5EFWB

Crystal structure of lov2-zdk1 - the complex of oat lov2 and the affibody protein zdark1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
55
structure length
55
Chain Sequence
KFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
molecule keywords NPH1-1
total genus 24
structure length 55
sequence length 55
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5efwB00
4GOEA 1MFTA 1Q2NA 3PH0A 4IOIH 4EYYQ 2KZIA 1Y47A 3RGUA 2LXBA 1OVUA 4HJGH 2ZAEB 1SS1A 2B89A 1EDKA 1X0TA 4NPEA 4ASWA 1H0TB 4WWIA 2P58A 4HKZH 1EDIA 1H0TA 2M5AB 2JWDA 1FC2C 1LP1A 4K3AA 4MN4C 2UWJE 4NPDA 2B87A 3QWOC 5EFWB 2I8DA 2QRXA 2B88A 3MZWB 2R44A 1EC5A 2KZJA 2B87B 3MHVA 1JM0A 2OTKE 4GOFA 2SPZA 5K5GB 1S3JA 4HB1A 4ASVA 1NVOA 4BXLA 3FXDA 2QVAA 4KJMA 1U7JA 4K35A 4ZMDA 4ZNCA 1BDDA 2Q1KA 5C39A 1EDLA 1LT1A 1OVRA 1EDJA 1ZXGA 5CBOA 2WMMA 3S1KA 2LXCB 4JBZA 1BDCA 1ZW0A 3FXEA 1OVVA 1LP1B 1JMBA 2KIKA 2M5AA 2KS1B 4CPGA 4GODA 2KUBA 1DEEG 3ZDMA 4NPFX 2LR2A 2K3RA 1U7MA 2KI7B 2HR3A 5CBNA 5DJTB 5DJUB 2M0BA 2RKLA
chains in the Genus database with same CATH superfamily
1S72P 4PJ0E 1MFTA 3CC2P 2ZFCA 3P8CD 2ITAA 1RY3A 1EQ7A 3AE7C 2W83C 4Y99C 1JO5A 1OW6A 2R32A 1LNQA 2W6AA 1CZQA 4KHXA 3N4XA 1BE3E 1BE3G 3VMYA 4EYYQ 2FY8A 2IDBA 5KLVE 1RHZB 5KLVG 3RGUA 1K9MQ 1D7MA 2R5DA 5KAFH 2QSIA 1VQ6P 1KYOD 2LXBA 2IBZI 3RK3D 2M8RA 1PGQA 5TJHA 1JUNA 4HJGH 1KTMA 2OYOA 2Z4EA 4R4MA 1JY3O 2XNDH 1W2EA 2POHA 2WVRA 1BGYJ 4PD4H 5E79E 2GA1A 5KJ7C 1KILD 1K73Q 2AXCA 2B89A 1VQLP 2FKWB 3AE6C 1QEXA 1EDKA 1LTIC 2D2CB 3RL0g 1JTHA 5APTA 1VQNP 2WWWA 3M0DA 3KZIE 4WWIA 2K1AA 3A2AA 4HKZH 2P2UA 3CL3D 1DD3A 5AW4B 2OYHB 1L0LJ 3OJAB 4IFDK 3KZIH 4D6TD 3SFEC 3Q5PA 1H0TA 3L74J 1XTGB 2WT7B 3RL0B 2IYOA 1FC2C 2FYUD 2JJLA 1PPJG 1PPJE 1PP9D 1SQPK 2NPSD 3CXHH 3FWLA 1L0LK 1AFOA 3RL0D 2YIUB 3EQ2A 1Q86Q 4N6JA 1KQFB 1M90Q 3Q3DA 1MUUA 3TNUB 1N7SB 1NU1J 1IK7A 1P84D 2RMZA 3USSA 3VYIA 3H1IJ 4BRYA 3F5HA 3L70G 3L70E 2V7QH 3V5BA 1MZ9A 3HE4B 3T97A 3GF3A 5B5EH 4RKUJ 2QRXA 4H0LB 3TGUJ 1ZP0C 3GG2A 2IX7C 2R44A 3L75E 3L75G 4HYTB 3PJSK 3T97B 2O01N 4C7NA 1R5SA 4ZKUA 2O01H 4EOTA 1VQOP 3JC22 3VMXA 1NAFA 1XTCC 2V4HA 2YNYA 2I1KA 2RH0A 3MD0A 2OTKE 2E5TA 2FXOA 1Q90D 2Q6QA 3H1KJ 3RK3B 3G4SP 2Y0DA 3G9RA 2I1JA 2Y9YA 1EZVE 1EZVG 3L73J 4HB1A 1GDTA 1MKMA 2FXMA 1L0NG 1L0NE 2WPQA 3FXDA 2IBZD 2M3BA 1FAVA 3SWKA 1RF1B 1HGVA 5BU5A 3LW5J 3L72E 1JY3N 3L72G 5AW0B 2Q3IA 1URQD 1U7JA 1KV4A 4ZMDA 1N7LA 1FZEA 1MV8A 2E42A 1N73C 4M3LA 1SQXE 1SQXG 1ZRTD 4H0LC 2BEQD 1L0LD 1LWUA 3CXHE 4WY4A 5TISE 3VMZA 3H1LD 1SQPD 3HUSB 2E76D 2QM8A 2FYUK 1FOSE 1QVFO 1S5LE 1T8ZA 3L37A 1YJWP 1PP9G 1PP9E 1HVVA 3EFFK 2IFNA 5CBOA 2Q9IA 1N7SA 3CXHI 4IFMA 3V2NA 4BRYB 3Q5RA 1RE4C 2JO1A 2WSEH 1SQBJ 3MIWA 4PV1B 2O3JA 1M8OB 3FX0A 4JBZA 5B5EE 4D6TJ 3I56P 4JYBA 1OX3A 1ZW0A 1SQQG 1SQQE 3B5ND 3QH9A 4C7NB 1G1JA 1OMIA 1L0NK 2HLOA 2ZVOB 1LTJC 2KIKA 5E79H 3CX5E 2ZT9D 1N73B 2ZJSE 1BSHA 2K9YA 3GF7A 2YKPA 3HE5A 3IR9A 5CCHC 3L72D 2KUBA 1KILE 1RF1C 1KMIZ 2OYIC 2JR8A 1NU1D 3MTUE 1HTLC 2JKVA 2N9YB 2NPSA 3D6YA 2A45H 1GMJA 1EZVD 1L4AC 1M7LA 1X22A 3LIEA 3HD7C 1UIIA 