5EFWB

Crystal structure of lov2-zdk1 - the complex of oat lov2 and the affibody protein zdark1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
55
structure length
55
Chain Sequence
KFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
molecule keywords NPH1-1
total genus 24
structure length 55
sequence length 55
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5efwB00
2WMMA 2LXBA 2OTKE 3QWOC 2K3RA 2QVAA 1ZXGA 5C39A 4HB1A 4K3AA 3PH0A 2B88A 1U7JA 3FXEA 1FC2C 3MZWB 2QRXA 4ZMDA 2KS1B 3FXDA 5K5GB 1S3JA 1NVOA 1Q2NA 1Y47A 2KIKA 1JM0A 1LT1A 4HKZH 1LP1A 1BDDA 2KZJA 2P58A 2UWJE 2Q1KA 2RKLA 1X0TA 1H0TB 1BDCA 2B89A 4WWIA 1EC5A 1DEEG 1SS1A 2LR2A 1LP1B 4NPEA 2I8DA 1OVVA 4K35A 2KUBA 3MHVA 2M0BA 1OVUA 2KI7B 3RGUA 3ZDMA 4NPDA 4ASVA 1EDLA 4GOFA 5CBOA 1H0TA 2HR3A 2SPZA 2ZAEB 1ZW0A 5DJUB 2B87B 2KZIA 2M5AA 4GOEA 1MFTA 4CPGA 4MN4C 1EDJA 5EFWB 4KJMA 4NPFX 2B87A 4IOIH 2JWDA 4HJGH 1EDIA 4GODA 4JBZA 4ASWA 2R44A 1U7MA 1EDKA 2LXCB 4ZNCA 1JMBA 2M5AB 4BXLA 4EYYQ 1OVRA 5CBNA 5DJTB 3S1KA
chains in the Genus database with same CATH superfamily
3L71E 5AVRB 4GDOA 4IFMA 4BRYA 1URQC 1N7SB 2LXBA 3TYYA 2WITA 3H1JD 3QWOC 4AYCA 3HRNA 1SQXD 2PAJA 3L73J 1YHQP 1KN7A 3VMAA 3V2PA 3JCUH 3WUUA 1SP4A 1IC2A 1NO4A 1BE3D 2RN0A 3AECC 3IFMA 4UB8E 4ZKPA 2A06D 2R3CA 4PV1B 5KAFE 3HD7D 1U7JA 4D6TG 1NU1J 2OGUA 3MIWA 1OX3A 2E5TA 2OARA 1M8OB 2ZYGA 3P8MC 2JDIH 4TT3H 1RF1C 1X79B 2QRXA 2D2CB 1GTWA 5KLVJ 1FZBA 2QJPB 3H1JE 3TNUA 1LTAC 1SFCC 5AW2B 4C46A 1KB9E 4LLHA 1NVOA 1PZQA 1SFCD 2KNCB 2FYUK 1GW3A 2E5YA 3L72D 4OGQC 1BSNA 1QL1A 5GTIE 3H25A 1SQBD 1RH5B 1R5LA 3RL0D 2YIUB 1T3UA 3E1IA 1YBKA 4AQRD 1OMIA 2ZVOB 4HKZH 3RL0C 2GA1A 2RMZA 4PV1D 5TISH 1VQOP 1KORA 1LP1A 1SQVG 1PGQA 1IK7A 2HG5D 3MD0A 4N3YB 1LWUB 1M1JA 1S5LX 3T97A 3SSUA 2AXTE 1JMMA 2OYOA 3L72E 1VQNP 3H32B 1LNQA 2QJKC 1OFCX 1W5CE 3H1KE 2RKLA 1FDOA 3MP7B 1HWTC 3CX5H 1FDIA 1QVFO 1RE4A 2B89A 1JEKA 2FYUE 2KS1A 4WWIA 3W68A 5APYA 3H1LD 1S4XA 1YTZT 1FS0E 1PP9G 4OVNF 1E5WA 2KP8A 1NKZB 2WT7B 3D6ZA 5APWA 3WUTA 4WY4A 3RBZA 1FZCA 3A3YB 1URQA 1NTZJ 1H89A 1X9VA 1YIJP 4I7ZC 5KJ7C 3L70G 1HTLC 1S72P 3CMEP 1L4AB 1KILD 1BGYD 3L75E 1YQ4C 5KJ7D 2PP6A 2Z5IA 2W83C 1GL2A 2AEMA 4O9BA 1HUCA 3I5CA 3H1LE 3L73D 2NRGA 2XZRA 3FX0A 2OYHC 1SFCA 3HUSB 1NTMK 3C9IA 4W7YA 1YITP 1GU4A 2HPCA 2FFDC 1P84D 3AE9C 3GLMA 3C8VA 3G9RA 3KDPB 5KLIC 2XNXA 3S9OA 5KKZC 3D71A 3IN6A 4L75A 2N9BA 2WSEH 2E74D 5CBOA 1FZGA 3RL0g 2KK7A 1VQLP 1JCDA 1GW4A 3CCJP 1S5LH 4B86A 1N73B 4H44C 5AW4B 1LTJB 1SQPJ 1ZW0A 3HE4A 3H1HG 2IPPA 1KQSO 3BCCE 3G6EP 1J1DC 1Q81Q 3MGNA 2J59M 3AEDC 2N1TD 3CMAP 1SQBK 1NTZD 3CL3D 1KFMA 1KD1Q 1PIXA 1CZQA 1VDFA 2POHA 4BWNA 1L0ND 3BCCG 1IFDA 2HODA 1NTKE 1ZRTD 3AE3C 2WSFJ 5BU8B 1LT9A 1PGPA 2E76D 2WQYC 1KQFB 1NU1G 3Q5RA 5AVTB 4H44B 1QLED 5E79H 3PHLA 2LKMA 3BASA 3OA7A 5CCGA 5AVSB 2HYNA 1ZR2A 3M06A 2K1AA 5KLIB 2OYIC 1EDKA 2W27A 1DH3A 1SQQK 5B5EH 2QM7A 3CC2P 3GW6A 3VMYA 2M5AB 1SLQA 3HUSC 3KZIH 4OGQD 5APTA 2OYHB 1OVRA 5CBNA 2C0WA 3CCUP 3N7NA 1FE6A 3GHGC 3CXHH 5KLVG 3KYQA 1SQBJ 5DJTB 1JY2N 2FBWC 3NMDA 1SQQD 1KB9H 3L75G 