA 4JRAA 2RS31 4AFMA 1PZ9A 4OUMA 5K0UC 2HWD2 1VAKA 1XE0A 3AB0A 5GLZA 4FOYA 5T55A 4BYYA 2QVSB 2VMDA 3H8UA 4FFFA 4GJZA 3LA3A 1K5JA 5DAXA 3WP5A 2ZHMA 3B9CA 1W9YA 3T0AA 3WQ0A 3VHRA 4HVOA 2R49A 2P3IA 2Y6GA 1DZQA 2BVBA 1UPSA 4BQYA 2Z2SB 3CEWA 5IUQA 3AYCA 4PT6A 1FMD2 2GP3A 4QXCA 1LOAA 1HRI2 5FWJA 1NX9A 4M0HA 1I3HA 2AREA 4Y5Z0 1HXS1 5FTTC 3M8LA 5FZ1A 3GDBA 4JGZC 4QPWA 1QXJA 3WP4A 4DNYA 4LT5A 1CX1A 2D6OX 5I0SA 4GB32 4Y1UA 2D3SA 5LWBA 1GR3A 4CUGA 4IERA 1QJZA 2E33A 3JB4C 4UBGA 2WQ8A 3AP4A 1O5UA 4P02B 2A3XA 2WC2A 5FUPA 5FOBB 4IEWA 1UU6A 2XLFA 1GFF2 3FZ3A 4QDSA 1AR63 4B7EA 2ORXA 1QQP2 4NRQA 1FPN3 1LCLA 4PCRA 5FYMA 1Q8QA 4B3NA 3WUDA 1IS5A 1D4VB 4Q4X1 5FQ0B 3OYWB 2EF6A 2VVFA 1ULEA 5IW0A 3I2FA 5BNOC 5LRSA 2J42A 4UYBA 1RXFA 3LIHA 4LMFA 1WW6A 4ZU5A 3GJBA 1IPSA 1VAMA 5FCCA 3H1WA 4AFDA 4KBBA 1UCXA 5HCAA 4FXKB 2BGPA 3LF7A 5FXXA 3FUQA 3M3IA 1LR5A 1Y3TA 4FPCA 2FDFA 3G6JB 5A6XA 1EV13 4EYUA 3WW1A 3FHQA 2YG0A 3KT7A 3POGA 1UIJA 3HVDA 4AGRA 1NOVA 1NE4A 2FCUA 5L36A 4OI0A 4AAXA 3DYOA 2QQMA 4AEDC 4EN9B 2EICA 1H0BA 3THCA 1K45A 4Q0QA 1A8MA 4NN0A 4JKMA 2L9LA 5CVRA 1E5SA 4CP1A 2XHKA 1NCRB 3OJBA 4Q4X2 3L2YA 3CDZB 5CBLA 1CAUB 2P5BA 4CE8A 4MO3M 2OKXA 5A6QA 2OUJA 3KQRA 2A1XA 3P5BA 3AL6A 3MFAA 1CZTA 2XOMA 5ANQA 1YEWA 2C9AA 2R063 3AC0A 3NL1A 1F2NA 4LHKA 3J8F2 2HWF1 2NLRA 4I01A 1QY4A 2HWC3 1AYM1 4AVSA 4UFHA 1AR83 2A3WA 4XJ8A 2VW1A 3O0XA 1VBD1 1QKQA 1RUF2 1HLCA 3LEIA 2VGDA 2JIGA 2WT2A 3R4UA 4BM8A 3OD4A 1HB4A 1KEXA 5IVVA 5FZ0A 4CEYC 1F35A 1XB9A 2BGCA 4LHSA 1C1FA 1PO22 1RUE1 3HBKA 2WQZC 3POIA 4LUMA 4LUKA 4EJRA 2YZ4A 2ZBJA 1O3SA 4CDUB 2W9XA 2PHWA 3K75B 4ZY9A 3NQHA 2DU0A 4Y22B 3S6PA 3VBHC 3Q8CA 5FK7A 5FZAA 1A8DA 5C5UA 2BWAA 3N7LA 1HV0A 1DGWX 2ADEA 3RRDA 1MZFA 1Y43B 2R16A 3S5QA 3NSTA 4CDUA 4QHBA 2VR4A 2ZX2A 4HSLA 1J3RA 4WVMA 1ZZ9A 1Q8VA 2CL2A 2VOWA 4J1WA 1DQ0A 4Q4Y2 2BRTA 1UOJA 4Q4X3 3M3CA 3A4UA 2BOIA 4BLJA 3IIAA 2Z5WA 3RVHA 2YBSA 1GV9A 2A6ZA 1DLCA 5JMOA 1IS6A 1BZWA 2B45X 2EALA 2JWPA 3KF5A 2VNGA 1URXA 2P34A 2E31A 1ZX5A 4OUSA 4YZ3A 1H1AA 3WDUA 3JXSA 1H1IA 4GALA 2ZGNA 1B35A 4IXLA 1GZTA 2ARBA 1L3JA 4LIVA 5FMDA 1OPMA 4IEOA 4CP2A 4Q4V3 2GNBA 1XU1A 3LOBA 3NJZA 1GNHA 4K8RB 4RR3C 1LEDA 1IG0A 5LZ6A 1Q8SA 1A78A 1XYOA 2GSYA 2RHPA 3U10A 4TN7A 4YVSC 2VECA 4AHYA 5FY7A 4LE3A 3UKTA 5J98B 1KXGA 1TQ5A 4WVVA 4YYOA 3POJA 2ILMA 1VMHA 4M3CF 3EQEA 1G6NA 2Y0OA 2PHXA 5F5IA 1EPWA 1W06A 3OGGA 1RUD2 4FPOB 3OPWA 5SV5A 2B39A 3K4ZA 1QJX2 2DBNA 2VMIA 3JQWA 3P6BA 2BBAA 1RL3A 4COVA 3PVOA 1PZ7A 1O4TA 2I74A 2LS6A 2WN3A 5A7NA 3BTZA 3OBRA 4B1LA 2PA7A 3FFZA 3B5LB 3FUOA 3NJYA 1V6LA 1OLRA 2JG9B 4KU8A 5C8CC 3SISA 4Y1VA 4OQ9A 4LULA 3A22A 2PLV1 3UK9A 2HEVF 4UOJA 5JPMB 2FMYA 1HRV3 5HPOA 4LBNA 1QOSA 4RFRB 4FXGB 4CXWA 5LK5A 5ABJA 4NIDA 3TBDA 2PAKA 1D4M2 4KBZA 2BNNA 2HWD3 1V6IA 2GALA 2YY1A 4CCMA 1W8WA 1VBE1 3O12A 4PLNA 4QX2A 4CU6A 1JOPA 1SDDB 2VBDA 1QXRA 1NQDA 4LLOA 5JMCA 2Y6JA 3LDKA 1QQP3 2CYFA 5DQ0A 4CZSA 1GWLA 4XBNA 4XZUG 5T54A 4PLOA 1OH3A 3WNXA 1VP6A 2J22A 2NMNA 3D5OA 3T2OA 5HI0A 4WM7A 3APBA 4LBQB 2PLV2 3ZX7A 2XJQA 4EV0A 3KHCA 1OF3A 1N1TA 3OY8B 2A7AA 2JDMA 2BOJA 5FBJA 3ZVXA 1VJ2A 2AR6A 2BQPA 5FY9A 1AL23 1OKQA 1W28A 3QH7A 1IGOA 4N53C 2HWC1 5E1RA 3RYPA 4XF9A 4RD7A 1PGL2 1MQTB 1RUJ2 3AJZA 1RHI2 1EYBA 1GSLA 1YO8A 2BDRA 2V5YA 3IKWA 3ME2A 1S4CA 1ST8A 4XFGA 2XDVA 3BOPA 3KV4A 3KV6A 1MQTA 1V6KA 4I09A 2H6BA 1AXZA 4MGQA 4DUXA 5JZGC 3AP6A 3BODA 2Q1FA 5K9YA 4ZZ8A 2D40A 3S7EA 3OG2A 5APAA 2FDIA 1LJ7A 4BDVB 3NJXA 3WDVA 2W46A 1LGBA 3UV9A 2WN2A 1S0CA 2JECA 2ZS6B 4W65A 4DS0A 5FZ4A 4MV2A 5CB7A 5J96B 1H8TC 5KXDA 3I59B 2GU9A 4HN0A 3O7OA 4XC9A 1PGL1 1C3HA 1H9WA 1QDOA 1FV3A 4NMIA 3VZJA 2CV6A 2OUHA 5K0UA 2VZ3A 2ZGUA 5EJ3A 5A7SA 1OPOA 4RHV3 1ND3A 4CPBA 4N43A 4UFIA 2VZRA 4BCUA 3OYWA 2VAUA 1G9CA 3JQXA 5DUWA 2VZOA 4XJ9A 1GZ9A 1EAH3 2AEYA 2G4IA 4YGDA 3ZMNA 1SEFA 1YXWA 2D98A 5L19A 3ACHA 5ISLA 5A1LA 4AVBA 