3PRJA 3MGNA 2H8PD 1GW3A 3AE8C 4AUWA 3C9IA 2J58A 4EI2A 5BU8B 3V6IA 5AVRB 1ZR2A 1NU1G 1NU1E 2V7QJ 2XDJA 2ZYDA 1RQUA 3IAOA 4PD4I 1LT9A 2C9NY 5DJUB 1AJYA 2KLVA 2M0BA 2RKLA 2K9JA 2YO3A 2PP6A 3B4SA 1VF5B 2WSEJ 3H1HG 3H1HE 1OWAA 2A06G 2A06E 3P8CE 4U7JA 5AW8B 1H88A 2CPSA 4YXDC 1S5LH 1SQVG 1SQVE 1SFCB 3L75J 1FJPA 1KN7A 2H43A 1BGYE 1BGYG 3G71P 2O1KA 3L70D 2J5UA 3H1HD 2CPBA 3EWKA 3B8EB 2A45I 2P1JA 1AA0A 1QGKB 3NMDA 4GIFA 2C9LY 4U3FD 3TF5A 3D70A 1P84H 2NZ2A 2QJPC 3M9QA 3V2RA 3VP8A 3KHUA 1BGYD 2XV5A 1FZGA 1CI6A 2FBWC 2BCCG 2BCCE 2A45G 3CXHD 1X0TA 5CCGD 1YYCA 2L5GB 4NPEA 1NO4A 3HTKA 3RL0C 3I55P 2MKVA 1H0TB 1HJBA 3ITKA 4AQRD 1KYOE 2WQYC 3L72J 1RE3A 4HH2A 3RK3C 2N1TB 5AW3B 5AVQB 3WUUA 1Q82Q 1FDMA 4LGDE 2FXPA 2M5AB 2WZ7A 1FE6A 1JTHB 1OIPA 1VF5D 2KSEA 2ZXEB 1LJ2A 3CWBD 1M57D 3H1IG 3H1IE 3I5CA 5AW6B 1YQ4C 5L8RJ 4K3AA 5GTIE 1DH3A 1YQ3C 2YKQA 2W90A 1H8AA 3KXDA 3L35A 4B86A 1RF0C 1W5CE 2UWJE 3RK2D 5GTIH 2WTYA 1AQ5A 1YJ9P 3O6QA 5AVTB 1SQXK 3AEBC 1DIPA 3FWNA 3BCCD 1LGHB 3BRVB 3QWOC 1L4AA 1IFNA 1RE4A 2R3CA 3CWBJ 4XFJA 3SSUA 2MJZA 1FDOA 3HUSA 3IF4A 2BEZF 1G2CB 4L76A 1K04A 1FZAA 1QX8A 3OAKA 1VQ9P 5AW1B 4W80A 2KXPB 4JYCA 3RK2C 2Y0EA 1L0NJ 1Q7YQ 1K8AQ 3A0BH 1JM0A 3MHVA 1LT9C 2QEXP 2KP8A 5M1BA 1YHQP 1LT9B 3H1KD 3CCSP 4KT0J 2KNCA 2PFXA 4GOFA 2WSCJ 3SWFA 5H2FE 3TSIA 1JCCA 1M1KQ 2YMYA 3VMAA 1LTTC 3L36A 5H2FH 1J1EB 5AVYB 3WMM0 3GW6A 1HWTC 2XNXA 2GM4A 1SFCC 3TK1A 2HG5D 2QJPB 3H1HJ 1GL2B 4OGQD 2AEFA 1IFMA 4I2LC 1NTZK 5B66H 2QE7H 1HJ0A 3V2QA 1SQVJ 1R5LA 4ZNCA 1NTKE 1NTKG 2NRGA 3A3YB 4QMAA 2K37A 5B66E 2E43A 3A7OA 3V4QA 1LTJA 1N73A 1SQQK 3L71D 4H44B 1J2JB 1SQPJ 1PV3A 1LT1A 1OVRA 1EDJA 5APSA 1L4AB 2BCCD 1KFMA 1YJNP 1SQVD 1VL2A 4UB6E 1RH5B 1SVFA 2W6BA 2WITA 2KLUA 3GHGA 3L74D 2L91A 1EZVI 1YBKA 4TT3H 4UB6H 1Z56A 3H1JD 1PL5A 2XZRA 2IFMA 1JMBA 5AW5B 1M1JB 4Z1MH 1QVGO 3P8MC 5AVSB 3SFDC 1LTJB 4WBAA 2KS1B 1WMKA 1LWUB 1SQBK 3PLNA 1ZV8A 1IC2A 1RQVA 5CMZA 5CCGA 1BCCJ 1QL1A 3PHLA 1M56D 3ZDMA 5APVA 5GTHE 1VQMP 2E74B 1LTAC 4NPFX 2LR2A 3H1JJ 2XU6A 2IZ0A 3U1AA 1NTMK 1LTSC 1N7SD 2KI7B 1BE3J 1QLED 2HR3A 3B5NA 3MP7B 4UB8H 4O9BA 5KLVK 3TGUD 1S9KD 1VPCA 4OH8B 3HUSC 1N2DC 2ZYGA 1GTWA 2R3SA 4PV1C 1KORA 2NPSB 3H32A 1T6AA 4I7ZC 3H1ID 3GMAA 3A0HE 4JF7A 2IZ1A 1A02F 3CCEP 5AVUB 4RO0A 1JY3P 4WY4D 1NTKD 4C46A 1NGMB 1YTZI 4JQ0D 3U1CA 3AEFC 1URQA 3CMEP 5KAIH 2HYNA 3PH0A 4RESB 1KB9H 3BATA 2Y0CA 1S4XA 2GUVA 3L71J 1SLQA 3HD7D 3K5BA 2RN0A 3CCLP 1JY2P 1NH4A 3KYQA 2PAJA 4BWNA 1AV1A 1CW5A 1NWQA 3BASA 1OVUA 1KILB 4I6MC 1L0LE 1L0LG 1YTZT 3TNUA 2WSFJ 4EDFA 3A0BE 3L74E 3L74G 1JY2O 1OW8A 1HF9A 2IPPA 2YXRB 2QJYC 3AEGC 3VTPC 2YO2A 1SS1A 3SWYA 3AE4C 1EXIA 4L75A 3IN6A 3NXSA 1ZLLA 4ASWA 2FYUE 2FYUG 1EXJA 3CX5I 2OYHA 3AECC 1EDIA 3M0DC 1IFIA 3P7KA 4IL6X 3AE3C 1VQ4P 4ZKPA 1FDIA 2K9JB 2ZT9B 2QJKB 3B71A 1JY2N 1ZN5A 1PZQA 1JMMA 1FZFA 5CJ0A 3CWBE 3CWBG 1LP1A 1NKZB 2Z5HA 5KAFE 3AE2C 4Y99B 1VQKP 1P84I 1H89A 2N1TC 2IBZE 2IBZG 1YIJP 1FS0E 3GHGC 3M0AA 1NTKK 5CCHA 4XE5B 1NTZJ 4NPDA 5EFWB 2JEEA 2WSSH 1KYOH 3LW5H 3B5NC 2E75D 4LLHA 5KLVJ 1FOSF 1LTBC 3U59A 4N78D 5CCGC 2WPRA 1G2CA 