3AE5C 2V7QJ 3SWKA 3BRVB 1GD2E 1CI6A 3TGUE 1PFIA 4U3FD 3VP9A 1NTKJ 3SWYA 1N7SA 2H43A 1DIPA 2A06G 2E74B 2Q7CA 1NH4A 3A0BE 1SQPK 4UB6E 2R32A 3GMAA 5H2FE 2OYHA 2C9LY 1ZXGA 1P84E 1NAYA 5C39A 3Q1MA 4HB1A 4IL6E 1LTTC 2FXMA 2FYUG 1SQQE 2ZT9C 3L4FA 3JCUE 4W80A 1P84H 3WU2H 5AVZB 1HBWA 3Q5PA 2QJKB 3BCCJ 2KYVA 4R4MA 3FXEA 1NTME 2P67A 4EDFA 3VTPC 2IZ1A 2KB7P 3K5BA 3KQGA 3L72G 2O01J 3VP8A 4ZMDA 3D70A 2KS1B 3G3ZA 3CX5E 2IDBA 4PD4E 1PGOA 1IFNA 1XTGB 3OAKA 2E75D 1NGMB 1BCCE 1S3JA 1VQ7P 2JEEA 1FAVA 4H0LB 1D7MA 1Q2NA 1H88A 1BE3E 2A45G 1N73C 4I2LC 2BASA 3TGUG 3IF4A 1EZVE 2N9YB 2YIUC 2YKQA 4C7RA 1RF1A 2ZFCA 3RK3C 1FZCC 3M9QA 1LTGC 3CLQA 2FYNC 1YYCA 2FFDB 1G2CA 3JSVC 1IK9A 4R4LA 3TSIA 1BDDA 1QEXA 1S1CX 3CC4P 1AV1A 2CPBA 3A0HH 1N2DC 4QMAA 2QJPC 2O01H 2P58A 3L71D 3L75J 1JTHB 1JY2P 1GL2C 1PPJD 2Q3IA 1GU5A 3E7KA 1K8AQ 3M0AA 2K88A 3TDKA 4L73A 3CWBG 3Q2YA 3D6YA 1X0TA 5APVA 1BDCA 4W7ZA 4I7ZB 3ABVC 1S9KD 1M1JC 1EC5A 3IR9A 5AVWB 1LJ2A 3AE7C 3MUDC 1SS1A 1L0NJ 3P8CE 3O6QA 3G4SP 2QE7H 1DD4A 1Q82Q 3H32A 1BGYJ 1NOHA 5AVVB 2N1TA 2ITAA 1N7SC 3H1HJ 5APXA 1VQPP 1UIXA 1HF9A 1KV4A 3KPEA 1QL2A 4H13B 3B71A 3V2QA 2V7QH 1Q90D 3F89A 1NAFA 5KJ7A 1GK6A 2I8DA 2BCCG 2P7JA 2Y9ZA 1ZV8A 4K35A 3M0DA 3BVHA 1KB9D 3MHVA 5AW0B 1L4AD 2ZYDA 2E76C 2NPSB 4GT1A 1LWUC 3VMZA 2MKVA 2Q9IA 1FDMA 1G1IA 4WB4A 2QA4P 3HD7C 1VF5B 1JTHA 2G3AA 1KQLA 2R5BA 2IYPA 2I1JA 3L74J 1IJDB 1FZFA 1USDA 4Y99B 5CJ0A 2YO2A 1M7LA 3MTUE 1M57D 1X8YA 1N8RQ 4PD4I 3NFQA 1QGKB 3CX5D 2ZYAA 5KLVE 4H13D 2B87B 1NTZG 5GTHE 1FJPA 3KXDA 3U1AA 1LTBC 1S2EA 2JJLA 1K05A 2L5GB 1Y8AA 2WPRA 4PJ0H 5H2FH 3VMXA 2AEJA 1T2KD 3CX5I 1EQ7A 2XV5A 1AJYA 2Y9YA 1LTJA 3HE4B 1W2BO 3GHGA 4PV1C 2H8PD 4IOIH 3HTKA 1MFZA 1YI2P 4BRYB 1M56D 2JWDA 3I55P 1URQD 1EXJA 1NTKG 5AW5B 5GTIH 1LT9C 1OW7A 3HE5B 3L71J 4GODA 5AW3B 1YJNP 3RK2C 1L0LK 4KHXA 3GF7A 5CCGC 4Y99C 2WPSA 2WSEJ 2GM4A 1N86A 1W2EA 1AQ5A 2AXCA 1RQVA 1SQXJ 3A5TA 1JMBA 1VQ9P 2QSIA 4BXLA 2AXTH 3N4XA 4EYYQ 2O01N 1LWUA 2YO3A 3T97B 4H0LD 4D6TD 2E76B 4DCKA 2HODB 3A2AA 3A7OA 3G71P 1NKNA 2YXQB 1SQVJ 1G1JA 3KZIE 1NTMG 4PD4H 1NU1K 2I1KA 2BCCE 3WMM0 5KAIH 2XNDH 2CK3H 3CXHE 3H1KG 2WMMA 3V2RA 4YPCA 4EIJA 4WBAA 1IZNB 1L0LE 3CI9A 4EI2A 3P32A 2K9JA 3HUSA 1JOCA 2FYZA 2OTKE 1YJ9P 5CJ4A 2K3RA 2QVAA 2O1JA 2WSFH 1KMIZ 3L36A 3H1HE 4KT0J 3CWBJ 1G2CB 4M3LA 5BU5A 3NXSA 3H1IG 1M1KQ 2H89C 1M1JB 2VRSA 4UB6H 1LGHB 3CCMP 3II6A 3CC7P 1JUNA 1L0NE 5AVUB 4GIFA 1L2PA 3O8ZA 3L70E 5TJHA 1U57A 2E43A 3MZWB 2H88C 4N78D 2JP3A 2IX7C 3WU2E 2IFMA 2WVRA 1FBMA 1FZAA 2W6BA 3AEAC 3P7KA 1Q86Q 1NWQA 2HPCB 3AEBC 1FOSE 2GUSA 3H1JG 1FOSF 2KNCA 3FWNA 5AW9B 1KZUB 1Y47A 3H6PA 1JY2O 2YKPA 1JB0J 1VL2A 1NTKK 1T8ZA 3RK3B 1Z56A 5CCHC 2DW3A 4ZKUA 1ZN5A 3S4RA 1MKMA 2KIKA 1JM0A 1N73A 1KTMA 5CCHD 1LT1A 1PPJG 1RE3A 1VF5C 2BCCJ 2O1KA 1LTSC 3EQ2A 1KYOD 1UIIA 1HGZA 1N7LA 2QM8A 2QJYB 1SQVE 3UIAA 1E79H 1BE3J 1VF5D 2NPSC 3JC22 2WT7A 5AW8B 4IFDK 4L74A 1PGJA 3BRTB 2NPSD 5L8RJ 1OIPA 1WMKA 2BEQD 1HJ0A 3A0HE 3CCRP 4PJ0E 1H0TB 1SQXE 4L76A 3Q3DA 3L73G 2H7HA 1YQ3C 3HD7A 4H13C 4U3FJ 4I6MC 5APUA 3SFDC 1DEEG 1RHZB 4DT0A 3AEFC 3IAOA 