2W39A 4QKDA 4QX5A 3CJIB 4Q1PA 3ZSJA 2XWJB 4XCBA 3H3ZA 5ACA3 2YU1A 2BEOA 2Q1ZB 4QXKA 4XE9A 1AUYA 1UY4A 2VVEA 5CFDB 4ZS3A 5FMOS 1JW6A 3AM2A 4QPIA 5FZDA 3MPBA 2W08A 4Q29A 3OCPA 4Y1ZA 2GN3A 3C8XA 3ZOIA 4M01A 4GH4C 3BTAA 2VCMA 1NCRA 1PX3A 4Q27A 1SLIA 4DO0A 2E26A 5BNPA 4ARXA 5KHHA 4BQ3A 1DLLA 5DUUA 3A0NA 2JENA 1QEXA 5JZGB 2XHNA 2O14A 1SLBA 1LTEA 3JD72 5FZCA 1HJFA 2DCJA 2PHTA 3AK0A 5LBBA 2GMEA 3MHZA 1N1VA 3THDA 4QX3A 5LA1A 3S7IA 4CUBA 5HXVA 3ZIWA 1UMZA 2VBPA 3OBTA 5LATA 1ENSA 2WO7A 5F1RA 1UZWA 2RG4A 2D3RA 1WMEA 3DPRB 3I3BA 5FPLA 5JR2A 2J1TA 5KC6A 5CFCC 1VRBA 1HQWA 2W91A 2WA3A 5CZKA 1W3XA 3U14A 5A3PA 2FD8A 2IVIB 4E4SA 1AXYA 2YXSA 3FWEA 4AR2A 5FV3A 4LA2A 4PDWB 3WG3A 3C7OA 1MPXA 1D4M1 5FZ6A 2YPJA 3NNMA 5L9VA 4NPLA 4E8CA 4Z2WA 1PIV3 2LM3A 3I2JA 3FFQA 4R52A 2ARCA 2IXIA 2HLEA 4BOWA 1OD5A 2A5ZA 1WW7A 2DCKA 1ZRCA 1GICA 1AR61 2A3YA 2TBVA 3DKWA 3E1F1 4P9WA 4YW7A 3PU8A 5LA2A 1WMDA 2H0BA 3ZSMA 3WNKA 5F3IA 1PHMA 1O8PA 3FLPA 4TLGA 3ZFEC 4AWDA 4AZZA 2E32A 2AUYA 3NNFA 5LBFA 5LW9A 3O1OA 1IZ3A 4IGQA 3V65A 2J1AA 2XVLA 3SKJE 1OLME 3ALQA 2JE8A 1VIWB 2TUNA 1AVBA 1R1A3 3WT3A 1H9PA 3ZKUA 1UYZA 4HXCA 2XGXA 3PVEA 2AYHA 3OGJA 4UW4A 1RUF3 5KXEA 5IFPA 3HQXA 3I2GA 4Y26A 5H9SA 1LGCA 2AACA 5FO7B 1YWKA 3RQ0A 3P3PA 4E2GA 2ZKNA 3RZLA 2HWC2 1HQLA 2VO5A 3Q9OA 3E5QA 1HN1A 5F6KA 4H7LA 2A73B 1JZ7A 1UNBA 2JJ6A 4EZHA 1IKPA 1OH4A 3VDAA 3TEZA 5DDJ2 2HYXA 2YYOA 4GAZA 3N9OA 4JQRA 2G9ZA 1J59A 1HB2A 4P9XA 3RPQA 5JVVA 5DAWA 1KJRA 2RS51 4K8FA 2Y38A 2VMEA 4KI5M 4ASLA 3GGLA 1O3TA 1UZ0A 1BBT1 4ONUA 4WV8A 4LE4A 5EP9A 4RR3A 2ET1A 3BVCA 4GD4A 4DRRA 2FBEA 2GC2A 3ORJA 2XLGA 2XMLA 4R4ZA 5DPNA 4PDWC 5JPNB 5IK4A 1Q8OA 2P3KA 4P9LA 2QZ3A 4BU2A 2JKBA 1RUOA 4PJYA 4MADA 3VL9A 5JLVA 1W2TA 1SLLA 3VBHA 5KHIA 4NRPA 4XMIA 1CN1A 1FXZA 3M3EA 5FR3A 2A6XA 2E51A 3RZGA 1NCQA 1W6PB 3J7HA 1RB8G 5HV0A 4BJ0A 1W03A 2O0OA 1DP0A 5JOXA 3F95A 4LKSA 1WLWA 3KM5A 3WV6A 3HNBM 2ZMLA 3OB8A 4W50A 5DG2A 1UOGA 3ZFEB 5JSPA 1MZ6A 4YW6A 4P9IA 1N47A 4GMP0 4D6SA 1FX5A 3J7MA 4XF0A 1KDKA 2R0HA 3N35A 3OBAA 1VALA 3RJ2X 1CAXA 3ZYRA 3P3NA 4KWKA 4CVUA 5J09A 1V70A 1OHFA 4GB33 1W39A 5C8WA 1WW5A 3PJQA 3IN9A 3ZFGC 1CWPA 2MEV2 3IBMA 2JD9A 1S0EA 5I8SA 1S1AA 1H8VA 2B7YA 4GB31 4I0WB 1F9KA 2WKKA 4YW2A 4TXWA 5FXWA 3C7FA 5FZGA 2B46X 2WYSA 2Q8CA 4CA9A 5DXDA 5FMBA 4PIYA 3PIGA 1OKOA 4Q0SA 1H30A 4HG6B 5T52A 3BU7A 1X8EA 3WHUA 1LHVA 1RJ8A 2VMHA 4YVSA 3N9PA 1W2NA 1ZZ6A 4A7YA 3CKHA 5FAXA 3JD71 2DCZA 5FYYA 1LNSA 4X8PA 1ZRIA 4HETA 4AI2A 4TLFA 2DCTA 4B8EA 1W99A 1HV1A 4QMAA 2D43A 5FZHA 2HBTA 4RQPB 3W58A 2BUKA 2X05A 3CO2A 1RUE3 5A33A 1BJQA 3OGVA 1IPKA 3H0OA 3MIHA 4YW1A 3USUA 2MPFA 2WQ4A 5D8AB 2ERFA 2BU9A 4IGOA 2QQLA 2NYYA 3FX3A 5JSOA 2X5IA 1HDKA 4JTNA 4MZUA 4OMDA 2ATFA 5D21A 2LALA 4M00A 3ZXDA 1X33A 1DQ2A 1H4GA 2HWF3 3SEPA 3RMXA 5A1FA 5C70A 4MOAA 1ULGA 4IEVA 2VNOA 2E6VA 1H6YA 4V2WA 4XFHA 2VZTA 4P5HA 5JOYA 5J48A 2V09A 1W6MA 5GALA 4IQPA 4CDXC 1OLQA 4B1MA 4KG8A 4XQ4A 2MEV3 4XCAA 4UAPA 2E7QA 4XFCA 2ZHNA 3MEPA 3H8XA 4IEUA 4BPZA 4KGQA 2AH2A 4Z1VA 1ZBE1 1AYM2 4WM8B 4O7XA 2ARXA 1V9U2 4OHVA 4JHTA 1RUF1 4OUEA 4EZ4A 3O14A 2RJKA 1VR3A 2BNOA 2SBAA 3FJSA 3KGLA 4Q1RA 4WVWA 4YM0A 5GJ6A 5A3UA 3ST7A 2XL7A 3TRSB 1RUG3 1N3QA 1PO21 3OGRA 4UW5A 1JUIA 4WM7C 3WY6A 1WW4A 4LO7A 5FZ9A 1M4WA 4RGAA 1H2LA 1XU2A 3JB8A 5I8YA 1XNCA 4N53B 4DMIA 1AJKA 2WNVA 3PUSA 4K1ZA 2P2KA 1PK6C 4NPRA 4SLIA 2WDBA 1YCIA 4I2OA 5KHKA 2WRAA 2IZWA 1PVC1 1MVEA 3J9SA 3K4AA 4HKWA 4N43C 1E57A 1R083 2VUDA 3D0JA 2WIIB 2XL9A 1EUTA 1QIQA 1YQ5A 4W6XA 2VCAA 3CL1A 2YV8A 4RQPC 3SHRA 4QKBA 1LGNA 1QOTA 5G05L 4Q4W1 1CAVB 1UO9A 3KS7A 1IHMA 4OVEA 5FMOL 5D8AC 5FY8A 4YM3A 1N1SA 1AHSA 2BWCA 4Q4Y3 4YZ4A 2RS52 5C9AA 3CHXA 4AL9A 3K51A 3LPFA 1AYN2 3DPRA 4OI4A 3ABZA 3VKFC 1C8M1 4QDQA 3VZKA 1Y9MA 4META 2QBXA 3WP6A 4GWJA 3E6CC 5CG9A 3WP3A 4K3UA 3GNEA 1GOFA 1RYYA 4RN5A 5JAXA 2FCVA 3O0WA 4YZ2A 1J3PA 2XB6C 