3CI9A 3HD7A 1DEBA 2B88A 5KLVD 2OTJP 1IFDA 1URQB 5APYA 4IL6H 2IYPA 1KB9I 1QL2A 1UIXA 2KZJA 3H1JE 3H1JG 3GLMA 3R2PA 3RBZA 3RK2B 1ZMEC 4IL6E 4N3YB 1RF1A 3H32B 1HUCA 3A5TA 5GTHH 1E5WA 1WT6A 2R5BA 1CSBA 5K5GB 2XKMA 1HH0A 1IFJA 3FGAD 4H44C 3G6EP 1T3JA 1ZRTE 3G3ZA 2KB7P 4UB8E 3L4FA 4OWFA 4KJMA 1KYOI 1SQPE 1SQPG 2AEJA 3C8VA 3II6A 3NFQA 4DCKA 4U3FJ 3WUVA 4WY4B 1SQBG 1KQLA 1SQBE 1SP4A 1HGZA 4K35A 5AVZB 1N7SC 2A06D 4D6TE 1PGPA 4D6TG 3HD7B 1VQ5P 3HTKB 3WUTA 1J1DB 3P32A 3PTZA 5AW2B 3CMAP 4GKGA 4PJ0H 1S1CX 3HE4A 5C39A 1EDLA 1ZXGA 4H13B 3CC7P 2JDIH 3GHGB 3CPWO 3CLQA 3R4YA 4IFFA 4W7YA 1J1DC 5KKZC 2QA4P 3S1KA 2H7HA 2E5YA 2LXCB 2E75C 1BCCG 1BCCE 2P10A 2FFDB 1PGJA 3H1LJ 2FYNB 3JCUE 5KLIB 1S9KE 1OVVA 2AXTE 1FZCB 2Y9ZA 1VQPP 2C0WA 2AEMA 2FYUJ 2QJKC 2HFED 4Y28J 4H13D 4DT0A 4CPGA 2H89C 1PPJD 4DOJA 1KFNA 4EIJA 1JB0J 1DEEG 3TYYA 5TISH 1KQGB 1IO4A 3KPEA 2K88A 1JEKA 1IZNB 1GW4A 2K3RA 4DJGA 1T2KD 1U7MA 4C7RA 1SQQJ 1HBWA 1CI6B 3MUDA 3S4RA 5CBNA 1VQ8P 3L73D 1NHLA 1JOCA 1NOHA 2QG4A 4GT1A 5DJTB 2OGUA 2YXQB 1L0ND 4PD4D 2KNCB 3BCCG 3BCCE 3E1RA 1VDFA 1IFPA 3JSVC 3L71E 2ZXXA 3L71G 3LIDA 2HPCA 3OA7A 3PP5A 1URQC 4A7PA 1NTMG 1NTME 4GOEA 1FZCC 3V2PA 1KC8Q 3D71A 1FBMA 4DZOA 1Q2NA 3CX5H 2P67A 4YXWH 3D6ZA 4IOIH 2KZIA 1Y47A 2AXTH 2E76C 4H44D 3V4WA 5KJ7A 3OW2O 1YITP 1NTMD 3WU2E 1FZCA 1AVYA 3N7NA 2GUSA 3BRTB 3HRNA 2OTLP 3Q2YA 1YI2P 3UIAA 1NKNA 3ABVC 1GL2D 4OGQB 5APQA 3CCMP 1GU4A 1SQBD 1X9VA 4YPCA 4WY4C 2ZAEB 2JP3A 3VP9A 2N9BA 2W27A 2ZT9C 1OFCX 1FJKA 1R8EA 1ZOYC 1Q81Q 1KD1Q 3CX5D 3F89A 1S5LX 4PV1D 1X8YA 2P58A 2N1TA 3RBXA 2J59M 1AVOA 1USEA 3VN0A 1T2KC 1NJIQ 4GDOA 1GD2E 3E7KA 1VF5C 2JWDA 2HODB 4N78E 3S9OA 1NTZG 1NTZE 2HPCB 4I1LA 1T3UA 4MN4C 1E79H 4RJTA 1IJDB 2BCCJ 1GK6A 2CK3H 2WSCH 3H25A 2OYHC 1DX7A 2QJYB 2FFDA 1PGOA 2G8YA 3H1LG 3H1LE 1KQSO 1FZBA 2YKOA 3AEDC 5KTBA 1VQ7P 2D2CC 2KK7A 2WPVB 2B87A 1KILC 4L74A 5AW9B 5CJ4A 4W7ZA 3M9BA 2I8DA 2OYIB 1U57A 3M91A 3CD6P 3M9HA 3WU2H 2KS1A 2NPSC 1X79B 3AE1C 3M06A 4I7ZB 1SFCA 3L75D 4L73A 5APXA 1KB9D 1BCCD 2Q3EA 2YMKA 3MZWB 1Y9BA 3VOPA 2OYIA 2QIWA 1EC5A 1OXZA 3L70J 2N1TD 2O1JA 1GL2C 2B87B 2KYVA 3EFGA 1NU1K 2ZYAA 1A02J 1NTKJ 3AE5C 3W68A 2LKMA 2E74C 2YIUC 3CCQP 2SPZA 1BE3D 3A0HH 1S3JA 4U3FE 4U3FG 5AW7B 2KSJA 4OVNF 3TDKA 4ASVA 3NTNA 4H0LD 2H88C 1NVOA 4BXLA 3CCRP 2KOGA 3CCVP 2QVAA 1SFCD 1W2BO 2WT7A 1NTMJ 4OGQC 1S2EA 2Q5UA 1IK9A 1JCDA 2BASA 2VRSA 1KZUB 1LWUC 2D2CD 1SQXD 3AEAC 4TLFA 5AVVB 5KKZB 3CCUP 4WB4A 1Y8AA 2E74D 2PGDA 3HE5B 5KJ7D 4YTPC 5BVZA 2G3AA 1GU5A 2Q7CA 1N8RQ 1OW7A 3C1LA 1BDDA 1FU1A 1M1JA 1NYHA 2Q1KA 3Q5SA 1AQTA 1M1JC 1RF0A 4R4LA 1NAYA 2OARA 1G1IA 4AYCA 2WSFH 1L2PA 1USDA 1GK4A 1SQXJ 3W67A 1LTGC 2WMMA 3AE9C 1GZLA 4WVZA 3BVHA 2FYZA 4XA4A 1BDCA 3KQGA 1RE3C 3FXEA 1JNMA 3CC4P 2OQQA 1LP1B 2W8ZA 1PP9J 2PRRA 2WPSA 5CHXA 5KAIE 4PD4E 1OZHA 5AVWB 1L4AD 1KB9E 3H6PA 2M5AA 3Q1MA 1WRGA 1TU3F 4GODA 2Z5IA 1PIXA 5KLIC 3TGUG 3TGUE 1PFIA 3RK3E 5APWA 1SQVK 2E75B 2W6JH 2O01J 3BCCJ 3IFMA 2FFDC 3H1KE 1GL2A 2JWAA 3H1KG 1K05A 1MFZA 3O6QB 4LC1A 3AEEC 4H13C 1DD4A 1SQQD 1J1EC 2P7JA 2DW3A 2QM7A 3JCUH 2C0XA 2E76B 3B5NB 4JPZB 3CCJP 2FYNC 3L73E 1N86A 3L73G 3MUDC 5CCHD 1ZR4A 1P84E 2B9BA 2M3EA 5AVXB 2HODA 3E1IA 1KILA 1NTZD 3O8ZA 2ZVNB 5APUA 3KDPB 1BSNA
