5EFXA

Crystal structure of rho gtpase regulator
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
144
structure length
144
Chain Sequence
GARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 2
publication title Crystal structure of hGEF-H1 PH domain provides insight into incapability in phosphoinositide binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 36
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5efxA00
2DHKA 2KGXB 3QWMA 3KSYA 1E5WA 1P3RA 3A8QA 4DX90 5HE0A 1WVHA 5JLJB 3KRXA 1V5UA 4EKUA 3P6AA 1MPHA 1UNPA 3MPXA 2RUKB 5CLQB 2COCA 4IFSA 4WSFA 3T06A 2HTHB 1BTNA 3RCPA 2IYBA 3CIKA 1WI1A 5L81A 2PZ1A 3CXBB 2VKIA 2Z0PA 2ZPYA 3FM8C 1W1HA 3G9WA 3TW1A 1N3HA 4DXAB 3PVWA 4DBBA 2I1KA 2DN6A 2D9ZA 1SHCA 2EMTA 4K81A 4KHOA 5GOWB 4MT7A 2EMSA 1U29A 2N23A 4GXBA 3FEHA 2N0YA 3PP2A 5JHGA 2UZRA 1EF1A 2DX1A 4Z2NA 1ISNA 2DHIA 4K17A 5KCVA 4A6HA 3ULBA 3WA0A 2OTXA 5DHFB 1GC6A 1FHXA 2Y8FA 3SO6A 2L1CA 2DHJA 4XWXA 3MDBC 2I5CA 5J3YA 1U5GA 2GCJA 3BINA 3D8DA 4KHAA 4HB3B 2H7DA 1UPQA 1TJ6A 1ZC4B 2D9YA 2COFA 4MY6A 4CYEA 1NTVA 4HATB 5C6RA 1PMSA 3ODXA 2IFSA 2I1JA 5C79A 3GYPA 4P7IA 2ROVA 4IOYX 3TCAA 2Z0QA 1NTYA 1V88A 2YRYA 1W1DA 2LKOA 4KVGB 5KQ4A 3ULCA 2ELBA 3AJ4A 2MKRA 4WVFB 5DH9B 2CODA 3O96A 4KHBB 2UZSA 1MK9B 1DROA 2YVCA 3QIJA 2DKQA 1WGQA 2FJLA 5D3WA 1MIZB 3HQCA 2YT1A 2EC1A 2YS3A 3BJIA 1WG7A 5DHAB 3TFMA 2BCJA 1XCGA 3F0WA 4GZUA 5EFXA 1UPRA 2DFKA 4GN1A 2COAA 2LULA 3PVUA 4A5KA 4NY0A 3AU4A 3QBVB 1Z87A 1DDVA 4B6HA 2P0HA 4HAYB 3PEGA 2YT0A 3DXDA 4HAXB 3D8EA 2YS5A 4ZRKA 1UEFA 1I7AA 1KZ7A 3U7DA 1LW3A 1ZVRA 2NMBA 4TKNA 2VSZA 2J0KA 5HE1A 4EMOA 1H10A 1EGXA 1V5MA 1P5TA 2L2IA 1DDWA 4KAXB 2ELAA 2XQNM 4GMVA 4HDOA 4L6EA 4PQ0A 1U5EA 5DI9B 1J19A 1X1GA 2CAYA 2RSGA 4HB4B 4EJNA 2YS1A 1GG3A 5J3QA 2KUPA 4H8SA 3PG7A 5DIFB 5LOPB 3ODWA 2J0MA 1FAOA 4HAVB 4Z2MB 1XODA 2LG1A 2M14A 2RNRB 4HHVA 4HB0B 2YSZA 3KZ1A 4Y94A 1K5DB 1M7RA 2J59M 1U5DA 1WJMA 2UVMA 1UNQA 3LJUX 2LOXA 3SUZA 3NSUA 1U5FA 2QKMA 4TYZA 3TO1A 3VIAA 2K2JA 1Y19B 2DX5A 5FI0A 5LONB 3A98B 1MKEA 1DDMA 1PLSA 2KCJA 1M7EA 1V89A 2RLOA 2P0DA 4HAUB 2D9XA 2RGNB 3KRWA 1TXDA 1X05A 