3GHMA 2VD7A 4D8MA 1WCKA 2VM9A 1BVP1 3N9QA 4FP3A 1B35C 3N7JA 1O3RA 1PIV2 5EZWA 1YI7A 4DXTA 3NJVA 5KR7A 1DQ4A 1QJX3 1V00A 2ZXQA 4XDOA 4LBQA 5E16A 2D97A 1VBE3 1OLMA 2WJSA 2W1UA 3BOWA 4WM8C 4Q4W2 4Y5TA 2F6BA 3X29B 5EFUA 2ZEZA 1NKGA 1VPHA 3LEGA 4A7ZA 4C0HA 1WCSA 1DZRA 4HK9A 3K2OA 3JU9A 3WD5A 1QJX1 4FQ4A 1EY2A 3CJIC 3L9JT 2TNFA 4QGNA 5JXJA 4LBLA 3LEMA 1OOPC 2R071 5FOJB 4DEQA 1ZBA3 1ZA4A 3VGIA 4PIZA 2Y6KA 5CFDC 1PM7A 2F4LA 1A6CA 1E5IA 5FZOB 4QM8A 4GWIA 2MEV1 5CEHA 1UU5A 1MS8A 3HT2A 1VMFA 2P6HA 4XZPA 5KC5A 1JYTA 2NQYA 1NZIA 5B4XA 2J1SA 1J84A 3M4FA 4C0BA 1F8VA 3DL3A 2QZ2A 2DYCA 3EYPA 4XTPA 4NPMA 1REFA 2VXRA 2VBBA 4JGYA 2WZR2 2W95A 1DG6A 1KS4A 2FZ1A 1VBB3 4NR1A 1A3KA 1EV12 4FFHA 3ZYJB 4ZXEA 3UGHA 1NCRC 1VBE2 1W0PA 3ZMOA 3BPSA 5BPXA 3SXWA 1KS5A 1PO23 2WABA 3IDAA 4K1YA 4S2FA 5F2WA 2XKOA 3SLIA 2WL1A 5ABJC 1LHWA 2Y34A 4L8QA 4RGGA 3OTFA 2ZX3A 1FV2A 1UQXA 1VBA2 1DGWA 3M70A 4HL0A 5G04L 2XJPA 4HANA 1HJGA 1AX2A 3HN1A 4J1XA 4EN8B 3RYKA 1CESA 3TNPB 1ENXA 2GP5A 3VBOB 4AVCA 1AYN3 2IXLA 2VC9A 4YLZA 1OURA 3PJYA 5FP8A 2WA4A 4AHXA 2HJIA 2WWJA 1CAUA 4CCCA 5SV8A 1QQP1 1QF3A 2ZGMA 5FQ0A 4H7MA 5IAXA 1S2EA 5FO8B 3SNMA 1UYXA 3DV8A 1AR82 3ZPYA 4QKFA 4JVAA 3H7YA 3I3MA 2YFUA 4ATFA 1J1TA 1MVQA 1IS3A 3O1UA 5HCBA 1BYHA 4E9KA 2ZCWA 1RITA 1OOPB 2HYKA 3R4DB 4DRVA 3TEXA 2EIDA 2OYZA 3NKTA 1LOFA 3LSEA 5L7OC 1JH5A 2W68A 2WNVC 1Y9QA 3KCXA 4IW3A 1LESA 5I0TA 3HIFA 3ZSLA 1JHJA 2HWE3 3PL0A 3RWNA 5F39A 4AHWA 1I1EA 2WFF3 1FMD3 3KCCA 2EXIA 3BIEA 5F9TA 2DF7A 4OZXA 1ULCA 1ZM1A 3WSOA 1G86A 3HNYM 1UIKA 3LCPA 4NJ4A 4NHLA 4XABA 2EA7A 1TEIA 1OF4A 3ELNA 2VZ1A 3S0MA 4MGIE 4XETA 2Z42A 3AJYA 3RGBA 3T09A 2IXJA 4AG4A 1NCQC 1CPMA 5EJ1B 4BISA 4FOVA 4NHYA 3BGAA 1K5MC 4RL7A 1PVC2 5IK7A 4M4RA 3NV3A 4NIIA 1ND2C 3UJQA 3ZSKA 4CU7A 4Z8BA 1H8TA 1JYVA 2RR13 3T30A 3J8F1 5A7WB 3WW4A 1DCSA 1LKNA 2CDOA 4YGEA 3OPTA 5FUNA 5FZEA 2OPKA 3RMYA 3BUCA 4FVVA 1W8TA 1BKZA 1RUC1 4GZ9A 4BMEA 5A70A 4Y22A 2DTYA 1GWKA 1C8M2 2YU2A 4JHZA 1P8JA 2VW2A 3IDCB 2A6YA 3S57A 3GZTB 3MW4A 3HNMA 4IE7A 1B09A 1RUG2 5FBZA 2VOVA 3ZXEA 3OEAA 4YW4A 1H6XA 2E53A 3CZUA 3DF0A 5FPUA 1V6MA 4WZCA 2VPVA 3MF6A 1UPIA 2FMDA 1SPPA 4R4XA 4CP9B 1D4M3 1IQDC 1IG3A 1M06G 3ATGA 4M0NA 3ITQA 1W8ZA 4O9GA 1PO12 4AQ6A 1DBNA 1TE1B 4QQ2A 1ASJ1 5F7UA 3THPA 3VBSC 3H50A 1SQ4A 1RUI1 3JUUA 3UKVA 4CP9A 2EIEA 3JCIA 2DVFA 2Q30A 1Z0HA 3P1IA 5FYVA 1OFSA 3HD8B 4LKEA 5A6ZA 3BTXA 2WFPA 4RS5B 1X50A 2KM2A 5JIAA 2X5IC 1QJU3 1R092 3GCWA 3PMSA 3W59A 4ARYA 4NIAA 3ILNA 5F3EA 3USSA 2JDAA 4UFJA 1ODNA 1UY1A 2AC1A 3OPZA 2C26A 4XF1A 1UMIA 3KQ4B 2OIIA 1IQAA 1EUUA 1RINA 4HK8A 5J3UA 2IFWA 4J25A 4WVMB 5F5QA 4PLMA 1O3QA 3VKMA 1K3IA 1ND2B 2D7FA 2WZR1 1ASJ2 4NIHA 3ZDSA 1EV11 3CBNA 4FOQA 1W05A 4D7TA 4NVPA 3OSDA 3B7MA 4NWVA 2NZ9A 1LU1A 1MQTC 4MHRA 3LKJA 4CPBD 1YLLA 1R081 2CAVA 1PM4A 2ZX1A 3IAPA 2ZGSA 1DDLA 3MICA 4AI1A 1CD3G 1R091 3CU7A 4BXFA 4CP0A 1RUD3 1VBA1 4XJZA 5FY4A 1UWWA 5FZKA 5FP4A 1F4HA 4QPGA 4D7YA 5DZEA 2W1WA 5AFBA 5CG8A 4P9YA 5T5OA 3VD4A 2OZJA 4FCAA 3I54A 5IFTA 3E6BA 1VBA3 2X8KA 3DECA 5EXOA 3H1YA 5T50A 1FOD3 1ZZBA 2XJVA 4CXYA 1DHKB 5E6HA 1YJKA 3KT4A 5FLJA 4CRQA 2IXKA 3VDDA 4B4QA 2VNRA 2UYAA 3AZZA 4IDZA 3K4DA 2PXJA 3VBSB 1HRV2 1X9PA 4AVTA 3ZFFA 2ZZJA 1BMV1 2QUOA 3SMHA 5DDJ1 1D0GA 3NNJA 1QHDA 1G8WA 4R8HA 1DYKA 1AX1A 4EWDA 3ZDVA 4H2AA 1W0NA 5EHDA 1ZZCA 4XDQA 5C7GA 1MS0A 5F32A 2WNEA 2WNUA 5CNAA 5JR7B 1I9RA 3WNOA 1BBT2 4X8NA 4GWNA 3R0RA 3PDQA 4FP2A 3BI3A 2PYTA 3T0BA 3QOPA 4M3CB 4QPIC 1K5MA 2LTNA 1ND2A 1W3VA 1VB2A 2WZR3 2CAUA 3N9MA 2VQAA 3NMBA 1RVF3 5IK8A 4K6BA 3SKVA 2C24A 4N9HA 2OW4A 5B2GB 2VMFA 3VD9A 4LHLA 4BQXA 5C4WC 2RS11 1RMU2 2CNAA 1BEV3 2R043 2WSUA 1V6OA 1C8NA 3GBFA 3E97A 3TYJA 2DDUA 1Q43A 4I3PA 1O5LA 3I2OA 2BP6A 3V56A 5JSRA 1HB1A 1W6QA 3PUIA 3B69A 4NRMA 1ZZ7A 3EJKA 5JI7A 4A2UA 5JDBA 2VZUA 2WUHA 4QB1A 2DVDA 1CAWA 1PGW1 4YG0A 3SITA 4WVZA 3POYA 1JOBA 