chains in the Genus database with same CATH topology
4GOEA 1MFTA 1Q2NA 3PH0A 4IOIH 4EYYQ 2KZIA 1Y47A 3RGUA 2LXBA 1OVUA 4HJGH 2ZAEB 1SS1A 2B89A 1EDKA 1X0TA 4NPEA 4ASWA 1H0TB 4WWIA 2P58A 4HKZH 1EDIA 1H0TA 2M5AB 2JWDA 1FC2C 1LP1A 4K3AA 4MN4C 2UWJE 4NPDA 2B87A 3QWOC 5EFWB 2I8DA 2QRXA 2B88A 3MZWB 2R44A 1EC5A 2KZJA 2B87B 3MHVA 1JM0A 2OTKE 4GOFA 2SPZA 5K5GB 1S3JA 4HB1A 4ASVA 1NVOA 4BXLA 3FXDA 2QVAA 4KJMA 1U7JA 4K35A 4ZMDA 4ZNCA 1BDDA 2Q1KA 5C39A 1EDLA 1LT1A 1OVRA 1EDJA 1ZXGA 5CBOA 2WMMA 3S1KA 2LXCB 4JBZA 1BDCA 1ZW0A 3FXEA 1OVVA 1LP1B 1JMBA 2KIKA 2M5AA 2KS1B 4CPGA 4GODA 2KUBA 1DEEG 3ZDMA 4NPFX 2LR2A 2K3RA 1U7MA 2KI7B 2HR3A 5CBNA 5DJTB 5DJUB 2M0BA 2RKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOE A;  1MFT A;  1Q2N A;  3PH0 A;  4IOI H;  4EYY Q;  2KZI A;  1Y47 A;  3RGU A;  2LXB A;  1OVU A;  4HJG H;  2ZAE B;  1SS1 A;  2B89 A;  1EDK A;  1X0T A;  4NPE A;  4ASW A;  1H0T B;  4WWI A;  2P58 A;  4HKZ H;  1EDI A;  1H0T A;  2M5A B;  2JWD A;  1FC2 C;  1LP1 A;  4K3A A;  4MN4 C;  2UWJ E;  4NPD A;  2B87 A;  3QWO C;  5EFW B;  2I8D A;  2QRX A;  2B88 A;  3MZW B;  2R44 A;  1EC5 A;  2KZJ A;  2B87 B;  3MHV A;  1JM0 A;  2OTK E;  4GOF A;  2SPZ A;  5K5G B;  1S3J A;  4HB1 A;  4ASV A;  1NVO A;  4BXL A;  3FXD A;  2QVA A;  4KJM A;  1U7J A;  4K35 A;  4ZMD A;  4ZNC A;  1BDD A;  2Q1K A;  5C39 A;  1EDL A;  1LT1 A;  1OVR A;  1EDJ A;  1ZXG A;  5CBO A;  2WMM A;  3S1K A;  2LXC B;  4JBZ A;  1BDC A;  1ZW0 A;  3FXE A;  1OVV A;  1LP1 B;  1JMB A;  2KIK A;  2M5A A;  2KS1 B;  4CPG A;  4GOD A;  2KUB A;  1DEE G;  3ZDM A;  4NPF X;  2LR2 A;  2K3R A;  1U7M A;  2KI7 B;  2HR3 A;  5CBN A;  5DJT B;  5DJU B;  2M0B A;  2RKL A; 
#chains in the Genus database with same CATH topology
 1S72 P;  4PJ0 E;  1MFT A;  3CC2 P;  2ZFC A;  3P8C D;  2ITA A;  1RY3 A;  1EQ7 A;  3AE7 C;  2W83 C;  4Y99 C;  1JO5 A;  1OW6 A;  2R32 A;  1LNQ A;  2W6A A;  1CZQ A;  4KHX A;  3N4X A;  1BE3 E;  1BE3 G;  3VMY A;  4EYY Q;  2FY8 A;  2IDB A;  5KLV E;  1RHZ B;  5KLV G;  3RGU A;  1K9M Q;  1D7M A;  2R5D A;  5KAF H;  2QSI A;  1VQ6 P;  1KYO D;  2LXB A;  2IBZ I;  3RK3 D;  2M8R A;  1PGQ A;  5TJH A;  1JUN A;  4HJG H;  1KTM A;  2OYO A;  2Z4E A;  4R4M A;  1JY3 O;  2XND H;  1W2E A;  2POH A;  2WVR A;  1BGY J;  4PD4 H;  5E79 E;  2GA1 A;  5KJ7 C;  1KIL D;  1K73 Q;  2AXC A;  2B89 A;  1VQL P;  2FKW B;  3AE6 C;  1QEX A;  1EDK A;  1LTI C;  2D2C B;  3RL0 g;  1JTH A;  5APT A;  1VQN P;  2WWW A;  3M0D A;  3KZI E;  4WWI A;  2K1A A;  3A2A A;  4HKZ H;  2P2U A;  3CL3 D;  1DD3 A;  5AW4 B;  2OYH B;  1L0L J;  3OJA B;  4IFD K;  3KZI H;  4D6T D;  3SFE C;  3Q5P A;  1H0T A;  3L74 J;  1XTG B;  2WT7 B;  3RL0 B;  2IYO A;  1FC2 C;  2FYU D;  2JJL A;  1PPJ G;  1PPJ E;  1PP9 D;  1SQP K;  2NPS D;  3CXH H;  3FWL A;  1L0L K;  1AFO A;  3RL0 D;  2YIU B;  3EQ2 A;  1Q86 Q;  4N6J A;  1KQF B;  1M90 Q;  3Q3D A;  1MUU A;  3TNU B;  1N7S B;  1NU1 J;  1IK7 A;  1P84 D;  