2K37A 1JY3N 2ZXEB 3H1IJ 1SQQJ 2LR2A 3M91A 1TU3F 1KILE 2YNYA 4LC1A 1JY3P 1S5LE 2XU6A 3A0BH 5E79E 1LP1B 1HJBA 4YTPC 1KILB 3CCVP 1PPJE 1IFMA 1RF0A 2PGDA 3V4WA 2WSSH 1ZRTE 2V4HA 4UB8H 5APSA 3AE4C 1P84I 4PD4D 1OVVA 2N1TC 1SQVK 4WY4C 1T3JA 2YMYA 1FJKA 1GK4A 2YKOA 1GL2B 3TGUJ 4C7NB 1VQKP 1L0LD 1OVUA 3GHGB 4WY4D 2J58A 3AEEC 2Q6QA 4HYTB 1VPCA 2KLVA 3RGUA 3RK2D 1SQBE 3V2NA 1VQMP 1OW8A 3H1LG 3ZDMA 3OW2O 1WRGA 1PP9D 2FYNB 2FXOA 5CCGD 4NPDA 1KILA 3GG2A 3NTNA 2HFED 4ASVA 3CCEP 1FZCB 1VQ5P 1OWAA 2AEFA 1L0NG 1EZVG 2HR3A 5CCHA 1MZ9A 3BCCD 4XFJA 1IO4A 1VQ6P 3L70D 2FY8A 2E75C 2PRRA 2ZAEB 1BGYG 3CXHI 4H0LC 5B66E 3V5BA 1RE3C 4GOEA 3L74E 2A45I 1L0NK 2KSJA 4U3FE 1H8AA 2B9BA 3B8EB 4XA4A 1EZVI 2JO1A 4MN4C 1AVYA 4DZOA 1R8EA 1JY3O 1NTKD 1YTZI 2XDJA 3M9HA 4NPFX 4A7PA 1PP9J 2K9YA 2ZT9B 3U1CA 2OTLP 1A02J 2B87A 5AVYB 1JO5A 2KOGA 5KAIE 5KLVD 1K9MQ 4TLFA 2IYOA 2M3EA 1AQTA 2J5UA 3L74G 4HJGH 4D6TJ 4AUWA 1AFOA 4JBZA 1M90Q 1BGYE 1GMJA 1KYOH 2E74C 1CSBA 2E75B 2JKVA 2QIWA 3L75D 5CMZA 2WPVB 2R44A 1J1EC 1BCCD 1PV3A 1SQPE 2JR8A 1L4AA 1MUUA 1Y9BA 4H44D 1U7MA 2ZVNB 3V6IA 2ZT9D 3WUVA 2QEXP 2LXCB 2WPQA 2K9JB 2Y0EA 1LTIC 2PFXA 3USSA 1N7SD 3EWKA 2G8YA 3CPWO 2P1JA 2M8RA 2IBZG 4XE5B 3S1KA 2CPSA 2N1TB 1JNMA 3Q5SA 1SQPG 1L4AC 1R5SA 1JCCA 4JQ0D 3CWBE 1RE4C 4D6TE 1J1EB 1YJWP 1DX7A 3KHUA 1KILC 4I1LA 5BVZA 2W90A 1OXZA 3RK3D 3VN0A 1IFPA 2IBZI 3CD6P 1HGVA 2Y0CA 1S9KE 1NTZE 1PP9E 3TGUD 1BCCJ 1PL5A 1ZOYC 3L37A 1FZEA 3PH0A 3PLNA 2B88A 4K3AA 4Y28J 5KLVK 1SQXG 3CCQP 1RQUA 2Y0DA 3CCLP 1SQQG 1NTMJ 2WSCJ 1FC2C 4OH8B 4RKUJ 1BE3G 1J1DB 1USEA 3B5NA 3RK3E 3H1KJ 3V4QA 1MV8A 3FXDA 4U3FG 1HVVA 5K5GB 2Q5UA 2L91A 3EFFK 4HH2A 4LGDE 3LIEA 3M0DC 1LTJC 2GUVA 4IL6X 3RL0B 3U59A 3VYIA 1SVFA 1RF0C 3R2PA 5AW1B 1J2JB 5TISE 4JYBA 2FYUD 1CW5A 2FXPA 4DJGA 5KKZB 2O3JA 4N78E 4OGQB 3VOPA 1KYOI 1VQ8P 1QVGO 2M3BA 3PTZA 1RY3A 1SQBG 2KZJA 3B4SA 2WTYA 2P10A 2NPSA 5B66H 2R5DA 3O6QB 1HH0A 5KAFH 2Q3EA 5AW6B 2UWJE 1RF1B 4WY4B 3P8CD 3H1JJ 2Q1KA 3FGAD 1SQVD 1X22A 1ZMEC 3PJSK 3TNUB 2HLOA 2IBZE 1OW6A 3ITKA 3AE6C 2W6JH 1NU1E 3H1IE 3PRJA 5AW7B 3R4YA 3F5HA 1SQXK 2KXPB 2A45H 4IFFA 1QX8A 1NYHA 4NPEA 1NJIQ 3TK1A 3PP5A 3QH9A 1L0LG 2KLUA 2JWAA 5GTHH 4YXDC 1CI6B 2XKMA 3L73E 1T6AA 1KQGB 2NZ2A 3FWLA 3L71G 2OYIB 4IL6H 1NHLA 3LIDA 2KUBA 4JPZB 4JYCA 3B5ND 3CWBD 5CHXA 2M0BA 2KI7B 3B5NC 1K73Q 2QJYC 1GL2D 1EZVD 1VQ4P 1FU1A 5M1BA 2A06E 3M9BA 3E1RA 1KFNA 4GOFA 1EDLA 2BEZF 2IFNA 2YXRB 1H0TA 1KYOE 2KSEA 3OJAB 2Z5HA 1XTCC 1NTZK 3LW5J 2SPZA 3L35A 4JF7A 4GKGA 3TF5A 4N6JA 3RK2B 1A02F 2OTJP 2BCCD 1LT9B 3AE1C 5DJUB 3CXHD 2KZIA 2M5AA 3BATA 3RBXA 1MFTA 2P2UA 1GZLA 4YXWH 1SFCB 4U7JA 3L70J 4OWFA 1IFJA 4CPGA 1K04A 2D2CC 1T2KC 1ZLLA 2RH0A 1ZP0C 3AEGC 4WVZA 1EDJA 5KTBA 2C0XA 2WSCH 2D2CD 3H1HD 3H1LJ 3L74D 4KJMA 5EFWB 2OQQA 3I56P 2E42A 1KB9I 5AVXB 2WZ7A 1AA0A 4C7NA 3HTKB 4RESB 3SWFA 1KC8Q 1BCCG 1GDTA 1L0LJ 1ZR4A 3AE2C 2ZXXA 1NTMD 2FFDA 1EDIA 2OYIA 1DEBA 2W8ZA 4ASWA 5APQA 2FKWB 1URQB 3LW5H 2ZJSE 3H1KD 5B5EE 5AVQB 1Q7YQ 1OZHA 2FYUJ 1WT6A 1NU1D 1AVOA 3AE8C 2IBZD 2MJZA 2C9NY 1DD3A 3HD7B 4RO0A 3W67A 4ZNCA 2WWWA 2IZ0A 3H1ID 4RJTA 1SQPD 3SFEC 2YMKA 3B5NB 3L72J 2W6AA 1IFIA 3CCSP 4EOTA 1EXIA 2R3SA 3C1LA 1BSHA 2QG4A 3HE5A 3GF3A 4Z1MH 3MUDA 2Z4EA 3EFGA 4DOJA