4MK0A 2JP2A 2D11A 1B55A 2K00A 2W2XC 2D9WA 1NI2A 2ROZB 3GYOA 3N7CA 1NU2A 2RVBB 5D3VA 1UNRA 2DYQA 2DA0A 3PZDA 1FOEA 4DX8A 1WJ1A 3UZTA 2CRFA 5C5BA 3V5WA 1V61A 1V5PA 2DKPA 2I5FA 4YL8A 1RJ2A 1DBHA 4BBKA 1FHWA 2R09A 4IAPA 4C0AA 1LB1A 2GS0A 4NSWA 1DYNA 1OY2A 3X23A 2MDXA 2LOZA 1EVHA 3DXEA 4K2OA 1EAZA 4ZRJA 2M38A 4WJ7A 2HE7A 5J3TA 3SNHA 3PSCA 2CY4A 1MIXA 1QQGA 1FGYA 2VRWB 3F5RA 4D0NB 1BAKA 3SV1A 4CHJA 1XR0B 1Q67A 1ZC3B 4GPTB 1GC7A 3A8PA 4A6FA 1U2BA 2X18A 3ODOA 4YONA 2MWNB 5KQ1A 1AQCA 5D27A 1K5GB 4HAZB 1BTKA 1W1GA 2CY5A 2Q13A 5C5BB 1MAIA 3VOQA 5D3XA 2J0JA 2D9VA 1TQZA 4PNKA 3D8FA 2W2WA 5JP4A 3TVVA 2QKLA 2GCLA 2LYDA 2G35A 3SYXA 1XX0A 2OQBA 3IVFA 1SGHA 1QC6A 2P0FA 3FSSA 2DYNA 3PVLA 3M1IB 1P6SA 2AEHA 5HE2A 1H4RA 5FI1A 3ZVRA 3P7ZA 2ADZA 4K2PA 2Y8GA 5C16A 2D2QA 1OQNA 2W2XD 3AU5A 2D4QA 1U27A 4HDQA 4CHMA 3OANA 3ZDTA 1I2HA 1AWEA 4A6FB 4F7UP 1RRPB 2R0DA 3U8ZA 2NZ8B 3HW2B 2YF0A 1FGZA 1XD4A 1ZM0A 4HAWB 2E2XA 1MK7B 3HK0A 1X11A 2P8VA 1OMWA 1FB8A 2V76A 1KI1B 1IRSA 3WYFB 1XKEA 1PFJA 4HB2B 2DLWA 2MFQA 2H7EA 2D10A 2Y7BA 4F7GA 5CLLB 3ML4A 1FHOA 2Z0OA 2K2UA 3KY9A 1KZGA 3DXCA 5D3YA 1X86A 4ZRIA 2DTCA 2GJYA 5JHHA 4GMXB 2AL6A 1WGUA 1Y5OA 4F7HA 1BWNA 4A6KA 2EJ8A 1ZSQA 5HE3A 1J0WA 1X1FA
chains in the Genus database with same CATH superfamily
2DHKA 2KGXB 2YT2A 3QWMA 3KSYA 1E5WA 1P3RA 3A8QA 4DX90 2KIGA 1MI1A 2ZKMX 5HE0A 1WVHA 5JLJB 3KRXA 1V5UA 4EKUA 3P6AA 1MPHA 1UNPA 3MPXA 2RUKB 5CLQB 2COCA 2RRFA 4IFSA 4WSFA 3T06A 2HTHB 1BTNA 3RCPA 2IYBA 3CIKA 1WI1A 5L81A 2PZ1A 3CXBB 2VKIA 2Z0PA 2ZPYA 3FM8C 1W1HA 3G9WA 2Z13A 3TW1A 1N3HA 4DXAB 3PVWA 4DBBA 2I1KA 2DN6A 2D9ZA 1SHCA 2EMTA 4K81A 4KHOA 5GOWB 4KHBA 4MT7A 2EMSA 1U29A 2N23A 4GNKB 4GXBA 3FEHA 2N0YA 3PP2A 5JHGA 2UZRA 1EF1A 2DX1A 4Z2NA 1ISNA 2DHIA 4K17A 5KCVA 4A6HA 3ULBA 3WA0A 2OTXA 5DHFB 4DIXA 1GC6A 1FHXA 2Y8FA 3SO6A 2L1CA 2DHJA 3NWAA 4XWXA 3MDBC 2I5CA 5J3YA 1U5GA 2GCJA 3BINA 3D8DA 4KHAA 4HB3B 2H7DA 1UPQA 1TJ6A 1ZC4B 2D9YA 2COFA 4MY6A 4CYEA 1NTVA 4HATB 5C6RA 1PMSA 3ODXA 2IFSA 2I1JA 5C79A 3GYPA 4P7IA 2ROVA 4IOYX 3TCAA 2Z0QA 1NTYA 1V88A 2YRYA 1W1DA 2LKOA 4KVGB 5KQ4A 3ULCA 2ELBA 3AJ4A 