2RMZ A;  3USS A;  3VYI A;  3H1I J;  4BRY A;  3F5H A;  3L70 G;  3L70 E;  2V7Q H;  3V5B A;  1MZ9 A;  3HE4 B;  3T97 A;  3GF3 A;  5B5E H;  4RKU J;  2QRX A;  4H0L B;  3TGU J;  1ZP0 C;  3GG2 A;  2IX7 C;  2R44 A;  3L75 E;  3L75 G;  4HYT B;  3PJS K;  3T97 B;  2O01 N;  4C7N A;  1R5S A;  4ZKU A;  2O01 H;  4EOT A;  1VQO P;  3JC2 2;  3VMX A;  1NAF A;  1XTC C;  2V4H A;  2YNY A;  2I1K A;  2RH0 A;  3MD0 A;  2OTK E;  2E5T A;  2FXO A;  1Q90 D;  2Q6Q A;  3H1K J;  3RK3 B;  3G4S P;  2Y0D A;  3G9R A;  2I1J A;  2Y9Y A;  1EZV E;  1EZV G;  3L73 J;  4HB1 A;  1GDT A;  1MKM A;  2FXM A;  1L0N G;  1L0N E;  2WPQ A;  3FXD A;  2IBZ D;  2M3B A;  1FAV A;  3SWK A;  1RF1 B;  1HGV A;  5BU5 A;  3LW5 J;  3L72 E;  1JY3 N;  3L72 G;  5AW0 B;  2Q3I A;  1URQ D;  1U7J A;  1KV4 A;  4ZMD A;  1N7L A;  1FZE A;  1MV8 A;  2E42 A;  1N73 C;  4M3L A;  1SQX E;  1SQX G;  1ZRT D;  4H0L C;  2BEQ D;  1L0L D;  1LWU A;  3CXH E;  4WY4 A;  5TIS E;  3VMZ A;  3H1L D;  1SQP D;  3HUS B;  2E76 D;  2QM8 A;  2FYU K;  1FOS E;  1QVF O;  1S5L E;  1T8Z A;  3L37 A;  1YJW P;  1PP9 G;  1PP9 E;  1HVV A;  3EFF K;  2IFN A;  5CBO A;  2Q9I A;  1N7S A;  3CXH I;  4IFM A;  3V2N A;  4BRY B;  3Q5R A;  1RE4 C;  2JO1 A;  2WSE H;  1SQB J;  3MIW A;  4PV1 B;  2O3J A;  1M8O B;  3FX0 A;  4JBZ A;  5B5E E;  4D6T J;  3I56 P;  4JYB A;  1OX3 A;  1ZW0 A;  1SQQ G;  1SQQ E;  3B5N D;  3QH9 A;  4C7N B;  1G1J A;  1OMI A;  1L0N K;  2HLO A;  2ZVO B;  1LTJ C;  2KIK A;  5E79 H;  3CX5 E;  2ZT9 D;  1N73 B;  2ZJS E;  1BSH A;  2K9Y A;  3GF7 A;  2YKP A;  3HE5 A;  3IR9 A;  5CCH C;  3L72 D;  2KUB A;  1KIL E;  1RF1 C;  1KMI Z;  2OYI C;  2JR8 A;  1NU1 D;  3MTU E;  1HTL C;  2JKV A;  2N9Y B;  2NPS A;  3D6Y A;  2A45 H;  1GMJ A;  1EZV D;  1L4A C;  1M7L A;  1X22 A;  3LIE A;  3HD7 C;  1UII A;  3PRJ A;  3MGN A;  2H8P D;  1GW3 A;  3AE8 C;  4AUW A;  3C9I A;  2J58 A;  4EI2 A;  5BU8 B;  3V6I A;  5AVR B;  1ZR2 A;  1NU1 G;  1NU1 E;  2V7Q J;  2XDJ A;  2ZYD A;  1RQU A;  3IAO A;  4PD4 I;  1LT9 A;  2C9N Y;  5DJU B;  1AJY A;  2KLV A;  2M0B A;  2RKL A;  2K9J A;  2YO3 A;  2PP6 A;  3B4S A;  1VF5 B;  2WSE J;  3H1H G;  3H1H E;  1OWA A;  2A06 G;  2A06 E;  3P8C E;  4U7J A;  5AW8 B;  1H88 A;  2CPS A;  4YXD C;  1S5L H;  1SQV G;  1SQV E;  1SFC B;  3L75 J;  1FJP A;  1KN7 A;  2H43 A;  1BGY E;  1BGY G;  3G71 P;  2O1K A;  3L70 D;  2J5U A;  3H1H D;  2CPB A;  3EWK A;  3B8E B;  2A45 I;  2P1J A;  1AA0 A;  1QGK B;  3NMD A;  4GIF A;  2C9L Y;  4U3F D;  3TF5 A;  3D70 A;  1P84 H;  2NZ2 A;  2QJP C;  3M9Q A;  3V2R A;  3VP8 A;  3KHU A;  1BGY D;  2XV5 A;  1FZG A;  1CI6 A;  2FBW C;  2BCC G;  2BCC E;  2A45 G;  3CXH D;  1X0T A;  5CCG D;  1YYC A;  2L5G B;  4NPE A;  1NO4 A;  3HTK A;  3RL0 C;  3I55 P;  2MKV A;  1H0T B;  1HJB A;  3ITK A;  4AQR D;  1KYO E;  2WQY C;  3L72 J;  1RE3 A;  4HH2 A;  3RK3 C;  2N1T B;  5AW3 B;  5AVQ B;  3WUU A;  1Q82 Q;  1FDM A;  4LGD E;  2FXP A;  2M5A B;  2WZ7 A;  1FE6 A;  1JTH B;  1OIP A;  1VF5 D;  2KSE A;  2ZXE B;  1LJ2 A;  3CWB D;  1M57 D;  3H1I G;  3H1I E;  3I5C A;  5AW6 B;  1YQ4 C;  5L8R J;  4K3A A;  5GTI E;  