2XONA 4HLTA 4Q4W3 2JX9A 1RTVA 5DABA 5C9AC 5LK7B 1UU4A 4D3WA 1C5IA 2YB7A 3I4IA 1X7NA 2G1MA 3DPRC 5FPBA 5A7PA 2ZGTA 3DXUA 5CFCB 3PUAA 4AFAA 2OXBA 1RMU1 4LBOA 3EMRA 3VBSA 5BNQA 4GKYA 3V0AA 2LRPA 4HONA 1SFYA 1XNTA 2JB8A 4XYXA 1LENA 5FZLA 1I6XA 1WBFA 3WDXA 3MV01 3B00A 3VBUA 1C57A 4UWDA 1JZ2A 1W6MB 5A3NA 1UW8A 1W8HA 3POSA 3V0BB 1KQRA 4LOTA 4CDQC 2R1DA 4H3WA 1PO11 3B3QE 5DUXA 4OHZA 4DXRA 5J37A 2A6VA 1YQCA 5FRAA 2D6NA 3IT8A 4COYA 3W20A 3CLPA 4SBVA 1DGRA 1XJAA 3TNQA 3VB9A 4DB5A 4DINB 2V4AA 1XSQA 3KSCA 5JIUA 1HQNA 4QPIB 2VL4A 3FMGA 2DVBA 4MXVA 3VZLA 2P1BA 3KT1A 1UL9A 2OVUA 2G9GA 2R073 3IDEA 4IETA 1U5ZA 3OEBA 4JQTA 4D69A 1U0AA 4MGKE 5C4WB 4IGPA 2NM1A 4QT6A 4Y5SA 1CAVA 1N3OA 3RFRA 1AJOA 3NNLA 4UFKA 4FAHA 5L9BA 1POV3 2QTWB 1HB3A 4JKLA 1OC1A 4C90A 4DOUA 2KXLA 4Y4RA 4YZ1A 2B5HA 4AI9A 2IWGB 4BK5A 4K40A 1FOD2 1Z7S3 1NYWA 4E27A 2A75A 4DY5A 4O61A 1OUSA 1CAWB 1ZBE2 1ZRRA 2Q8DA 4FI9A 1JXNA 2D6LX 1GKBA 5L7OA 1XNKA 1V9U1 3NWKA 4JDNA 4C1XA 5CISA 2G19A 1KDMA 2RMU2 3MIDA 3HQRA 5EYXA 3WQBA 4F8AA 4EWAA 1Q3EA 3IDBB 3MUY1 3THTA 2EXKA 5FZMA 3MIGA 1W2OA 2BPA2 2VCCA 3AYEA 1AR71 2YGLA 3KWVA 5E8AA 3ROUA 3AMPA 2RDNA 3TB0A 3I49A 4I3GA 4AYUA 5HV4A 4LBJA 4FPKA 3ZXLA 1HW5A 4NUBA 4YG6A 1XXNA 1XYPA 3OD0A 3Q8EA 3T4HB 5LASA 4AEDA 1VMJA 2YMZA 4CU9A 1UAIA 3VBRB 1IS4A 4XFIA 1OVPA 1NLQA 1PX4A 4FFGA 3OGSA 4IEQA 4LORA 5A3WA 4KH9A 4PF1A 1S2BA 3NKGA 3WZ1A 1DGLA 3T4VA 5F3CA 3UL2A 1YIFA 3MUZ1 1ZBA1 4HPKA 3NAPB 3DYPA 2JDNA 2EAAA 5FXZA 2KR2A 2WNVB 1HKDA 3ZN6B 2VZQA 2VVDA 1DGRN 1GLHA 2VNVA 2PN5A 4A7KA 1V6NA 1OA2A 2WAAA 1S0DA 5LEJA 1NA1A 2V5DA 4YVWB 2A6WA 3SH5A 1OQ1A 4PHZA 2P6CA 2W92A 5F8PA 4LO5B 3ZFGB 3PIJA 1EP0A 2YUEA 3IPVB 4NWWA 1NXD1 1NA1B 1ZRFA 1CPNA 3VHPA 3LB9A 4V2VA 3Q8FA 1WCQA 2RS12 4YM1A 4XILA 2LW8A 4B29A 1UZZA 2P4EA 2Q5TA 4HKLA 2YC4A 3H8RA 1TG7A 3U0ZA 2R7EB 3OBZA 3AMMA 4OCTA 4D0QA 3TAYA 4M3CE 1CAXB 5FKCA 4IEZA 3B01A 4AFCA 1QMJA 2J1UA 1BLZA 1QNYA 2VQ0A 4XFFA 2F4PA 3MDPA 2K9ZA 3A7QA 2R072 1JZ4A 4LK6A 2UY9A 2ZTNA 5FO9B 2OS2A 1G7YA 4FTEA 1W90A 2C5DA 4NROA 2I2SA 1QWRA 1AL22 2DUPA 4NAOA 3LEKA 4XFAA 3RI8A 1FPN1 3VBHB 5AFEA 2E7AA 3HR9A 4A45A 5EV7A 4CCJA 1MS9A 1VAVA 2VCBA 2ZJCA 2XH6A 1OOPA 1YRZA 1C8M3 1JTZX 2D6MA 2JKXA 2ZGQA 3AKQA 4A6OA 3CZJA 4URAA 1UF2C 2Y6LA 1SHWB 3EB7A 1Y9GA 3VHOA 2WZPP 4EN7B 1JYCA 2ZGKA 4JZRA 1DFQA 1S0JA 1TZOA 2ORZA 4AQSA 1W8NA 3POFA 3D0SA 4NAMA 1NY71 1W8UA 1ZVFA 2C0ZA 1LU2A 4XXAA 3GZEA 2RR12 4L99A 5DAVA 2LUWA 3J7NA 2Q8EA 3RDIA 2EIGA 1GZCA 4GIQA 4PI0A 2HWB3 2DFBA 3AZXA 1REDA 3D82A 3N36A 4XF4A 4AGGA 1UN1A 2X5IB 1DQ6A 3O5SA 1D2QA 1H2MA 4XJUA 1CJPA 4XFBA 5KBFA 3IPVA 2RDRA 1JOJA 3MYXA 1XSRA 4NHMA 3J4UH 4Z2AA 4AI0A 5BNOA 1JYWA 4JKKA 4A42A 2UY8A 2ID4A 2VMGA 2ZZQA 3ZXAC 1QJU1 3MLJA 4KMQA 4LJHA 4LO6B 3O1MA 3M7AA 4HN1A 4YVSB 3JBG3 4CCOA 3VV1A 5AVAA 4LLFA 2ETEA 1WGPA 5IVYA 4C8DA 3K3NA 1CJDA 2ZAAA 1AR81 2XWBB 2WYFA 4PF5A 1NY72 4UBHA 2HKXA 2QQWA 1WA6X 5HBAA 2HWE1 4KQ7A 4N43B 5IVFA 2DTWA 2WS93 2RR11 1TMF2 1AR73 1X9TA 1LHOA 1CX4A 2WWSA 1NZCA 4LQRA 1A34A 1HX6A 5IK5A 3KVBA 1RVF2 2WNUC 4GWMA 2XBO3 1T6GC 1PMHX 4Q8LA 5CYYA 4YM2A 4DQAA 3KD4A 1S2KA 2JG9C 5C8CB 5JCTA 3TN92 3WLUA 4RA0A 3UGFA 1UYYA 4AVVA 4MYEA 2NMOA 3LDBA 2VW0A 4MX3A 5KXBA 2DVAA 2ZMNA 4Q0PA 4UW6A 3LPGA 4Q4V2 5JXHA 3VUOA 1VBB2 1MEC3 5E88A 1VRH3 2DU1A 1GBGA 1I5PA 5FWEA 4WM8A 4Q2FA 2VTFA 4B4PA 3B02A 4W4ZA 4AK3A 5FUIA 1GOHA 1SMVA 1DF0A 4N90A 2D6KA 3LWCA 2FQPA 3WG2A 1G9FA 2QQKA 3EBRA 1ZBA2 1UY3A 2R6QA 2R042 4XUNA 5A1AA 4DPNA 1N3PA 2QE3A 1OT5A 4IV3A 2I07B 5C71A 1E5RA 2QQJA 1RUC2 5FLIA 1TVGA 1VRH2 2O8QA 4MHUA 1OMIA 4BQ4A 2ZX4A 4C91A 3HPNA 1R1ZA 5F5AA 2DWRA 3OUIA 2QDRA 1V0AA 2JDHA 4Q4V1 2XJUA 2XPJA 1TMF3 4P9JA 5BXXA 1CIYA 1D2SA 4HKOA 4ET7A 1ZNPA 3T2TA 1RUG1 4FPLA 3VDDC 2NN8A 4QM9A 5A3LA 1UX7A 3U11A 3IWZA 2QNKA 4AEDB 5IVEA 1BEV2 1YUDA 3JBG2 2WO2A 1POV0 1HRI3 3LE0A 3VKNA 5CKNA 2C9KA 1SCRA 