chains in the Genus database with same CATH topology
2WMMA 2LXBA 2OTKE 3QWOC 2K3RA 2QVAA 1ZXGA 5C39A 4HB1A 4K3AA 3PH0A 2B88A 1U7JA 3FXEA 1FC2C 3MZWB 2QRXA 4ZMDA 2KS1B 3FXDA 5K5GB 1S3JA 1NVOA 1Q2NA 1Y47A 2KIKA 1JM0A 1LT1A 4HKZH 1LP1A 1BDDA 2KZJA 2P58A 2UWJE 2Q1KA 2RKLA 1X0TA 1H0TB 1BDCA 2B89A 4WWIA 1EC5A 1DEEG 1SS1A 2LR2A 1LP1B 4NPEA 2I8DA 1OVVA 4K35A 2KUBA 3MHVA 2M0BA 1OVUA 2KI7B 3RGUA 3ZDMA 4NPDA 4ASVA 1EDLA 4GOFA 5CBOA 1H0TA 2HR3A 2SPZA 2ZAEB 1ZW0A 5DJUB 2B87B 2KZIA 2M5AA 4GOEA 1MFTA 4CPGA 4MN4C 1EDJA 5EFWB 4KJMA 4NPFX 2B87A 4IOIH 2JWDA 4HJGH 1EDIA 4GODA 4JBZA 4ASWA 2R44A 1U7MA 1EDKA 2LXCB 4ZNCA 1JMBA 2M5AB 4BXLA 4EYYQ 1OVRA 5CBNA 5DJTB 3S1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMM A;  2LXB A;  2OTK E;  3QWO C;  2K3R A;  2QVA A;  1ZXG A;  5C39 A;  4HB1 A;  4K3A A;  3PH0 A;  2B88 A;  1U7J A;  3FXE A;  1FC2 C;  3MZW B;  2QRX A;  4ZMD A;  2KS1 B;  3FXD A;  5K5G B;  1S3J A;  1NVO A;  1Q2N A;  1Y47 A;  2KIK A;  1JM0 A;  1LT1 A;  4HKZ H;  1LP1 A;  1BDD A;  2KZJ A;  2P58 A;  2UWJ E;  2Q1K A;  2RKL A;  1X0T A;  1H0T B;  1BDC A;  2B89 A;  4WWI A;  1EC5 A;  1DEE G;  1SS1 A;  2LR2 A;  1LP1 B;  4NPE A;  2I8D A;  1OVV A;  4K35 A;  2KUB A;  3MHV A;  2M0B A;  1OVU A;  2KI7 B;  3RGU A;  3ZDM A;  4NPD A;  4ASV A;  1EDL A;  4GOF A;  5CBO A;  1H0T A;  2HR3 A;  2SPZ A;  2ZAE B;  1ZW0 A;  5DJU B;  2B87 B;  2KZI A;  2M5A A;  4GOE A;  1MFT A;  4CPG A;  4MN4 C;  1EDJ A;  5EFW B;  4KJM A;  4NPF X;  2B87 A;  4IOI H;  2JWD A;  4HJG H;  1EDI A;  4GOD A;  4JBZ A;  4ASW A;  2R44 A;  1U7M A;  1EDK A;  2LXC B;  4ZNC A;  1JMB A;  2M5A B;  4BXL A;  4EYY Q;  1OVR A;  5CBN A;  5DJT B;  3S1K A; 
#chains in the Genus database with same CATH topology
 3L71 E;  5AVR B;  4GDO A;  4IFM A;  4BRY A;  1URQ C;  1N7S B;  2LXB A;  3TYY A;  2WIT A;  3H1J D;  3QWO C;  4AYC A;  3HRN A;  1SQX D;  2PAJ A;  3L73 J;  1YHQ P;  1KN7 A;  3VMA A;  3V2P A;  3JCU H;  3WUU A;  1SP4 A;  1IC2 A;  1NO4 A;  1BE3 D;  2RN0 A;  3AEC C;  3IFM A;  4UB8 E;  4ZKP A;  2A06 D;  2R3C A;  4PV1 B;  5KAF E;  3HD7 D;  1U7J A;  4D6T G;  1NU1 J;  2OGU A;  3MIW A;  1OX3 A;  2E5T A;  2OAR A;  1M8O B;  2ZYG A;  3P8M C;  2JDI H;  4TT3 H;  1RF1 C;  1X79 B;  2QRX A;  2D2C B;  1GTW A;  5KLV J;  1FZB A;  2QJP B;  3H1J E;  3TNU A;  1LTA C;  1SFC C;  5AW2 B;  4C46 A;  1KB9 E;  4LLH A;  1NVO A;  1PZQ A;  1SFC D;  2KNC B;  2FYU K;  1GW3 A;  2E5Y A;  3L72 D;  4OGQ C;  1BSN A;  1QL1 A;  5GTI E;  3H25 A;  1SQB D;  1RH5 B;  1R5L A;  3RL0 D;  2YIU B;  1T3U A;  3E1I A;  1YBK A;  4AQR D;  1OMI A;  2ZVO B;  4HKZ H;  3RL0 C;  2GA1 A;  2RMZ A;  4PV1 D;  5TIS H;  1VQO P;  1KOR A;  1LP1 A;  1SQV G;  1PGQ A;  1IK7 A;  2HG5 D;  3MD0 A;  4N3Y B;  1LWU B;  1M1J A;  1S5L X;  3T97 A;  3SSU A;  2AXT E;  1JMM A;  2OYO A;  3L72 E;  1VQN P;  3H32 B;  1LNQ A;  2QJK C;  1OFC X;  1W5C E;  3H1K E;  2RKL A;  1FDO A;  3MP7 B;  1HWT C;  