1DH3 A;  1YQ3 C;  2YKQ A;  2W90 A;  1H8A A;  3KXD A;  3L35 A;  4B86 A;  1RF0 C;  1W5C E;  2UWJ E;  3RK2 D;  5GTI H;  2WTY A;  1AQ5 A;  1YJ9 P;  3O6Q A;  5AVT B;  1SQX K;  3AEB C;  1DIP A;  3FWN A;  3BCC D;  1LGH B;  3BRV B;  3QWO C;  1L4A A;  1IFN A;  1RE4 A;  2R3C A;  3CWB J;  4XFJ A;  3SSU A;  2MJZ A;  1FDO A;  3HUS A;  3IF4 A;  2BEZ F;  1G2C B;  4L76 A;  1K04 A;  1FZA A;  1QX8 A;  3OAK A;  1VQ9 P;  5AW1 B;  4W80 A;  2KXP B;  4JYC A;  3RK2 C;  2Y0E A;  1L0N J;  1Q7Y Q;  1K8A Q;  3A0B H;  1JM0 A;  3MHV A;  1LT9 C;  2QEX P;  2KP8 A;  5M1B A;  1YHQ P;  1LT9 B;  3H1K D;  3CCS P;  4KT0 J;  2KNC A;  2PFX A;  4GOF A;  2WSC J;  3SWF A;  5H2F E;  3TSI A;  1JCC A;  1M1K Q;  2YMY A;  3VMA A;  1LTT C;  3L36 A;  5H2F H;  1J1E B;  5AVY B;  3WMM 0;  3GW6 A;  1HWT C;  2XNX A;  2GM4 A;  1SFC C;  3TK1 A;  2HG5 D;  2QJP B;  3H1H J;  1GL2 B;  4OGQ D;  2AEF A;  1IFM A;  4I2L C;  1NTZ K;  5B66 H;  2QE7 H;  1HJ0 A;  3V2Q A;  1SQV J;  1R5L A;  4ZNC A;  1NTK E;  1NTK G;  2NRG A;  3A3Y B;  4QMA A;  2K37 A;  5B66 E;  2E43 A;  3A7O A;  3V4Q A;  1LTJ A;  1N73 A;  1SQQ K;  3L71 D;  4H44 B;  1J2J B;  1SQP J;  1PV3 A;  1LT1 A;  1OVR A;  1EDJ A;  5APS A;  1L4A B;  2BCC D;  1KFM A;  1YJN P;  1SQV D;  1VL2 A;  4UB6 E;  1RH5 B;  1SVF A;  2W6B A;  2WIT A;  2KLU A;  3GHG A;  3L74 D;  2L91 A;  1EZV I;  1YBK A;  4TT3 H;  4UB6 H;  1Z56 A;  3H1J D;  1PL5 A;  2XZR A;  2IFM A;  1JMB A;  5AW5 B;  1M1J B;  4Z1M H;  1QVG O;  3P8M C;  5AVS B;  3SFD C;  1LTJ B;  4WBA A;  2KS1 B;  1WMK A;  1LWU B;  1SQB K;  3PLN A;  1ZV8 A;  1IC2 A;  1RQV A;  5CMZ A;  5CCG A;  1BCC J;  1QL1 A;  3PHL A;  1M56 D;  3ZDM A;  5APV A;  5GTH E;  1VQM P;  2E74 B;  1LTA C;  4NPF X;  2LR2 A;  3H1J J;  2XU6 A;  2IZ0 A;  3U1A A;  1NTM K;  1LTS C;  1N7S D;  2KI7 B;  1BE3 J;  1QLE D;  2HR3 A;  3B5N A;  3MP7 B;  4UB8 H;  4O9B A;  5KLV K;  3TGU D;  1S9K D;  1VPC A;  4OH8 B;  3HUS C;  1N2D C;  2ZYG A;  1GTW A;  2R3S A;  4PV1 C;  1KOR A;  2NPS B;  3H32 A;  1T6A A;  4I7Z C;  3H1I D;  3GMA A;  3A0H E;  4JF7 A;  2IZ1 A;  1A02 F;  3CCE P;  5AVU B;  4RO0 A;  1JY3 P;  4WY4 D;  1NTK D;  4C46 A;  1NGM B;  1YTZ I;  4JQ0 D;  3U1C A;  3AEF C;  1URQ A;  3CME P;  5KAI H;  2HYN A;  3PH0 A;  4RES B;  1KB9 H;  3BAT A;  2Y0C A;  1S4X A;  2GUV A;  3L71 J;  1SLQ A;  3HD7 D;  3K5B A;  2RN0 A;  3CCL P;  1JY2 P;  1NH4 A;  3KYQ A;  2PAJ A;  4BWN A;  1AV1 A;  1CW5 A;  1NWQ A;  3BAS A;  1OVU A;  1KIL B;  4I6M C;  1L0L E;  1L0L G;  1YTZ T;  3TNU A;  2WSF J;  4EDF A;  3A0B E;  3L74 E;  3L74 G;  1JY2 O;  1OW8 A;  1HF9 A;  2IPP A;  2YXR B;  2QJY C;  3AEG C;  3VTP C;  2YO2 A;  1SS1 A;  3SWY A;  3AE4 C;  1EXI A;  4L75 A;  3IN6 A;  3NXS A;  1ZLL A;  4ASW A;  2FYU E;  2FYU G;  1EXJ A;  3CX5 I;  2OYH A;  3AEC C;  1EDI A;  3M0D C;  1IFI A;  3P7K A;  4IL6 X;  3AE3 C;  1VQ4 P;  4ZKP A;  1FDI A;  2K9J B;  2ZT9 B;  2QJK B;  3B71 A;  1JY2 N;  1ZN5 A;  1PZQ A;  1JMM A;  1FZF A;  5CJ0 A;  3CWB E;  3CWB G;  1LP1 A;  1NKZ B;  2Z5H A;  5KAF E;  3AE2 C;  4Y99 B;  1VQK P;  1P84 I;  1H89 A;  2N1T C;  