2MKRA 4WVFB 5DH9B 2CODA 3O96A 4KHBB 2UZSA 1MK9B 1DROA 2YVCA 3QIJA 2DKQA 1WGQA 2FJLA 2KR0A 5D3WA 1MIZB 3HQCA 2YT1A 2EC1A 2YS3A 3OHMB 4HSIA 3BJIA 1WG7A 5DHAB 3TFMA 2BCJA 1XCGA 3F0WA 4GZUA 5EFXA 1UPRA 2DFKA 4GN1A 2COAA 2LULA 3PVUA 3NWDA 4A5KA 4OT1A 4NY0A 3AU4A 3QBVB 1Z87A 1DDVA 5M4YB 4B6HA 2P0HA 4HAYB 3PEGA 2YT0A 3DXDA 4HAXB 3D8EA 2YS5A 4ZRKA 1UEFA 1I7AA 1KZ7A 3U7DA 1LW3A 4L1RA 1ZVRA 2NMBA 4TKNA 2VSZA 2J0KA 5HE1A 4EMOA 1H10A 2FJUB 1EGXA 1V5MA 1P5TA 2L2IA 1DDWA 4KAXB 2ELAA 4GOUA 2XQNM 4GMVA 4HDOA 4L6EA 4PQ0A 1U5EA 5DI9B 1J19A 1X1GA 2CAYA 2RSGA 4HB4B 4EJNA 2YS1A 1GG3A 5J3QA 3HIEA 2KUPA 4H8SA 3PG7A 5DIFB 5LOPB 3ODWA 2Z4DA 2J0MA 1FAOA 4HAVB 4Z2MB 1XODA 2LG1A 2M14A 2RNRB 4HHVA 4HB0B 2YSZA 3KZ1A 4Y94A 1K5DB 1M7RA 2J59M 1U5DA 1WJMA 2UVMA 1UNQA 3LJUX 2LOXA 3SUZA 2NBVA 3NSUA 1U5FA 2QKMA 4TYZA 3TO1A 3VIAA 2K2JA 1Y19B 2DX5A 5FI0A 5LONB 3A98B 1MKEA 1DDMA 1PLSA 2KCJA 1M7EA 1V89A 2RLOA 5I2MA 2P0DA 4HAUB 2D9XA 2RGNB 3KRWA 1TXDA 1X05A 4MK0A 2JP2A 2D11A 1B55A 2K00A 2W2XC 2D9WA 1NI2A 2ROZB 3GYOA 3N7CA 1NU2A 2RVBB 4QJ5B 5D3VA 2GUMA 1UNRA 2DYQA 1T77A 2DA0A 3PZDA 1FOEA 4DX8A 1WJ1A 3UZTA 2CRFA 5C5BA 3V5WA 1V61A 1V5PA 2DKPA 4QXAB 2I5FA 4YL8A 1RJ2A 1DBHA 4BBKA 1FHWA 2R09A 4IAPA 3B77A 4C0AA 1LB1A 2GS0A 4NSWA 1DYNA 1OY2A 3X23A 2Z59A 2KUQA 2MDXA 2LOZA 1EVHA 3DXEA 4K2OA 1EAZA 4ZRJA 2M38A 4WJ7A 2HE7A 5J3TA 3SNHA 2R2YA 2CY4A 3FVCA 3PSCA 1MIXA 1QQGA 1FGYA 2VRWB 3F5RA 4D0NB 1BAKA 3HSAA 3SV1A 4CHJA 1XR0B 1Q67A 1ZC3B 4GPTB 1GC7A 3A8PA 4A6FA 1U2BA 2X18A 3ODOA 4YONA 2MWNB 5KQ1A 1AQCA 5D27A 1ZYIA 3DCXA 1K5GB 4HAZB 1BTKA 1W1GA 2CY5A 4QJ3B 2Q13A 5C5BB 2Z14A 1MAIA 3VOQA 5IRSA 5D3XA 2J0JA 2D9VA 1TQZA 4PNKA 3D8FA 2W2WA 5JP4A 3TVVA 2QKLA 2GCLA 2LYDA 2G35A 3SYXA 1XX0A 2OQBA 3IVFA 1SGHA 1QC6A 2P0FA 3FSSA 2DYNA 3PVLA 3M1IB 1P6SA 2AEHA 5HE2A 1H4RA 5FI1A 3ZVRA 3P7ZA 2ADZA 4K2PA 2Y8GA 5C16A 4CSQA 2D2QA 1OQNA 2W2XD 3AU5A 2D4QA 1U27A 4HDQA 4CHMA 3OANA 3ZDTA 1I2HA 5LG4B 4OSNA 1AWEA 4A6FB 3NWFA 4QJ4B 4F7UP 1RRPB 2R0DA 3U8ZA 2NZ8B 3HW2B 2YF0A 1FGZA 1XD4A 1ZM0A 4HAWB 2E2XA 1MK7B 3HK0A 1X11A 2P8VA 3A58A 1OMWA 1FB8A 2V76A 1KI1B 1IRSA 5I2SA 3WYFB 1XKEA 1PFJA 4HB2B 2DLWA 2MFQA 2H7EA 2D10A 2Y7BA 3NW8A 4F7GA 2KIEA 2K49A 5CLLB 4D6WA 3ML4A 1FHOA 2Z0OA 2K2UA 2K8EA 3KY9A 1KZGA 3DXCA 5D3YA 1X86A 4ZRIA 2DTCA 2GJYA 5JHHA 4GMXB 2AL6A 1WGUA 1Y5OA 4F7HA 1BWNA 4A6KA 3U12A 2EJ8A 1ZSQA 5HE3A 1J0WA 1X1FA