1K42A 1NUKA 5TSWA 3AP5A 3BALA 4K20A 3LZZA 4IEYA 1OQDA 1RUI2 2JEMA 2R041 5DG1A 3U1XA 2JD4A 1LHUA 3B93A 5I0UA 2X10A 3H42B 5GZFA 1BXHA 3VZNA 1WWYA 4BA6A 3HJRA 3O1RA 5BNNB 5KWRA 4FAGA 4QWNA 5GKAC 1UKGA 5FP3A 1ASJ3 5L73A 1FPN2 4JRLA 4CEYB 3QH6A 4TYSA 4HFSA 3BB6A 3PNAA 5I0DA 2VUCA 1PMIA 4G3YC 4A3XA 1VB4A 3GBGA 3AX4A 1GMMA 4AI8A 2XQXA 5FLHA 4F3JA 3LFIA 3O1VA 1WZXA 2WNOA 1U5YA 2PHLA 3OY8A 4LOSA 4OHXA 3ZYBA 1CGPA 1NG0A 2WT0A 3NV2A 4AQTA 1AX0A 1X8MA 2VE1A 4GXLA 1WCUA 3M2MA 3VDCA 3DKQA 1S0IA 4QX0A 4ZS2A 4YGCA 4BZ4A 2W94A 4PQ9A 4YVWA 2OZ6A 5GZEA 3WUCA 4AOCA 3LSDA 1APNA 1RGSA 4M3CA 4IEPA 1CR7A 1NAEA 2OQ7A 3NV4A 1C5HA 2EIBA 4XJAA 1QJU2 2XVGA 1CQ9A 3O1TA 1FYUA 2IUWA 4A44A 1MS5A 4DZGA 3WG1A 1BMV2 3FE5A 2Z79A 3IMMA 1V9U3 3NO8A 1NE6A 4MSVA 4N8MA 1L7LA 4L2NA 4TWTA 5T5JA 3ZSEA 3FHAA 4Y20A 5GM0A 2GH2A 1XQNA 2WS91 1GUIA 2ZX0A 1VBD3 3U07A 2YFZA 3DCQA 4OFGA 5GZGA 3UKNA 2ZEYA 5A6YA 1RVF1 3HAGA 1UYPA 1JYIA 1R093 1W8OA 1YFWA 5FYUA 4FSJA 2RS13 1QXPA 1WBLA 3W5NA 2P3YA 2XKPA 2FDHA 1RUH1 3AVSA 2RS33 3I3EA 5C5TA 3ZFEA 2D93A 1U12A 1YYNA 3BYWA 5JZGA 3CIHA 5C3SA 4QB2A 3WNPA 1OBNA 2QQUA 2ZMKA 3MFCA 5T5PA 3V0AB 4P00B 5E89A 3ACGA 3UJOA 1GZWB 1JI6A 4BMBA 1F15A 5A7WA 3MBWA 1SBDA 2FCTA 1LOEA 1XYNA 3GBWA 3CQOA 2J1VA 1O8SA 4N7IA 4UF0A 2OT7A 2Y60A 3V64A 4Y3OA 3VKOA 3NAPC 3WQ7A 3MGUA 1WA4A 1BHGA 3K48A 4QB6A 4NOTA 3R6SA 1H2KA 5FZOA 4P5YA 4TTGA 1UXZA 1FT9A 2WZEA 3K3OA 3KV5A 1PGW2 3MLKA 4HSJA 1UY0A 4R9AA 3GM8A 4R9CA 5ERLA 1RJ7A 4HT1T 5HXMA 2JB4A 5JOWA 2YROA 3ZM8A 1RUI3 5FPZA 3W21A 1QH7A 2V4VA 4AE2A 5IT6A 3VLBB 4BWOA 4CUCA 4L97A 2I45A 3KB5A 1ND3B 2EXJA 2X09A 3C7GA 5F2SA 1NA1C 2ES3A 4MXWB 3S5AA 4EE2A 4PBPA 2JG8C 3HT1A 4MUVA 3KZ4C 1SLAA 4LPLA 3USUB 2W0XA 3IM0A 3PVNA 1LODA 2C6SA 3DEMA 3N4MA 3M1HA 3PURA 3WF1A 3WNLA 2NPIA 3GYDA 3J26N 1O6UA 4CCLA 3QBQA 5LCWL 1UZYA 3NVCA 1QU0A 3R05A 3N9NA 5FYCA 4E4HA 1MACA 4ZZ5A 4K7JA 5IVBA 5J7MA 3N3HA 1LULA 1AZDA 4GH4A 4FT8A 3BU0A 3LD8A 5DAPA 4KG0A 3ZYHA 3AMQA 3DN7A 1W9FA 2A71A 4LIUA 4IV3B 4CCKA 3UNPA 4TZDA 3VN4A 5D1IA 5FP9A 4CCEA 2MHFA 2P17A 1TME2 2ET7A 2CWMA 3H8OA 1Z7S1 3ETPA 3LFMA 3LIGA 1U5XA 3D4KA 3UESA 5DZFA 3E6DA 1CZSA 3PU3A 3HMYA 2CHHA 4FPGA 3GZUC 3OOXA 4NHXA 2QQNA 1SPPB 4ZPIA 2BZDA 2XBO2 3CMGA 3BIWE 5DN2A 5A80A 2E63A 4AFBA 5A3TA 1JZ8A 2RJLA 2YBPA 4QX1A 2BGOA 5FXVA 4K9SA 4QU1A 2BFUL 4E4DX 2GDFA 3ZIXA 2HBUA 1FOD1 4D6QA 3RZKA 2VJXA 3D3AA 4B7KA 2BTVC 3INAA 2Y26A 4A4AA 4WBBA 1N1YA 1QJY3 3CJXA 4GULA 4LO8A 1UX6A 4RS5A 5FYHA 5FZ7A 5CA6A 2RV9A 1WUVA 5H9RA 2CGOA 1GQGA 1GP6A 3ES1A 3O1SA 1O7FA 3AKPA 3WVJA 4UW3A 4V1PA 1SDWA 5EPAA 4KWUA 4DXSA 1GNZA 3EO6A 4MH0E 1QJFA 1AR72 2VQUA 1D7PM 4Q0UA 1Q8PA 4XQWA 1SFNA 3C7EA 4YGBA 3Q8AA 3POEA 4W6YA 2OQ6A 3C3VA 3G7DA 1YQ2A 5J1XA 5I0RA 5CU1A 1US2A 5F3GA 3PLQA 2CGNA 2YDEA 3NW4A 5FJHA 2DV9A 2Z4FA 1Q5OA 3C7HA 4XBQA 3VL8A 2XUEA 3A0KA 2BNMA 1GNYA 3ILRA 3J7LA 1GYKA 3JD73 4GH4B 3GCXA 1R082 1LECA 1K12A 4GMP1 3VBFA 2WFF1 4CDWB 3OUHA 4ES8A 4KU7A 5LB6A 3O1PA 1RIRA 3SQOA 1OXCA 4DUWA 2HH9A 4MVTA 2Q4SA 5H9PA 4IV3C 3RG0A 3RNSA 1S0FA 2YHJA 4FTBA 1BK1A 2VZSA 4JX0A 2PQQA 4FOWA 1NLRA 4XDPA 1F4AA 4MG2A 1OA3A 3VD3A 2QQPA 5FZIA 3WF3A 1QDCA 1J1LA 4I02A 4XUOA 1W0OA 3BCWA 3HOBA 3KF3A 1MS3A 3AXDA 3J8F3 3N7MA 3AP9A 4XF3A 4XIOA 5CKMA 5FZFA 4IUGA 2QDNA 3SH4A 3ZYIB 4BB3A 5LY1A 5HCFA 5LA9A 4AXOA 3I2DA 2PHRA 1NLSA 5AC91 3VZOA 4A6SA 1HXS2 4YWAA 3NAPA 2RS53 2VZPA 4X6RB 5BNPC 1HRV1 2YGMA 3ZYPA 4BXSV 4ISRA 3WHTA 2VUAA 1CVNA 1KD7A 1Q56A 1W9WA 2E9QA 5FY0A 1ZYBA 4BHPA 1PK6A 4BE3A 5FYBA 4L11A 2EXHA 2GN7A 5FYSA 3A23A 5CADA 4RHV2 4XAAA 5JOZA 3WG4A 4QAWA 1ULOA 4L0PA 2R0FA 2VH9A 3SCHA 4JCKA 1O4ZA 3T2QA 3ACIA 1TNRA 5FPVA 2CGPA 1YHFA 4XUQA 2XG3A 4L92A 4QPGB 3IMNA 4P08A 3HQUA 2WINB 1PO13 1ENQA 2ZEXA 5CFCA 4AHZA 3POWA 4CYDA 4OZOA 5AVPA 3AKSA 3ZXKA 1AL21 2D3PA 2AEZA 5AC92 4DIQA 5JXGA 4FFIA 3WW3A 5C6CA 4QX8A 1ACCA 3ZYFA 