2IBZ E;  2IBZ G;  1YIJ P;  1FS0 E;  3GHG C;  3M0A A;  1NTK K;  5CCH A;  4XE5 B;  1NTZ J;  4NPD A;  5EFW B;  2JEE A;  2WSS H;  1KYO H;  3LW5 H;  3B5N C;  2E75 D;  4LLH A;  5KLV J;  1FOS F;  1LTB C;  3U59 A;  4N78 D;  5CCG C;  2WPR A;  1G2C A;  3CI9 A;  3HD7 A;  1DEB A;  2B88 A;  5KLV D;  2OTJ P;  1IFD A;  1URQ B;  5APY A;  4IL6 H;  2IYP A;  1KB9 I;  1QL2 A;  1UIX A;  2KZJ A;  3H1J E;  3H1J G;  3GLM A;  3R2P A;  3RBZ A;  3RK2 B;  1ZME C;  4IL6 E;  4N3Y B;  1RF1 A;  3H32 B;  1HUC A;  3A5T A;  5GTH H;  1E5W A;  1WT6 A;  2R5B A;  1CSB A;  5K5G B;  2XKM A;  1HH0 A;  1IFJ A;  3FGA D;  4H44 C;  3G6E P;  1T3J A;  1ZRT E;  3G3Z A;  2KB7 P;  4UB8 E;  3L4F A;  4OWF A;  4KJM A;  1KYO I;  1SQP E;  1SQP G;  2AEJ A;  3C8V A;  3II6 A;  3NFQ A;  4DCK A;  4U3F J;  3WUV A;  4WY4 B;  1SQB G;  1KQL A;  1SQB E;  1SP4 A;  1HGZ A;  4K35 A;  5AVZ B;  1N7S C;  2A06 D;  4D6T E;  1PGP A;  4D6T G;  3HD7 B;  1VQ5 P;  3HTK B;  3WUT A;  1J1D B;  3P32 A;  3PTZ A;  5AW2 B;  3CMA P;  4GKG A;  4PJ0 H;  1S1C X;  3HE4 A;  5C39 A;  1EDL A;  1ZXG A;  4H13 B;  3CC7 P;  2JDI H;  3GHG B;  3CPW O;  3CLQ A;  3R4Y A;  4IFF A;  4W7Y A;  1J1D C;  5KKZ C;  2QA4 P;  3S1K A;  2H7H A;  2E5Y A;  2LXC B;  2E75 C;  1BCC G;  1BCC E;  2P10 A;  2FFD B;  1PGJ A;  3H1L J;  2FYN B;  3JCU E;  5KLI B;  1S9K E;  1OVV A;  2AXT E;  1FZC B;  2Y9Z A;  1VQP P;  2C0W A;  2AEM A;  2FYU J;  2QJK C;  2HFE D;  4Y28 J;  4H13 D;  4DT0 A;  4CPG A;  2H89 C;  1PPJ D;  4DOJ A;  1KFN A;  4EIJ A;  1JB0 J;  1DEE G;  3TYY A;  5TIS H;  1KQG B;  1IO4 A;  3KPE A;  2K88 A;  1JEK A;  1IZN B;  1GW4 A;  2K3R A;  4DJG A;  1T2K D;  1U7M A;  4C7R A;  1SQQ J;  1HBW A;  1CI6 B;  3MUD A;  3S4R A;  5CBN A;  1VQ8 P;  3L73 D;  1NHL A;  1JOC A;  1NOH A;  2QG4 A;  4GT1 A;  5DJT B;  2OGU A;  2YXQ B;  1L0N D;  4PD4 D;  2KNC B;  3BCC G;  3BCC E;  3E1R A;  1VDF A;  1IFP A;  3JSV C;  3L71 E;  2ZXX A;  3L71 G;  3LID A;  2HPC A;  3OA7 A;  3PP5 A;  1URQ C;  4A7P A;  1NTM G;  1NTM E;  4GOE A;  1FZC C;  3V2P A;  1KC8 Q;  3D71 A;  1FBM A;  4DZO A;  1Q2N A;  3CX5 H;  2P67 A;  4YXW H;  3D6Z A;  4IOI H;  2KZI A;  1Y47 A;  2AXT H;  2E76 C;  4H44 D;  3V4W A;  5KJ7 A;  3OW2 O;  1YIT P;  1NTM D;  3WU2 E;  1FZC A;  1AVY A;  3N7N A;  2GUS A;  3BRT B;  3HRN A;  2OTL P;  3Q2Y A;  1YI2 P;  3UIA A;  1NKN A;  3ABV C;  1GL2 D;  4OGQ B;  5APQ A;  3CCM P;  1GU4 A;  1SQB D;  1X9V A;  4YPC A;  4WY4 C;  2ZAE B;  2JP3 A;  3VP9 A;  2N9B A;  2W27 A;  2ZT9 C;  1OFC X;  1FJK A;  1R8E A;  1ZOY C;  1Q81 Q;  1KD1 Q;  3CX5 D;  3F89 A;  1S5L X;  4PV1 D;  1X8Y A;  2P58 A;  2N1T A;  3RBX A;  2J59 M;  1AVO A;  1USE A;  3VN0 A;  1T2K C;  1NJI Q;  4GDO A;  1GD2 E;  3E7K A;  1VF5 C;  2JWD A;  2HOD B;  4N78 E;  3S9O A;  1NTZ G;  1NTZ E;  2HPC B;  4I1L A;  1T3U A;  4MN4 C;  1E79 H;  4RJT A;  1IJD B;  2BCC J;  1GK6 A;  2CK3 H;  2WSC H;  3H25 A;  2OYH C;  1DX7 A;  2QJY B;  2FFD A;  1PGO A;  2G8Y A;  3H1L G;  3H1L E;  1KQS O;  1FZB A;  2YKO A;  3AED C;  5KTB A;  1VQ7 P;  2D2C C;  2KK7 A;  2WPV B;  2B87 A;  1KIL C;  4L74 