chains in the Genus database with same CATH topology
2DHKA 2KGXB 3QWMA 3KSYA 1E5WA 1P3RA 3A8QA 4DX90 5HE0A 1WVHA 5JLJB 3KRXA 1V5UA 4EKUA 3P6AA 1MPHA 1UNPA 3MPXA 2RUKB 5CLQB 2COCA 4IFSA 4WSFA 3T06A 2HTHB 1BTNA 3RCPA 2IYBA 3CIKA 1WI1A 5L81A 2PZ1A 3CXBB 2VKIA 2Z0PA 2ZPYA 3FM8C 1W1HA 3G9WA 3TW1A 1N3HA 4DXAB 3PVWA 4DBBA 2I1KA 2DN6A 2D9ZA 1SHCA 2EMTA 4K81A 4KHOA 5GOWB 4MT7A 2EMSA 1U29A 2N23A 4GXBA 3FEHA 2N0YA 3PP2A 5JHGA 2UZRA 1EF1A 2DX1A 4Z2NA 1ISNA 2DHIA 4K17A 5KCVA 4A6HA 3ULBA 3WA0A 2OTXA 5DHFB 1GC6A 1FHXA 2Y8FA 3SO6A 2L1CA 2DHJA 4XWXA 3MDBC 2I5CA 5J3YA 1U5GA 2GCJA 3BINA 3D8DA 4KHAA 4HB3B 2H7DA 1UPQA 1TJ6A 1ZC4B 2D9YA 2COFA 4MY6A 4CYEA 1NTVA 4HATB 5C6RA 1PMSA 3ODXA 2IFSA 2I1JA 5C79A 3GYPA 4P7IA 2ROVA 4IOYX 3TCAA 2Z0QA 1NTYA 1V88A 2YRYA 1W1DA 2LKOA 4KVGB 5KQ4A 3ULCA 2ELBA 3AJ4A 2MKRA 4WVFB 5DH9B 2CODA 3O96A 4KHBB 2UZSA 1MK9B 1DROA 2YVCA 3QIJA 2DKQA 1WGQA 2FJLA 5D3WA 1MIZB 3HQCA 2YT1A 2EC1A 2YS3A 3BJIA 1WG7A 5DHAB 3TFMA 2BCJA 1XCGA 3F0WA 4GZUA 5EFXA 1UPRA 2DFKA 4GN1A 2COAA 2LULA 3PVUA 4A5KA 4NY0A 3AU4A 3QBVB 1Z87A 1DDVA 4B6HA 2P0HA 4HAYB 3PEGA 2YT0A 3DXDA 4HAXB 3D8EA 2YS5A 4ZRKA 1UEFA 1I7AA 1KZ7A 3U7DA 1LW3A 1ZVRA 2NMBA 4TKNA 2VSZA 2J0KA 5HE1A 4EMOA 1H10A 1EGXA 1V5MA 1P5TA 2L2IA 1DDWA 4KAXB 2ELAA 2XQNM 4GMVA 4HDOA 4L6EA 4PQ0A 1U5EA 5DI9B 1J19A 1X1GA 2CAYA 2RSGA 4HB4B 4EJNA 2YS1A 1GG3A 5J3QA 2KUPA 4H8SA 3PG7A 5DIFB 5LOPB 3ODWA 2J0MA 1FAOA 4HAVB 4Z2MB 1XODA 2LG1A 2M14A 2RNRB 4HHVA 4HB0B 2YSZA 3KZ1A 4Y94A 1K5DB 1M7RA 2J59M 1U5DA 1WJMA 2UVMA 1UNQA 3LJUX 2LOXA 3SUZA 3NSUA 1U5FA 2QKMA 4TYZA 3TO1A 3VIAA 2K2JA 1Y19B 2DX5A 5FI0A 5LONB 3A98B 1MKEA 1DDMA 1PLSA 2KCJA 1M7EA 1V89A 2RLOA 2P0DA 4HAUB 2D9XA 2RGNB 3KRWA 1TXDA 1X05A 4MK0A 2JP2A 2D11A 1B55A 2K00A 2W2XC 2D9WA 1NI2A 2ROZB 3GYOA 3N7CA 1NU2A 2RVBB 5D3VA 1UNRA 2DYQA 2DA0A 3PZDA 1FOEA 4DX8A 1WJ1A 3UZTA 