2PMWB 3ZYGA 4CTEA 3T08A 4J6GA 4UFLA 2JE9A 4XW3A 3AFKA 2PTMA 1GZWA 3DXTA 2QJVA 5IYYA 4E8DA 3OF1A 1W2AX 3QCWA 1LRHA 2ZKLA 4BQ5A 1KGYA 2GNMA 2VG9A 1AXKA 4MGYE 4YW3A 4BQWA 1EAH2 3D8CA 4MGZE 4P14A 5GLVA 1LHNA 2FDGA 2WLQA 1TNFA 1POQA 4MGTA 2K2SA 4JDOA 5A7OA 4MLOA 2YBKA 4LXLA 1WLTA 1QNWA 4YFZA 5BNNC 2HWF2 4D94A 5FJKA 1KITA 2W5FA 4OHYA 1YFUA 2ZGLA 3HBZA 1VBD2 5IAVA 3RWKX 4I30A 5CFDA 3AZYA 5BNPB 4XMAA 1OVSA 1G9AA 1B35B 3I7DA 2JDPA 2XBO1 4Q8KA 3V0BA 4IE0A 2ENRA 1ZBE3 5IVJA 4LO4B 2G9FA 3UYJA 1STMA 1W9TA 3T1LA 4Y24A 3ES4A 4FBFA 2HWE2 1EAH1 4EWEA 4ZONA 3VBRC 2O1QA 2EVXA 5FY1A 4G4FA 1XNDA 1LAJA 1DQ1A 2ZHKA 5BNOB 3RZHA 1ZA7A 4QPGC 2H0VA 3ILFA 5DZGA 2Y8KA 4LHNA 2JIJA 3PHMA 2GMMA 2LROA 5J36A 2RVAA 4R9BA 1L7RA 2RDQA 4CDXA 1NQJA 3TEWA 4Y33A 1R1A1 5A32A 3KV9A 2WR9A 3KCYA 1SCSA 1BCXA 2HEYF 2Y6HA 3FHIB 3AZWA 3H3LA 1V6JA 3PUQA 4YVWC 2WBKA 3ZFFC 5FDBA 3EXUA 1VBB1 3D6EA 4RFT0 3VBUB 3AMNA 4AEJA 3RZMA 3ZLIA 2F17A 4RQPA 3FBMA 4XQDA 1W9SA 3IIIA 3PTYA 5GLUA 3WCRA 2W52A 1SLTA 3TOJA 1W2UA 2ZA9A 4GJYA 3URFA 3MO4A 4LTAA 3MZHA 5LBEA 1ZRDA 1COV2 3HWJA 2D5FA 5ABJB 5EYYA 4ASKA 2RMU1 2D5HA 3ETQA 3AVRA 5EIYB 3FLRA 1R1A2 1H1MA 3I2HA 4WZFA 2FDKA 1PNGA 1UD1A 2MNGA 1PVC3 3U78A 4ASMB 4CCDA 1T2XA 1QOOA 1RUD1 3ZFGA 1VRH1 4F83A 1MS4A 3ZO0B 5FMCA 1O91A 5A3OA 3RS6A 4Q5OA 2JDUA 5C4WA 2KD7A 5F37A 2CWSA 4Y4YA 4IV1A 3QLQA 2IFRA 4I0AA
chains in the Genus database with same CATH topology
2XVKA 3WDTA 4JTOA 2Z69A 1RUH3 4HBNA 1RUC3 2FHRA 3MW2A 4LBKA 2JICA 1X82A 4ZU4A 2WT1A 1DQ5A 1OQEA 4HPKB 2GC0A 4LBQD 4TSVA 1HXS3 3WX5A 2H6CA 4RHV1 3VBOA 5K8SA 2DUOA 3WXPA 2HWD1 3ASIA 3VKLA 4CDXB 3WW2A 3MW3A 1J58A 5A32B 5I93A 1F5JA 3LOIA 4JGZA 4H55A 4XOGA 4P9GA 1FAYA 2VULA 1W6NA 1RC6A 2BBVA 1QJY2 4JGYC 4K21A 4XBLA 4PBOA 4RR3B 2ZGOA 3VBUC 3CJIA 2O8OA 3RSJA 4E2SA 3PVBB 1NCQB 3H9AA 1WLDA 3L2HA 5FREA 1C28A 5I91A 2JG8A 4S2HA 2JE7A 2R062 2BVVA 3FC0A 4CDWA 1G9BA 4Y20B 5BNNA 5A3MA 2VU9A 1W6PA 4D7SA 2RE9A 1KRIA 5C33A 3B94A 3MI8A 3WINE 5T3NA 4DXZA 4YFWA 1RHI1 4DY3A 1O4YA 3TN93 5BV6A 1BVVA 1D0HA 2WNUB 3O0VA 4Z92B 2VOKA 3M3QA 4H14A 1AR92 1ENRA 4BIFA 3LAGA 3TWIA 1ZZ8A 4QGLA 4HMZA 1WD3A 2XLAA 1JUHA 2DURA 3WDWA 3VBRA 1DIWA 1YFXA 4E4ZA 3R4SA 3WQ1A 1OSGA 1MR5A 1S0BA 1FATA 3FLTA 1MS1A 2CTVA 2IXHA 2TEPA 1MZ5A 2K0GA 2X53S 5CIRA 4GQ7A 5I8TA 2AENA 2UURA 3ECQA 4BQ1A 2AZ5A 4RS5C 4FPYA 4LBMA 2Q8OA 3H7JA 4BIOA 1AR91 2B8MA 4Q0VA 1ZREA 4JGYB 4QD2A 1EPZA 4HVRA 1IPJA 2RM21 3KGZA 2XJSA 5FFOC 4Y1YA 1QH6A 2KA3A 4COZA 1ULFA 5GLWA 1YIPA 1AYM3 2XJTA 3CNAA 4XPVA 3VDDB 1CIWA 1SLCA 4XJWA 1TMF1 2Y0IA 3I59A 1YI9A 1XNBA 3ZXGA 4Q4Y1 4KGGA 5K0UB 3AZVA 2A70A 1LOBA 4GMP3 4ITCA 4LA3A 3TN91 4AGVA 3VHNA 2ZGPA 2UWBA 2PLV3 4QGMA 1C4RA 1RUNA 1RUJ3 2JXAA 1H8TB 4B4RA 2P3JA 4ISQA 4UXAA 2UWCA 1H4HA 3SCFA 4ATEA 4RSUA 3VBOC 2GNTA 1Y7BA 4URTA 4S2DA 1JN2P 2VUJA 5GZDA 1WCDJ 1HIXA 4BH9A 4QQPA 5AC93 5K7PA 1MEC1 4Z82A 4S2GA 4EROA 4XHXA 1VBC2 2PHFA 2IC1A 4CEWC 4C1WA 1YFYA 1H2NA 2GAUA 1MZEA 4XIKA 3EHKA 4XTMA 1FNYA 4AW7A 2PHUA 3SH3A 1TME1 4G9SB 3GZAA 1Z7S2 4GA9A 3BPZA 4ZXKA 4FPJA 5L7OB 3VBFB 1QJY1 4FQZA 2JDZA 1I5ZA 4FPHA 1VBC3 1BEV1 3JBG1 3AYAA 2X29A 3WR0A 4KWLA 3QD6A 1VBC1 3KLSA 2R061 2V73A 4AF9A 1YNAA 2QCSB 4EN6B 3WDYA 1CONA 1ULDA 1Z78A 1K5MB 3JZVA 1YJLA 2VY0A 4FO9A 4OI2A 2GH8A 2AGSA 2HEWF 2SLIA 1KJLA 3LA2A 3MIBA 3E5UA 2RMU3 3AMHA 1OFNA 2EAKA 4CEYA 1W6NB 3WCSA 4N53A 1WD4A 2D44A 3AYDA 4KL1A 4LR4A 4NHKA 5JWPA 3RYRA 1JBCA 1PZ8A 3MPPG 1PVXA 2ZGRA 4CDUC 5LEKA 4OULA 3DUIA 2DFCA 4CEWB 3GALA 1RUJ1 4QU2A 2D6PA 4COWA 5EWSA 3S30A 4IEXA 3U4XA 4XHBA 4ZKTB 3ACLA 4I0BA 1ALYA 2DCYA 2UU8A 5T5LA 1SBFA 1DU3D 3VBFC 4YNIA 4XXPA 1OI6A 3AKTA 5CAZA 5DDJ3 2PAEA 3ZFFB 1AF9A 2RM22 3AXEA 1NXMA 2QFEA 2PELA 4KNCA 4AEMA 1ND3C 1AR93 5D8AA 1VLNA 2R30A 2YC0A 2ZACA 5BY5A 4YSFA 2JG8B 1PNFA 2WS92 1G9DA 5FPXA 1SBEA 1F5FA 4QQLA 4HVQA 3M3OA 2XUMA 2BYVE 4F7ZA 1GQHA 