A;  5AW9 B;  5CJ4 A;  4W7Z A;  3M9B A;  2I8D A;  2OYI B;  1U57 A;  3M91 A;  3CD6 P;  3M9H A;  3WU2 H;  2KS1 A;  2NPS C;  1X79 B;  3AE1 C;  3M06 A;  4I7Z B;  1SFC A;  3L75 D;  4L73 A;  5APX A;  1KB9 D;  1BCC D;  2Q3E A;  2YMK A;  3MZW B;  1Y9B A;  3VOP A;  2OYI A;  2QIW A;  1EC5 A;  1OXZ A;  3L70 J;  2N1T D;  2O1J A;  1GL2 C;  2B87 B;  2KYV A;  3EFG A;  1NU1 K;  2ZYA A;  1A02 J;  1NTK J;  3AE5 C;  3W68 A;  2LKM A;  2E74 C;  2YIU C;  3CCQ P;  2SPZ A;  1BE3 D;  3A0H H;  1S3J A;  4U3F E;  4U3F G;  5AW7 B;  2KSJ A;  4OVN F;  3TDK A;  4ASV A;  3NTN A;  4H0L D;  2H88 C;  1NVO A;  4BXL A;  3CCR P;  2KOG A;  3CCV P;  2QVA A;  1SFC D;  1W2B O;  2WT7 A;  1NTM J;  4OGQ C;  1S2E A;  2Q5U A;  1IK9 A;  1JCD A;  2BAS A;  2VRS A;  1KZU B;  1LWU C;  2D2C D;  1SQX D;  3AEA C;  4TLF A;  5AVV B;  5KKZ B;  3CCU P;  4WB4 A;  1Y8A A;  2E74 D;  2PGD A;  3HE5 B;  5KJ7 D;  4YTP C;  5BVZ A;  2G3A A;  1GU5 A;  2Q7C A;  1N8R Q;  1OW7 A;  3C1L A;  1BDD A;  1FU1 A;  1M1J A;  1NYH A;  2Q1K A;  3Q5S A;  1AQT A;  1M1J C;  1RF0 A;  4R4L A;  1NAY A;  2OAR A;  1G1I A;  4AYC A;  2WSF H;  1L2P A;  1USD A;  1GK4 A;  1SQX J;  3W67 A;  1LTG C;  2WMM A;  3AE9 C;  1GZL A;  4WVZ A;  3BVH A;  2FYZ A;  4XA4 A;  1BDC A;  3KQG A;  1RE3 C;  3FXE A;  1JNM A;  3CC4 P;  2OQQ A;  1LP1 B;  2W8Z A;  1PP9 J;  2PRR A;  2WPS A;  5CHX A;  5KAI E;  4PD4 E;  1OZH A;  5AVW B;  1L4A D;  1KB9 E;  3H6P A;  2M5A A;  3Q1M A;  1WRG A;  1TU3 F;  4GOD A;  2Z5I A;  1PIX A;  5KLI C;  3TGU G;  3TGU E;  1PFI A;  3RK3 E;  5APW A;  1SQV K;  2E75 B;  2W6J H;  2O01 J;  3BCC J;  3IFM A;  2FFD C;  3H1K E;  1GL2 A;  2JWA A;  3H1K G;  1K05 A;  1MFZ A;  3O6Q B;  4LC1 A;  3AEE C;  4H13 C;  1DD4 A;  1SQQ D;  1J1E C;  2P7J A;  2DW3 A;  2QM7 A;  3JCU H;  2C0X A;  2E76 B;  3B5N B;  4JPZ B;  3CCJ P;  2FYN C;  3L73 E;  1N86 A;  3L73 G;  3MUD C;  5CCH D;  1ZR4 A;  1P84 E;  2B9B A;  2M3E A;  5AVX B;  2HOD A;  3E1I A;  1KIL A;  1NTZ D;  3O8Z A;  2ZVN B;  5APU A;  3KDP B;  1BSN A; 
#chains in the Genus database with same CATH homology
 4GOE A;  1MFT A;  1Q2N A;  3PH0 A;  4IOI H;  4EYY Q;  2KZI A;  1Y47 A;  3RGU A;  2LXB A;  1OVU A;  4HJG H;  2ZAE B;  1SS1 A;  2B89 A;  1EDK A;  1X0T A;  4NPE A;  4ASW A;  1H0T B;  4WWI A;  2P58 A;  4HKZ H;  1EDI A;  1H0T A;  2M5A B;  2JWD A;  1FC2 C;  1LP1 A;  4K3A A;  4MN4 C;  2UWJ E;  4NPD A;  2B87 A;  3QWO C;  5EFW B;  2I8D A;  2QRX A;  2B88 A;  3MZW B;  2R44 A;  1EC5 A;  2KZJ A;  2B87 B;  3MHV A;  1JM0 A;  2OTK E;  4GOF A;  2SPZ A;  5K5G B;  1S3J A;  4HB1 A;  4ASV A;  1NVO A;  4BXL A;  3FXD A;  2QVA A;  4KJM A;  1U7J A;  4K35 A;  4ZMD A;  4ZNC A;  1BDD A;  2Q1K A;  5C39 A;  1EDL A;  1LT1 A;  1OVR A;  1EDJ A;  1ZXG A;  5CBO A;  2WMM A;  3S1K A;  2LXC B;  4JBZ A;  1BDC A;  1ZW0 A;  3FXE A;  1OVV A;  1LP1 B;  1JMB A;  2KIK A;  2M5A A;  2KS1 B;  4CPG A;  4GOD A;  2KUB A;  1DEE G;  3ZDM A;  4NPF X;  2LR2 A;  2K3R A;  1U7M A;  2KI7 B;  2HR3 A;  5CBN A;  5DJT B;  5DJU B;  2M0B A;  2RKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...