3CX5 H;  1FDI A;  1QVF O;  1RE4 A;  2B89 A;  1JEK A;  2FYU E;  2KS1 A;  4WWI A;  3W68 A;  5APY A;  3H1L D;  1S4X A;  1YTZ T;  1FS0 E;  1PP9 G;  4OVN F;  1E5W A;  2KP8 A;  1NKZ B;  2WT7 B;  3D6Z A;  5APW A;  3WUT A;  4WY4 A;  3RBZ A;  1FZC A;  3A3Y B;  1URQ A;  1NTZ J;  1H89 A;  1X9V A;  1YIJ P;  4I7Z C;  5KJ7 C;  3L70 G;  1HTL C;  1S72 P;  3CME P;  1L4A B;  1KIL D;  1BGY D;  3L75 E;  1YQ4 C;  5KJ7 D;  2PP6 A;  2Z5I A;  2W83 C;  1GL2 A;  2AEM A;  4O9B A;  1HUC A;  3I5C A;  3H1L E;  3L73 D;  2NRG A;  2XZR A;  3FX0 A;  2OYH C;  1SFC A;  3HUS B;  1NTM K;  3C9I A;  4W7Y A;  1YIT P;  1GU4 A;  2HPC A;  2FFD C;  1P84 D;  3AE9 C;  3GLM A;  3C8V A;  3G9R A;  3KDP B;  5KLI C;  2XNX A;  3S9O A;  5KKZ C;  3D71 A;  3IN6 A;  4L75 A;  2N9B A;  2WSE H;  2E74 D;  5CBO A;  1FZG A;  3RL0 g;  2KK7 A;  1VQL P;  1JCD A;  1GW4 A;  3CCJ P;  1S5L H;  4B86 A;  1N73 B;  4H44 C;  5AW4 B;  1LTJ B;  1SQP J;  1ZW0 A;  3HE4 A;  3H1H G;  2IPP A;  1KQS O;  3BCC E;  3G6E P;  1J1D C;  1Q81 Q;  3MGN A;  2J59 M;  3AED C;  2N1T D;  3CMA P;  1SQB K;  1NTZ D;  3CL3 D;  1KFM A;  1KD1 Q;  1PIX A;  1CZQ A;  1VDF A;  2POH A;  4BWN A;  1L0N D;  3BCC G;  1IFD A;  2HOD A;  1NTK E;  1ZRT D;  3AE3 C;  2WSF J;  5BU8 B;  1LT9 A;  1PGP A;  2E76 D;  2WQY C;  1KQF B;  1NU1 G;  3Q5R A;  5AVT B;  4H44 B;  1QLE D;  5E79 H;  3PHL A;  2LKM A;  3BAS A;  3OA7 A;  5CCG A;  5AVS B;  2HYN A;  1ZR2 A;  3M06 A;  2K1A A;  5KLI B;  2OYI C;  1EDK A;  2W27 A;  1DH3 A;  1SQQ K;  5B5E H;  2QM7 A;  3CC2 P;  3GW6 A;  3VMY A;  2M5A B;  1SLQ A;  3HUS C;  3KZI H;  4OGQ D;  5APT A;  2OYH B;  1OVR A;  5CBN A;  2C0W A;  3CCU P;  3N7N A;  1FE6 A;  3GHG C;  3CXH H;  5KLV G;  3KYQ A;  1SQB J;  5DJT B;  1JY2 N;  2FBW C;  3NMD A;  1SQQ D;  1KB9 H;  3L75 G;  3AE5 C;  2V7Q J;  3SWK A;  3BRV B;  1GD2 E;  1CI6 A;  3TGU E;  1PFI A;  4U3F D;  3VP9 A;  1NTK J;  3SWY A;  1N7S A;  2H43 A;  1DIP A;  2A06 G;  2E74 B;  2Q7C A;  1NH4 A;  3A0B E;  1SQP K;  4UB6 E;  2R32 A;  3GMA A;  5H2F E;  2OYH A;  2C9L Y;  1ZXG A;  1P84 E;  1NAY A;  5C39 A;  3Q1M A;  4HB1 A;  4IL6 E;  1LTT C;  2FXM A;  2FYU G;  1SQQ E;  2ZT9 C;  3L4F A;  3JCU E;  4W80 A;  1P84 H;  3WU2 H;  5AVZ B;  1HBW A;  3Q5P A;  2QJK B;  3BCC J;  2KYV A;  4R4M A;  3FXE A;  1NTM E;  2P67 A;  4EDF A;  3VTP C;  2IZ1 A;  2KB7 P;  3K5B A;  3KQG A;  3L72 G;  2O01 J;  3VP8 A;  4ZMD A;  3D70 A;  2KS1 B;  3G3Z A;  3CX5 E;  2IDB A;  4PD4 E;  1PGO A;  1IFN A;  1XTG B;  3OAK A;  2E75 D;  1NGM B;  1BCC E;  1S3J A;  1VQ7 P;  2JEE A;  1FAV A;  4H0L B;  1D7M A;  1Q2N A;  1H88 A;  1BE3 E;  2A45 G;  1N73 C;  4I2L C;  2BAS A;  3TGU G;  3IF4 A;  1EZV E;  2N9Y B;  2YIU C;  2YKQ A;  4C7R A;  1RF1 A;  2ZFC A;  3RK3 C;  1FZC C;  3M9Q A;  1LTG C;  3CLQ A;  2FYN C;  1YYC A;  2FFD B;  1G2C A;  3JSV C;  1IK9 A;  4R4L A;  3TSI A;  1BDD A;  1QEX A;  1S1C X;  3CC4 P;  1AV1 A;  2CPB A;  3A0H H;  1N2D C;  4QMA A;  2QJP C;  2O01 H;  2P58 A;  3L71 D;  3L75 J;  1JTH B;  1JY2 P;  1GL2 C;  1PPJ D;  2Q3I A;  1GU5 A;  3E7K A;  1K8A Q;  3M0A A;  2K88 A;  