4YG3A 1RUH2 3N7KA 2ZAHA 4R9DA 2QKDA 3CF6E 4YARA 3H3UA 1QGLA 3MIFA 5J7MA 2R1BA 4OHWA 1BQPA 2ZHLA 4MXWA 2PHDA 2IXCA 4AEKA 2R32A 4AI3A 1BBT3 1W6QB 4IV1C 2VOXA 5A33B 3AKRA 2OA2A 2ZOEB 4CEWA 1X36A 1RMU3 3PMEA 4YZ5A 2GNDA 2BFUS 2ZPXA 1AL0G 4INDA 2ZABA 3MIEA 4KWJA 4Y1XA 2B9UA 2CY6A 1W6OA 4OI1A 1MEC2 4LNVA 2GC1A 2WSVA 2P37A 3RZZA 2NP0A 4PIXA 5JI9A 1REEA 4W6WA 4EN0A 5LRRA 1W6OB 3KMHA 1C1LA 2GC3A 1IKQA 1SACA 4HZFA 4JC1A 4XEZA 3ZN4A 3FBYA 3H1MA 4JAAA 4AVAA 1LOGA 4CDQA 2UYBA 4FTSA 4COUA 5GZCA 3GHNA 1PGSA 3GF6A 3C2UA 3NV1A 5C8CA 2RM23 1WMFA 1OA4A 3WOGA 1J3QA 4QPYA 2UWAA 1TME3 3RI9A 4OLLA 2PAMA 3AFGA 5F6LB 5BUVA 1POV1 4Z07A 4QQOA 4ES9A 2XJRA 3E5XA 4AQ2A 3ENRA 4DFSA 4IL7A 4JV4A 4X6QB 4U2AA 4CDWC 1FI2A 1AR62 4GKXA 3ZXJA 2DVGA 3DGTA 3RJRA 3T1MA 4L9BA 5KHJA 1F31A 1RHI3 1GANA 1LEMA 5KHGA 2GMPA 4JDMA 2HWB2 2Q1MA 4IV1B 1RUE2 1UKRA 1AYN1 1U5IA 4FPEA 5C9AB 1XRUA 1DZTA 1ONAA 3I8TA 4E2QA 1LOFC 1COV3 5DUVA 4JGZB 4BLIA 5ACA2 1FNZA 1XE7A 3MLLA 1JHNA 4N9IA 5KXCA 4ZU7A 1S0GA 1COV1 4YW5A 4N7UA 3ZN5A 1XE8A 1WLCA 3B9IA 1PIV1 2GZWA 1IOAA 1S55A 1LB2A 2N7GA 2RS32 5BYNA 4CDQB 3LGRA 4YRDA 2PFWA 3AP7A 2C1FA 2HWB1 2B42B 2WLPA 2E7TA 4PDWA 3VZMA 4ORFA 1KFXL 5H9QA 2DUQA 4WM7B 3QACA 2JG9A 3LA7A 3ZXFA 4IESA 1KFUL 1LOCA 2BW8A 1FMD1 4Q26A 5ACA1 1HRI1 1PK6B 4LEJA 5GLTA 3W9AA 3MF9A 2WFF2 1DYPA 3ZN6A 2Q0AA 4FPFA 4NO4A 4U36A 3SCGA 4O9EA 2FZ2A 4JRAA 4AFMA 2RS31 1PZ9A 4OUMA 5K0UC 2HWD2 1VAKA 3AB0A 4BYYA 5GLZA 4FOYA 5T55A 2QVSB 3H8UA 3LA3A 3WP5A 3WQ0A 2ZHMA 3B9CA 3VHRA 4HVOA 2R49A 2P3IA 1DZQA 2BVBA 1UPSA 2Z2SB 3CEWA 3AYCA 1FMD2 1LOAA 1HRI2 4M0HA 1I3HA 2AREA 4Y5Z0 1HXS1 5FTTC 3M8LA 4JGZC 3WP4A 1QXJA 4DNYA 4LT5A 2D6OX 5I0SA 4GB32 4Y1UA 2D3SA 1GR3A 4IERA 1QJZA 3JB4C 4UBGA 3AP4A 1O5UA 2A3XA 2WC2A 5FOBB 4IEWA 1UU6A 2XLFA 1GFF2 3FZ3A 1AR63 4B7EA 1QQP2 4PCRA 1LCLA 1FPN3 4B3NA 1Q8QA 3WUDA 1IS5A 1D4VB 4Q4X1 5FQ0B 3OYWB 2EF6A 2VVFA 1ULEA 5BNOC 5LRSA 1WW6A 4ZU5A 1VAMA 5FCCA 3H1WA 4AFDA 4KBBA 1UCXA 5HCAA 4FXKB 3FUQA 3M3IA 1LR5A 1Y3TA 4FPCA 3G6JB 1EV13 3WW1A 3KT7A 1UIJA 4AGRA 5L36A 1NOVA 1NE4A 4OI0A 4AEDC 4EN9B 1H0BA 4Q0QA 1A8MA 4NN0A 5CVRA 4CP1A 2XHKA 1NCRB 3OJBA 4Q4X2 3L2YA 5CBLA 1CAUB 2OUJA 3KQRA 3MFAA 2R063 2C9AA 3NL1A 1F2NA 4LHKA 3J8F2 2HWF1 2NLRA 4I01A 1QY4A 2HWC3 1AYM1 4AVSA 1AR83 2A3WA 4XJ8A 2VW1A 3O0XA 1VBD1 1QKQA 1RUF2 1HLCA 2VGDA 2WT2A 3R4UA 4BM8A 3OD4A 4CEYC 2BGCA 1C1FA 1PO22 1RUE1 2WQZC 4LUMA 4LUKA 4EJRA 2YZ4A 2ZBJA 1O3SA 4CDUB 2PHWA 4Y22B 2DU0A 3VBHC 3S6PA 1A8DA 2BWAA 3N7LA 1HV0A 1DGWX 3RRDA 1MZFA 1Y43B 2R16A 3NSTA 4CDUA 4QHBA 2ZX2A 4HSLA 1J3RA 4WVMA 1ZZ9A 1Q8VA 2CL2A 2VOWA 4J1WA 1DQ0A 4Q4Y2 4Q4X3 3M3CA 3A4UA 4BLJA 3IIAA 2Z5WA 1GV9A 2A6ZA 1IS6A 1BZWA 2B45X 2EALA 4QQHA 3VDDA 2VNGA 1URXA 2P34A 4OUSA 1ZX5A 4YZ3A 3WDUA 1H1AA 1H1IA 4GALA 2ZGNA 1B35A 4IXLA 2ARBA 1L3JA 1OPMA 4IEOA 4CP2A 4Q4V3 2GNBA 1XU1A 3LOBA 3NJZA 1GNHA 4RR3C 1LEDA 1Q8SA 1A78A 1XYOA 2GSYA 2RHPA 3U10A 4YVSC 2VECA 4AHYA 4LE3A 3UKTA 5J98B 1KXGA 1TQ5A 4WVVA 4YYOA 2ILMA 4M3CF 3EQEA 1G6NA 2Y0OA 2PHXA 1EPWA 3OGGA 1RUD2 4FPOB 5SV5A 2B39A 1QJX2 2VMIA 3JQWA 1RL3A 4COVA 3PVOA 1PZ7A 1O4TA 2I74A 3OBRA 2PA7A 3FFZA 3B5LB 3FUOA 1V6LA 1OLRA 2JG9B 4KU8A 5C8CC 3SISA 4Y1VA 4LULA 2PLV1 3UK9A 2HEVF 5JPMB 2FMYA 1HRV3 4LBNA 1QOSA 4FXGB 5LK5A 5ABJA 3TBDA 2PAKA 1D4M2 2BNNA 2HWD3 1V6IA 2GALA 2YY1A 3O12A 1VBE1 4PLNA 1QXRA 1NQDA 4LLOA 5JMCA 1QQP3 2CYFA 4CZSA 5T54A 4XBNA 4PLOA 3WNXA 1VP6A 2NMNA 3D5OA 5HI0A 4WM7A 3APBA 4LBQB 2PLV2 3ZX7A 2XJQA 4EV0A 1N1TA 3OY8B 2A7AA 3ZVXA 1VJ2A 2AR6A 2BQPA 1AL23 1OKQA 3QH7A 1IGOA 4N53C 2HWC1 5E1RA 3RYPA 4XF9A 4RD7A 1PGL2 1MQTB 1RUJ2 3AJZA 1RHI2 1EYBA 1GSLA 1YO8A 2V5YA 3IKWA 3ME2A 4XFGA 3BOPA 1MQTA 1V6KA 4I09A 2H6BA 1AXZA 5JZGC 3AP6A 3BODA 5K9YA 2D40A 3S7EA 1LJ7A 3WDVA 1LGBA 3UV9A 1S0CA 2JECA 2ZS6B 4W65A 4DS0A 4MV2A 5CB7A 5J96B 1H8TC 5KXDA 3I59B 2GU9A 4HN0A 3O7OA 1PGL1 1C3HA 