2CRFA 5C5BA 3V5WA 1V61A 1V5PA 2DKPA 2I5FA 4YL8A 1RJ2A 1DBHA 4BBKA 1FHWA 2R09A 4IAPA 4C0AA 1LB1A 2GS0A 4NSWA 1DYNA 1OY2A 3X23A 2MDXA 2LOZA 1EVHA 3DXEA 4K2OA 1EAZA 4ZRJA 2M38A 4WJ7A 2HE7A 5J3TA 3SNHA 3PSCA 2CY4A 1MIXA 1QQGA 1FGYA 2VRWB 3F5RA 4D0NB 1BAKA 3SV1A 4CHJA 1XR0B 1Q67A 1ZC3B 4GPTB 1GC7A 3A8PA 4A6FA 1U2BA 2X18A 3ODOA 4YONA 2MWNB 5KQ1A 1AQCA 5D27A 1K5GB 4HAZB 1BTKA 1W1GA 2CY5A 2Q13A 5C5BB 1MAIA 3VOQA 5D3XA 2J0JA 2D9VA 1TQZA 4PNKA 3D8FA 2W2WA 5JP4A 3TVVA 2QKLA 2GCLA 2LYDA 2G35A 3SYXA 1XX0A 2OQBA 3IVFA 1SGHA 1QC6A 2P0FA 3FSSA 2DYNA 3PVLA 3M1IB 1P6SA 2AEHA 5HE2A 1H4RA 5FI1A 3ZVRA 3P7ZA 2ADZA 4K2PA 2Y8GA 5C16A 2D2QA 1OQNA 2W2XD 3AU5A 2D4QA 1U27A 4HDQA 4CHMA 3OANA 3ZDTA 1I2HA 1AWEA 4A6FB 4F7UP 1RRPB 2R0DA 3U8ZA 2NZ8B 3HW2B 2YF0A 1FGZA 1XD4A 1ZM0A 4HAWB 2E2XA 1MK7B 3HK0A 1X11A 2P8VA 1OMWA 1FB8A 2V76A 1KI1B 1IRSA 3WYFB 1XKEA 1PFJA 4HB2B 2DLWA 2MFQA 2H7EA 2D10A 2Y7BA 4F7GA 5CLLB 3ML4A 1FHOA 2Z0OA 2K2UA 3KY9A 1KZGA 3DXCA 5D3YA 1X86A 4ZRIA 2DTCA 2GJYA 5JHHA 4GMXB 2AL6A 1WGUA 1Y5OA 4F7HA 1BWNA 4A6KA 2EJ8A 1ZSQA 5HE3A 1J0WA 1X1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHK A;  2KGX B;  3QWM A;  3KSY A;  1E5W A;  1P3R A;  3A8Q A;  4DX9 0;  5HE0 A;  1WVH A;  5JLJ B;  3KRX A;  1V5U A;  4EKU A;  3P6A A;  1MPH A;  1UNP A;  3MPX A;  2RUK B;  5CLQ B;  2COC A;  4IFS A;  4WSF A;  3T06 A;  2HTH B;  1BTN A;  3RCP A;  2IYB A;  3CIK A;  1WI1 A;  5L81 A;  2PZ1 A;  3CXB B;  2VKI A;  2Z0P A;  2ZPY A;  3FM8 C;  1W1H A;  3G9W A;  3TW1 A;  1N3H A;  4DXA B;  3PVW A;  4DBB A;  2I1K A;  2DN6 A;  2D9Z A;  1SHC A;  2EMT A;  4K81 A;  4KHO A;  5GOW B;  4MT7 A;  2EMS A;  1U29 A;  2N23 A;  4GXB A;  3FEH A;  2N0Y A;  3PP2 A;  5JHG A;  2UZR A;  1EF1 A;  2DX1 A;  4Z2N A;  1ISN A;  2DHI A;  4K17 A;  5KCV A;  4A6H A;  3ULB A;  3WA0 A;  2OTX A;  5DHF B;  1GC6 A;  1FHX A;  2Y8F A;  3SO6 A;  2L1C A;  2DHJ A;  4XWX A;  3MDB C;  2I5C A;  5J3Y A;  1U5G A;  2GCJ A;  3BIN A;  3D8D A;  4KHA A;  4HB3 B;  2H7D A;  1UPQ A;  1TJ6 A;  1ZC4 B;  2D9Y A;  2COF A;  4MY6 A;  4CYE A;  1NTV A;  4HAT B;  5C6R A;  1PMS A;  3ODX A;  2IFS