3TDK A;  4L73 A;  3CWB G;  3Q2Y A;  3D6Y A;  1X0T A;  5APV A;  1BDC A;  4W7Z A;  4I7Z B;  3ABV C;  1S9K D;  1M1J C;  1EC5 A;  3IR9 A;  5AVW B;  1LJ2 A;  3AE7 C;  3MUD C;  1SS1 A;  1L0N J;  3P8C E;  3O6Q A;  3G4S P;  2QE7 H;  1DD4 A;  1Q82 Q;  3H32 A;  1BGY J;  1NOH A;  5AVV B;  2N1T A;  2ITA A;  1N7S C;  3H1H J;  5APX A;  1VQP P;  1UIX A;  1HF9 A;  1KV4 A;  3KPE A;  1QL2 A;  4H13 B;  3B71 A;  3V2Q A;  2V7Q H;  1Q90 D;  3F89 A;  1NAF A;  5KJ7 A;  1GK6 A;  2I8D A;  2BCC G;  2P7J A;  2Y9Z A;  1ZV8 A;  4K35 A;  3M0D A;  3BVH A;  1KB9 D;  3MHV A;  5AW0 B;  1L4A D;  2ZYD A;  2E76 C;  2NPS B;  4GT1 A;  1LWU C;  3VMZ A;  2MKV A;  2Q9I A;  1FDM A;  1G1I A;  4WB4 A;  2QA4 P;  3HD7 C;  1VF5 B;  1JTH A;  2G3A A;  1KQL A;  2R5B A;  2IYP A;  2I1J A;  3L74 J;  1IJD B;  1FZF A;  1USD A;  4Y99 B;  5CJ0 A;  2YO2 A;  1M7L A;  3MTU E;  1M57 D;  1X8Y A;  1N8R Q;  4PD4 I;  3NFQ A;  1QGK B;  3CX5 D;  2ZYA A;  5KLV E;  4H13 D;  2B87 B;  1NTZ G;  5GTH E;  1FJP A;  3KXD A;  3U1A A;  1LTB C;  1S2E A;  2JJL A;  1K05 A;  2L5G B;  1Y8A A;  2WPR A;  4PJ0 H;  5H2F H;  3VMX A;  2AEJ A;  1T2K D;  3CX5 I;  1EQ7 A;  2XV5 A;  1AJY A;  2Y9Y A;  1LTJ A;  3HE4 B;  1W2B O;  3GHG A;  4PV1 C;  2H8P D;  4IOI H;  3HTK A;  1MFZ A;  1YI2 P;  4BRY B;  1M56 D;  2JWD A;  3I55 P;  1URQ D;  1EXJ A;  1NTK G;  5AW5 B;  5GTI H;  1LT9 C;  1OW7 A;  3HE5 B;  3L71 J;  4GOD A;  5AW3 B;  1YJN P;  3RK2 C;  1L0L K;  4KHX A;  3GF7 A;  5CCG C;  4Y99 C;  2WPS A;  2WSE J;  2GM4 A;  1N86 A;  1W2E A;  1AQ5 A;  2AXC A;  1RQV A;  1SQX J;  3A5T A;  1JMB A;  1VQ9 P;  2QSI A;  4BXL A;  2AXT H;  3N4X A;  4EYY Q;  2O01 N;  1LWU A;  2YO3 A;  3T97 B;  4H0L D;  4D6T D;  2E76 B;  4DCK A;  2HOD B;  3A2A A;  3A7O A;  3G71 P;  1NKN A;  2YXQ B;  1SQV J;  1G1J A;  3KZI E;  1NTM G;  4PD4 H;  1NU1 K;  2I1K A;  2BCC E;  3WMM 0;  5KAI H;  2XND H;  2CK3 H;  3CXH E;  3H1K G;  2WMM A;  3V2R A;  4YPC A;  4EIJ A;  4WBA A;  1IZN B;  1L0L E;  3CI9 A;  4EI2 A;  3P32 A;  2K9J A;  3HUS A;  1JOC A;  2FYZ A;  2OTK E;  1YJ9 P;  5CJ4 A;  2K3R A;  2QVA A;  2O1J A;  2WSF H;  1KMI Z;  3L36 A;  3H1H E;  4KT0 J;  3CWB J;  1G2C B;  4M3L A;  5BU5 A;  3NXS A;  3H1I G;  1M1K Q;  2H89 C;  1M1J B;  2VRS A;  4UB6 H;  1LGH B;  3CCM P;  3II6 A;  3CC7 P;  1JUN A;  1L0N E;  5AVU B;  4GIF A;  1L2P A;  3O8Z A;  3L70 E;  5TJH A;  1U57 A;  2E43 A;  3MZW B;  2H88 C;  4N78 D;  2JP3 A;  2IX7 C;  3WU2 E;  2IFM A;  2WVR A;  1FBM A;  1FZA A;  2W6B A;  3AEA C;  3P7K A;  1Q86 Q;  1NWQ A;  2HPC B;  3AEB C;  1FOS E;  2GUS A;  3H1J G;  1FOS F;  2KNC A;  3FWN A;  5AW9 B;  1KZU B;  1Y47 A;  3H6P A;  1JY2 O;  2YKP A;  1JB0 J;  1VL2 A;  1NTK K;  1T8Z A;  3RK3 B;  1Z56 A;  5CCH C;  2DW3 A;  4ZKU A;  1ZN5 A;  3S4R A;  1MKM A;  2KIK A;  1JM0 A;  1N73 A;  1KTM A;  5CCH D;  1LT1 A;  1PPJ G;  1RE3 A;  1VF5 C;  2BCC J;  2O1K A;  1LTS C;  3EQ2 A;  1KYO D;  1UII A;  1HGZ A;  1N7L A;  2QM8 A;  2QJY B;  1SQV E;  3UIA A;  1E79 H;  1BE3 J;  1VF5 D;  2NPS C;  3JC2 2;  2WT7 A;  5AW8 B;  4IFD K;  4L74 A;  1PGJ A;  3BRT B;  