1H9WA 1QDOA 1FV3A 3VZJA 2CV6A 2OUHA 5K0UA 2ZGUA 5EJ3A 1OPOA 4RHV3 1ND3A 4N43A 4BCUA 3OYWA 1G9CA 3JQXA 5DUWA 4XJ9A 1GZ9A 1EAH3 4YGDA 2G4IA 3ZMNA 1SEFA 1YXWA 2D98A 5L19A 4AVBA 2W39A 4QX5A 3CJIB 4Q1PA 3ZSJA 2XWJB 3H3ZA 5ACA3 2BEOA 2Q1ZB 4QXKA 4XE9A 1AUYA 2VVEA 5CFDB 5FMOS 1JW6A 3AM2A 4QPIA 3MPBA 2W08A 4Q29A 3OCPA 4Y1ZA 2GN3A 4M01A 4GH4C 3BTAA 1NCRA 4Q27A 1SLIA 5BNPA 5KHHA 1DLLA 5DUUA 3A0NA 2JENA 5JZGB 1SLBA 1LTEA 3JD72 2DCJA 2PHTA 3AK0A 2GMEA 1N1VA 3S7IA 5HXVA 3ZIWA 1UMZA 3OBTA 1ENSA 5F1RA 2D3RA 1WMEA 3DPRB 5KC6A 5CFCC 1HQWA 2WA3A 4E4SA 1AXYA 2YXSA 3FWEA 4LA2A 4PDWB 3WG3A 1D4M1 2YPJA 4Z2WA 1PIV3 2LM3A 4R52A 3FFQA 2IXIA 4BOWA 1OD5A 2A5ZA 1WW7A 2DCKA 1ZRCA 1GICA 1AR61 2A3YA 2TBVA 3DKWA 4P9WA 1WMDA 2H0BA 3ZSMA 1PHMA 3FLPA 3ZFEC 4AWDA 2AUYA 1IZ3A 3V65A 2XVLA 3ALQA 3WT3A 1VIWB 2TUNA 1AVBA 1R1A3 1H9PA 2XGXA 3PVEA 2AYHA 3OGJA 4UW4A 1RUF3 5KXEA 3HQXA 4Y26A 5H9SA 1LGCA 3RQ0A 5FO7B 1YWKA 4E2GA 3P3PA 2ZKNA 2HWC2 1HQLA 3Q9OA 3E5QA 5F6KA 4H7LA 2A73B 2JJ6A 1IKPA 5DDJ2 2YYOA 4JQRA 1J59A 4P9XA 3RPQA 5JVVA 1KJRA 2RS51 4K8FA 2Y38A 4ASLA 1O3TA 4ONUA 1BBT1 4WV8A 4LE4A 4RR3A 2ET1A 4DRRA 2FBEA 2GC2A 2XLGA 4R4ZA 4PDWC 5JPNB 5IK4A 1Q8OA 2P3KA 4P9LA 2QZ3A 2JKBA 1RUOA 4PJYA 3VL9A 5JLVA 1SLLA 3VBHA 5KHIA 4XMIA 1CN1A 1FXZA 3M3EA 2A6XA 2E51A 1RB8G 1NCQA 1W6PB 2O0OA 5JOXA 1WLWA 3KM5A 3WV6A 2ZMLA 5DG2A 5JSPA 3ZFEB 1MZ6A 4P9IA 1N47A 4GMP0 1FX5A 4XF0A 3ZYRA 1KDKA 2R0HA 3N35A 1VALA 3RJ2X 1CAXA 3P3NA 4KWKA 5J09A 1V70A 1OHFA 4GB33 1W39A 5C8WA 1WW5A 3PJQA 3IN9A 3ZFGC 2MEV2 3IBMA 1S0EA 5I8SA 1S1AA 1H8VA 2B7YA 4GB31 4I0WB 1F9KA 2WKKA 4YW2A 2B46X 5DXDA 4PIYA 4Q0SA 1H30A 5T52A 3BU7A 1X8EA 3WHUA 1LHVA 1RJ8A 2VMHA 4YVSA 1ZZ6A 4A7YA 5FAXA 3JD71 2DCZA 4X8PA 4HETA 4AI2A 4TLFA 2DCTA 4B8EA 4QMAA 1HV1A 2D43A 4RQPB 3W58A 2BUKA 3CO2A 1RUE3 5A33A 1BJQA 1IPKA 3H0OA 3MIHA 4YW1A 3USUA 2MPFA 2WQ4A 5D8AB 2ERFA 3FX3A 2NYYA 5JSOA 2X5IA 1HDKA 4JTNA 4MZUA 2ATFA 2LALA 4M00A 3ZXDA 1X33A 1DQ2A 1H4GA 2HWF3 3RMXA 1ULGA 4IEVA 2VNOA 2E6VA 4XFHA 4P5HA 5JOYA 5J48A 2V09A 1W6MA 5GALA 4IQPA 4CDXC 1OLQA 4KG8A 4XQ4A 2MEV3 2E7QA 4XFCA 2ZHNA 3MEPA 4IEUA 4BPZA 4KGQA 2AH2A 4Z1VA 1ZBE1 1AYM2 4WM8B 2ARXA 1V9U2 4OHVA 1RUF1 3O14A 2RJKA 1VR3A 2BNOA 2SBAA 3FJSA 3KGLA 4Q1RA 4WVWA 4YM0A 5GJ6A 3ST7A 2XL7A 3TRSB 1RUG3 1N3QA 1PO21 4UW5A 1JUIA 4WM7C 3WY6A 1WW4A 4LO7A 1M4WA 4RGAA 1H2LA 1XU2A 3JB8A 5I8YA 1XNCA 4N53B 4DMIA 1AJKA 2WNVA 4K1ZA 4NPRA 2P2KA 1PK6C 4SLIA 1YCIA 4I2OA 5KHKA 2IZWA 1PVC1 1MVEA 3J9SA 4N43C 4HKWA 1E57A 1R083 3D0JA 2WIIB 2XL9A 4W6XA 3CL1A 2YV8A 4RQPC 3SHRA 1LGNA 1QOTA 4Q4W1 1CAVB 3KS7A 1IHMA 4OVEA 5FMOL 5D8AC 4YM3A 1N1SA 1AHSA 2BWCA 4Q4Y3 4YZ4A 2RS52 5C9AA 3K51A 1AYN2 3DPRA 4OI4A 3VKFC 1C8M1 3VZKA 4META 3WP6A 3E6CC 5CG9A 3WP3A 4K3UA 3GNEA 5JAXA 3O0WA 4YZ2A 1J3PA 2XB6C 3GHMA 1WCKA 1BVP1 4FP3A 1B35C 3N7JA 1O3RA 1PIV2 5EZWA 1YI7A 1DQ4A 1QJX3 1V00A 4LBQA 5E16A 2D97A 1VBE3 3X29B 2WJSA 3BOWA 4WM8C 4Q4W2 2F6BA 4A7ZA 5EFUA 4C0HA 1WCSA 1DZRA 4HK9A 3JU9A 1QJX1 4FQ4A 1EY2A 3CJIC 3L9JT 2TNFA 4QGNA 4LBLA 1OOPC 2R071 5FOJB 1ZBA3 1ZA4A 3VGIA 4PIZA 5CFDC 1PM7A 1A6CA 4QM8A 2MEV1 1UU5A 1MS8A 3HT2A 4XZPA 5KC5A 2NQYA 1F8VA 3M4FA 4C0BA 3DL3A 2QZ2A 2DYCA 4XTPA 1REFA 2VXRA 4JGYA 2WZR2 1DG6A 1KS4A 2FZ1A 1VBB3 4NR1A 1A3KA 1EV12 3ZYJB 1NCRC 1VBE2 1W0PA 3ZMOA 5BPXA 3SXWA 1KS5A 1PO23 4K1YA 4S2FA 2XKOA 3SLIA 2WL1A 5ABJC 1LHWA 4L8QA 4RGGA 3OTFA 2ZX3A 1FV2A 1VBA2 1DGWA 3M70A 4HL0A 2XJPA 4HANA 3HN1A 1AX2A 4J1XA 4EN8B 3RYKA 1CESA 3TNPB 1ENXA 3VBOB 4AVCA 1AYN3 2IXLA 4YLZA 3PJYA 2WA4A 4AHXA 2HJIA 1CAUA 5SV8A 1QQP1 1QF3A 2ZGMA 5FQ0A 4H7MA 5FO8B 3SNMA 3DV8A 1AR82 3ZPYA 4JVAA 3H7YA 4ATFA 1J1TA 1MVQA 1IS3A 5HCBA 1BYHA 4E9KA 2ZCWA 1RITA 1OOPB 2HYKA 3R4DB 4DRVA 2OYZA 3NKTA 1LOFA 3LSEA 5L7OC 1JH5A 2W68A 2WNVC 1Y9QA 3KCXA 1LESA 5I0TA 3HIFA 3ZSLA 2HWE3 3RWNA 4AHWA 1I1EA 2WFF3 1FMD3 3KCCA 2EXIA 5F9TA 2DF7A