A;  2I1J A;  5C79 A;  3GYP A;  4P7I A;  2ROV A;  4IOY X;  3TCA A;  2Z0Q A;  1NTY A;  1V88 A;  2YRY A;  1W1D A;  2LKO A;  4KVG B;  5KQ4 A;  3ULC A;  2ELB A;  3AJ4 A;  2MKR A;  4WVF B;  5DH9 B;  2COD A;  3O96 A;  4KHB B;  2UZS A;  1MK9 B;  1DRO A;  2YVC A;  3QIJ A;  2DKQ A;  1WGQ A;  2FJL A;  5D3W A;  1MIZ B;  3HQC A;  2YT1 A;  2EC1 A;  2YS3 A;  3BJI A;  1WG7 A;  5DHA B;  3TFM A;  2BCJ A;  1XCG A;  3F0W A;  4GZU A;  5EFX A;  1UPR A;  2DFK A;  4GN1 A;  2COA A;  2LUL A;  3PVU A;  4A5K A;  4NY0 A;  3AU4 A;  3QBV B;  1Z87 A;  1DDV A;  4B6H A;  2P0H A;  4HAY B;  3PEG A;  2YT0 A;  3DXD A;  4HAX B;  3D8E A;  2YS5 A;  4ZRK A;  1UEF A;  1I7A A;  1KZ7 A;  3U7D A;  1LW3 A;  1ZVR A;  2NMB A;  4TKN A;  2VSZ A;  2J0K A;  5HE1 A;  4EMO A;  1H10 A;  1EGX A;  1V5M A;  1P5T A;  2L2I A;  1DDW A;  4KAX B;  2ELA A;  2XQN M;  4GMV A;  4HDO A;  4L6E A;  4PQ0 A;  1U5E A;  5DI9 B;  1J19 A;  1X1G A;  2CAY A;  2RSG A;  4HB4 B;  4EJN A;  2YS1 A;  1GG3 A;  5J3Q A;  2KUP A;  4H8S A;  3PG7 A;  5DIF B;  5LOP B;  3ODW A;  2J0M A;  1FAO A;  4HAV B;  4Z2M B;  1XOD A;  2LG1 A;  2M14 A;  2RNR B;  4HHV A;  4HB0 B;  2YSZ A;  3KZ1 A;  4Y94 A;  1K5D B;  1M7R A;  2J59 M;  1U5D A;  1WJM A;  2UVM A;  1UNQ A;  3LJU X;  2LOX A;  3SUZ A;  3NSU A;  1U5F A;  2QKM A;  4TYZ A;  3TO1 A;  3VIA A;  2K2J A;  1Y19 B;  2DX5 A;  5FI0 A;  5LON B;  3A98 B;  1MKE A;  1DDM A;  1PLS A;  2KCJ A;  1M7E A;  1V89 A;  2RLO A;  2P0D A;  4HAU B;  2D9X A;  2RGN B;  3KRW A;  1TXD A;  1X05 A;  4MK0 A;  2JP2 A;  2D11 A;  1B55 A;  2K00 A;  2W2X C;  2D9W A;  1NI2 A;  2ROZ B;  3GYO A;  3N7C A;  1NU2 A;  2RVB B;  5D3V A;  1UNR A;  2DYQ A;  2DA0 A;  3PZD A;  1FOE A;  4DX8 A;  1WJ1 A;  3UZT A;  2CRF A;  5C5B A;  3V5W A;  1V61 A;  1V5P A;  2DKP A;  2I5F A;  4YL8 A;  1RJ2 A;  1DBH A;  4BBK A;  1FHW A;  2R09 A;  4IAP A;  4C0A A;  1LB1 A;  2GS0 A;  4NSW A;  1DYN A;  1OY2 A;  3X23 A;  2MDX A;  2LOZ A;  1EVH A;  3DXE A;  4K2O A;  1EAZ A;  4ZRJ A;  2M38 A;  4WJ7 A;  2HE7 A;  5J3T A;  3SNH A;  3PSC A;  2CY4 A;  1MIX A;  1QQG A;  1FGY A;  2VRW B;  3F5R A;  4D0N B;  1BAK A;  