2NPS D;  5L8R J;  1OIP A;  1WMK A;  2BEQ D;  1HJ0 A;  3A0H E;  3CCR P;  4PJ0 E;  1H0T B;  1SQX E;  4L76 A;  3Q3D A;  3L73 G;  2H7H A;  1YQ3 C;  3HD7 A;  4H13 C;  4U3F J;  4I6M C;  5APU A;  3SFD C;  1DEE G;  1RHZ B;  4DT0 A;  3AEF C;  3IAO A;  2K37 A;  1JY3 N;  2ZXE B;  3H1I J;  1SQQ J;  2LR2 A;  3M91 A;  1TU3 F;  1KIL E;  2YNY A;  4LC1 A;  1JY3 P;  1S5L E;  2XU6 A;  3A0B H;  5E79 E;  1LP1 B;  1HJB A;  4YTP C;  1KIL B;  3CCV P;  1PPJ E;  1IFM A;  1RF0 A;  2PGD A;  3V4W A;  2WSS H;  1ZRT E;  2V4H A;  4UB8 H;  5APS A;  3AE4 C;  1P84 I;  4PD4 D;  1OVV A;  2N1T C;  1SQV K;  4WY4 C;  1T3J A;  2YMY A;  1FJK A;  1GK4 A;  2YKO A;  1GL2 B;  3TGU J;  4C7N B;  1VQK P;  1L0L D;  1OVU A;  3GHG B;  4WY4 D;  2J58 A;  3AEE C;  2Q6Q A;  4HYT B;  1VPC A;  2KLV A;  3RGU A;  3RK2 D;  1SQB E;  3V2N A;  1VQM P;  1OW8 A;  3H1L G;  3ZDM A;  3OW2 O;  1WRG A;  1PP9 D;  2FYN B;  2FXO A;  5CCG D;  4NPD A;  1KIL A;  3GG2 A;  3NTN A;  2HFE D;  4ASV A;  3CCE P;  1FZC B;  1VQ5 P;  1OWA A;  2AEF A;  1L0N G;  1EZV G;  2HR3 A;  5CCH A;  1MZ9 A;  3BCC D;  4XFJ A;  1IO4 A;  1VQ6 P;  3L70 D;  2FY8 A;  2E75 C;  2PRR A;  2ZAE B;  1BGY G;  3CXH I;  4H0L C;  5B66 E;  3V5B A;  1RE3 C;  4GOE A;  3L74 E;  2A45 I;  1L0N K;  2KSJ A;  4U3F E;  1H8A A;  2B9B A;  3B8E B;  4XA4 A;  1EZV I;  2JO1 A;  4MN4 C;  1AVY A;  4DZO A;  1R8E A;  1JY3 O;  1NTK D;  1YTZ I;  2XDJ A;  3M9H A;  4NPF X;  4A7P A;  1PP9 J;  2K9Y A;  2ZT9 B;  3U1C A;  2OTL P;  1A02 J;  2B87 A;  5AVY B;  1JO5 A;  2KOG A;  5KAI E;  5KLV D;  1K9M Q;  4TLF A;  2IYO A;  2M3E A;  1AQT A;  2J5U A;  3L74 G;  4HJG H;  4D6T J;  4AUW A;  1AFO A;  4JBZ A;  1M90 Q;  1BGY E;  1GMJ A;  1KYO H;  2E74 C;  1CSB A;  2E75 B;  2JKV A;  2QIW A;  3L75 D;  5CMZ A;  2WPV B;  2R44 A;  1J1E C;  1BCC D;  1PV3 A;  1SQP E;  2JR8 A;  1L4A A;  1MUU A;  1Y9B A;  4H44 D;  1U7M A;  2ZVN B;  3V6I A;  2ZT9 D;  3WUV A;  2QEX P;  2LXC B;  2WPQ A;  2K9J B;  2Y0E A;  1LTI C;  2PFX A;  3USS A;  1N7S D;  3EWK A;  2G8Y A;  3CPW O;  2P1J A;  2M8R A;  2IBZ G;  4XE5 B;  3S1K A;  2CPS A;  2N1T B;  1JNM A;  3Q5S A;  1SQP G;  1L4A C;  1R5S A;  1JCC A;  4JQ0 D;  3CWB E;  1RE4 C;  4D6T E;  1J1E B;  1YJW P;  1DX7 A;  3KHU A;  1KIL C;  4I1L A;  5BVZ A;  2W90 A;  1OXZ A;  3RK3 D;  3VN0 A;  1IFP A;  2IBZ I;  3CD6 P;  1HGV A;  2Y0C A;  1S9K E;  1NTZ E;  1PP9 E;  3TGU D;  1BCC J;  1PL5 A;  1ZOY C;  3L37 A;  1FZE A;  3PH0 A;  3PLN A;  2B88 A;  4K3A A;  4Y28 J;  5KLV K;  1SQX G;  3CCQ P;  1RQU A;  2Y0D A;  3CCL P;  1SQQ G;  1NTM J;  2WSC J;  1FC2 C;  4OH8 B;  4RKU J;  1BE3 G;  1J1D B;  1USE A;  3B5N A;  3RK3 E;  3H1K J;  3V4Q A;  1MV8 A;  3FXD A;  4U3F G;  1HVV A;  5K5G B;  2Q5U A;  2L91 A;  3EFF K;  4HH2 A;  4LGD E;  3LIE A;  3M0D C;  1LTJ C;  2GUV A;  4IL6 X;  3RL0 B;  3U59 A;  3VYI A;  1SVF A;  1RF0 C;  3R2P A;  5AW1 B;  1J2J B;  5TIS E;  4JYB A;  2FYU D;  1CW5 A;  2FXP A;  4DJG A;  5KKZ B;  2O3J A;  4N78 E;  4OGQ B;  3VOP A;  1KYO I;  1VQ8 P;  1QVG O;  2M3B A;  3PTZ A;  1RY3 A;  1SQB G;  2KZJ A;  3B4S A;  2WTY A;  2P10 A;  2NPS A;  5B66 H;  2R5D A;  3O6Q B;  1HH0 A;  5KAF H;  2Q3E A;  5AW6 B;  2UWJ E;  1RF1 B;  4WY4 B;  3P8C D;  3H1J J;  2Q1K A;  3FGA D;  1SQV D;  1X22 A;  1ZME C;  3PJS K;  3TNU B;  2HLO A;  2IBZ E;  1OW6 A;  3ITK A;  3AE6 C;  2W6J H;  1NU1 E;  3H1I E;  3PRJ A;  5AW7 B;  3R4Y A;  3F5H A;  1SQX K;  2KXP B;  2A45 H;  4IFF A;  1QX8 A;  1NYH A;  4NPE A;  1NJI Q;  3TK1 A;  3PP5 A;  3QH9 A;  1L0L G;  2KLU A;  2JWA A;  5GTH H;  4YXD C;  1CI6 B;  2XKM A;  3L73 E;  1T6A A;  1KQG B;  2NZ2 A;  3FWL A;  3L71 G;  2OYI B;  4IL6 H;  1NHL A;  3LID A;  2KUB A;  4JPZ B;  4JYC A;  3B5N D;  3CWB D;  5CHX A;  2M0B A;  2KI7 B;  3B5N C;  1K73 Q;  2QJY C;  1GL2 D;  1EZV D;  1VQ4 P;  1FU1 A;  5M1B A;  2A06 E;  3M9B A;  3E1R A;  1KFN A;  4GOF A;  1EDL A;  2BEZ F;  2IFN A;  2YXR B;  1H0T A;  1KYO E;  2KSE A;  3OJA B;  2Z5H A;  1XTC C;  1NTZ K;  3LW5 J;  2SPZ A;  3L35 A;  4JF7 A;  4GKG A;  3TF5 A;  4N6J A;  3RK2 B;  1A02 F;  2OTJ P;  2BCC D;  1LT9 B;  3AE1 C;  5DJU B;  3CXH D;  2KZI A;  2M5A A;  3BAT A;  3RBX A;  1MFT A;  2P2U A;  1GZL A;  4YXW H;  1SFC B;  4U7J A;  3L70 J;  4OWF A;  1IFJ A;  4CPG A;  1K04 A;  2D2C C;  1T2K C;  1ZLL A;  2RH0 A;  1ZP0 C;  3AEG C;  4WVZ A;  1EDJ A;  5KTB A;  2C0X A;  2WSC H;  2D2C D;  3H1H D;  3H1L J;  3L74 D;  4KJM A;  5EFW B;  2OQQ A;  3I56 P;  2E42 A;  1KB9 I;  5AVX B;  2WZ7 A;  1AA0 A;  4C7N A;  3HTK B;  4RES B;  3SWF A;  1KC8 Q;  1BCC G;  1GDT A;  1L0L J;  1ZR4 A;  3AE2 C;  2ZXX A;  1NTM D;  2FFD A;  1EDI A;  2OYI A;  1DEB A;  2W8Z A;  4ASW A;  5APQ A;  2FKW B;  1URQ B;  3LW5 H;  2ZJS E;  3H1K D;  5B5E E;  5AVQ B;  1Q7Y Q;  1OZH A;  2FYU J;  1WT6 A;  1NU1 D;  1AVO A;  3AE8 C;  2IBZ D;  2MJZ A;  2C9N Y;  1DD3 A;  3HD7 B;  4RO0 A;  3W67 A;  4ZNC A;  2WWW A;  2IZ0 A;  3H1I D;  4RJT A;  1SQP D;  3SFE C;  2YMK A;  3B5N B;  3L72 J;  2W6A A;  1IFI A;  3CCS P;  4EOT A;  1EXI A;  2R3S A;  3C1L A;  1BSH A;  2QG4 A;  3HE5 A;  3GF3 A;  4Z1M H;  3MUD A;  2Z4E A;  3EFG A;  4DOJ A; 
#chains in the Genus database with same CATH homology
 2WMM A;  2LXB A;  2OTK E;  3QWO C;  2K3R A;  2QVA A;  1ZXG A;  5C39 A;  4HB1 A;  4K3A A;  3PH0 A;  2B88 A;  1U7J A;  3FXE A;  1FC2 C;  3MZW B;  2QRX A;  4ZMD A;  2KS1 B;  3FXD A;  5K5G B;  1S3J A;  1NVO A;  1Q2N A;  1Y47 A;  2KIK A;  1JM0 A;  1LT1 A;  4HKZ H;  1LP1 A;  1BDD A;  2KZJ A;  2P58 A;  2UWJ E;  2Q1K A;  2RKL A;  1X0T A;  1H0T B;  1BDC A;  2B89 A;  4WWI A;  1EC5 A;  1DEE G;  1SS1 A;  2LR2 A;  1LP1 B;  4NPE A;  2I8D A;  1OVV A;  4K35 A;  2KUB A;  3MHV A;  2M0B A;  1OVU A;  2KI7 B;  3RGU A;  3ZDM A;  4NPD A;  4ASV A;  1EDL A;  4GOF A;  5CBO A;  1H0T A;  2HR3 A;  2SPZ A;  2ZAE B;  1ZW0 A;  5DJU B;  2B87 B;  2KZI A;  2M5A A;  4GOE A;  1MFT A;  4CPG A;  4MN4 C;  1EDJ A;  5EFW B;  4KJM A;  4NPF X;  2B87 A;  4IOI H;  2JWD A;  4HJG H;  1EDI A;  4GOD A;  4JBZ A;  4ASW A;  2R44 A;  1U7M A;  1EDK A;  2LXC B;  4ZNC A;  1JMB A;  2M5A B;  4BXL A;  4EYY Q;  1OVR A;  5CBN A;  5DJT B;  3S1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...