3SV1 A;  4CHJ A;  1XR0 B;  1Q67 A;  1ZC3 B;  4GPT B;  1GC7 A;  3A8P A;  4A6F A;  1U2B A;  2X18 A;  3ODO A;  4YON A;  2MWN B;  5KQ1 A;  1AQC A;  5D27 A;  1K5G B;  4HAZ B;  1BTK A;  1W1G A;  2CY5 A;  2Q13 A;  5C5B B;  1MAI A;  3VOQ A;  5D3X A;  2J0J A;  2D9V A;  1TQZ A;  4PNK A;  3D8F A;  2W2W A;  5JP4 A;  3TVV A;  2QKL A;  2GCL A;  2LYD A;  2G35 A;  3SYX A;  1XX0 A;  2OQB A;  3IVF A;  1SGH A;  1QC6 A;  2P0F A;  3FSS A;  2DYN A;  3PVL A;  3M1I B;  1P6S A;  2AEH A;  5HE2 A;  1H4R A;  5FI1 A;  3ZVR A;  3P7Z A;  2ADZ A;  4K2P A;  2Y8G A;  5C16 A;  2D2Q A;  1OQN A;  2W2X D;  3AU5 A;  2D4Q A;  1U27 A;  4HDQ A;  4CHM A;  3OAN A;  3ZDT A;  1I2H A;  1AWE A;  4A6F B;  4F7U P;  1RRP B;  2R0D A;  3U8Z A;  2NZ8 B;  3HW2 B;  2YF0 A;  1FGZ A;  1XD4 A;  1ZM0 A;  4HAW B;  2E2X A;  1MK7 B;  3HK0 A;  1X11 A;  2P8V A;  1OMW A;  1FB8 A;  2V76 A;  1KI1 B;  1IRS A;  3WYF B;  1XKE A;  1PFJ A;  4HB2 B;  2DLW A;  2MFQ A;  2H7E A;  2D10 A;  2Y7B A;  4F7G A;  5CLL B;  3ML4 A;  1FHO A;  2Z0O A;  2K2U A;  3KY9 A;  1KZG A;  3DXC A;  5D3Y A;  1X86 A;  4ZRI A;  2DTC A;  2GJY A;  5JHH A;  4GMX B;  2AL6 A;  1WGU A;  1Y5O A;  4F7H A;  1BWN A;  4A6K A;  2EJ8 A;  1ZSQ A;  5HE3 A;  1J0W A;  1X1F A; 
#chains in the Genus database with same CATH topology
 2DHK A;  2KGX B;  2YT2 A;  3QWM A;  3KSY A;  1E5W A;  1P3R A;  3A8Q A;  4DX9 0;  2KIG A;  1MI1 A;  2ZKM X;  5HE0 A;  1WVH A;  5JLJ B;  3KRX A;  1V5U A;  4EKU A;  3P6A A;  1MPH A;  1UNP A;  3MPX A;  2RUK B;  5CLQ B;  2COC A;  2RRF A;  4IFS A;  4WSF A;  3T06 A;  2HTH B;  1BTN A;  3RCP A;  2IYB A;  3CIK A;  1WI1 A;  5L81 A;  2PZ1 A;  3CXB B;  2VKI A;  2Z0P A;  2ZPY A;  3FM8 C;  1W1H A;  3G9W A;  2Z13 A;  3TW1 A;  1N3H A;  4DXA B;  3PVW A;  4DBB A;  2I1K A;  2DN6 A;  2D9Z A;  1SHC A;  2EMT A;  4K81 A;  4KHO A;  5GOW B;  4KHB A;  4MT7 A;  2EMS A;  1U29 A;  2N23 A;  4GNK B;  4GXB A;  3FEH A;  2N0Y A;  3PP2 A;  5JHG A;  2UZR A;  1EF1 A;  2DX1 A;  4Z2N A;  1ISN A;  2DHI A;  4K17 A;  5KCV A;  4A6H A;  3ULB A;  3WA0 A;  2OTX A;  5DHF B;  4DIX A;  1GC6 A;  1FHX A;  2Y8F A;  3SO6 A;  2L1C A;  2DHJ A;  3NWA A;  4XWX A;  3MDB C;  2I5C A;  5J3Y A;  1U5G A;  2GCJ A;  3BIN A;  3D8D A;  4KHA A;  4HB3 B;  2H7D A;  1UPQ A;  1TJ6 A;  1ZC4 B;  2D9Y A;  2COF A;  4MY6 A;  4CYE A;  1NTV A;  4HAT B;  5C6R A;  1PMS A;  3ODX A;  2IFS A;  2I1J A;  5C79 A;  3GYP A;  4P7I A;  2ROV A;  4IOY X;  3TCA A;  2Z0Q A;  1NTY A;  1V88 A;  2YRY A;  1W1D A;  2LKO A;  4KVG B;  5KQ4 A;  3ULC A;  2ELB A;  3AJ4 A;  2MKR A;  4WVF B;  5DH9 B;  2COD A;  3O96 A;  4KHB B;  2UZS A;  1MK9 B;  1DRO A;  2YVC A;  3QIJ A;  2DKQ A;  1WGQ A;  2FJL A;  2KR0 A;  5D3W A;  1MIZ B;  3HQC A;  2YT1 A;  2EC1 A;  2YS3 A;  3OHM B;  4HSI A;  3BJI A;  1WG7 A;  5DHA B;  3TFM A;  2BCJ A;  1XCG A;  3F0W A;  4GZU A;  5EFX A;  1UPR A;  2DFK A;  4GN1 A;  2COA A;  2LUL A;  3PVU A;  3NWD A;  4A5K A;  4OT1 A;  4NY0 A;  3AU4 A;  3QBV B;  1Z87 A;  1DDV A;  5M4Y B;  4B6H A;  2P0H A;  4HAY B;  3PEG A;  2YT0 A;  3DXD A;  4HAX B;  3D8E A;  2YS5 A;  4ZRK A;  1UEF A;  1I7A A;  1KZ7 A;  3U7D A;  1LW3 A;  4L1R A;  1ZVR A;  2NMB A;  4TKN A;  2VSZ A;  2J0K A;  5HE1 A;  4EMO A;  1H10 A;  2FJU B;  1EGX A;  1V5M A;  1P5T A;  2L2I A;  1DDW A;  4KAX B;  2ELA A;  4GOU A;  2XQN M;  4GMV A;  4HDO A;  4L6E A;  4PQ0 A;  1U5E A;  5DI9 B;  1J19 A;  1X1G A;  2CAY A;  2RSG A;  4HB4 B;  4EJN A;  2YS1 A;  1GG3 A;  5J3Q A;  3HIE A;  2KUP A;  4H8S A;  3PG7 A;  5DIF B;  5LOP B;  3ODW A;  2Z4D A;  2J0M A;  1FAO A;  4HAV B;  4Z2M B;  1XOD A;  2LG1 A;  2M14 A;  2RNR B;  4HHV A;  4HB0 B;  2YSZ A;  3KZ1 A;  4Y94 A;  1K5D B;  1M7R A;  2J59 M;  1U5D A;  1WJM A;  2UVM A;  1UNQ A;  3LJU X;  2LOX A;  3SUZ A;  2NBV A;  3NSU A;  1U5F A;  2QKM A;  4TYZ A;  3TO1 A;  3VIA A;  2K2J A;  1Y19 B;  2DX5 A;  5FI0 A;  5LON B;  3A98 B;  1MKE A;  1DDM A;  1PLS A;  2KCJ A;  1M7E A;  1V89 A;  2RLO A;  5I2M A;  2P0D A;  4HAU B;  2D9X A;  2RGN B;  3KRW A;  1TXD A;  1X05 A;  4MK0 A;  2JP2 A;  2D11 A;  1B55 A;  2K00 A;  2W2X C;  2D9W A;  1NI2 A;  2ROZ B;  3GYO A;  3N7C A;  1NU2 A;  2RVB B;  4QJ5 B;  5D3V A;  2GUM A;  1UNR A;  2DYQ A;  1T77 A;  2DA0 A;  3PZD A;  1FOE A;  4DX8 A;  1WJ1 A;  3UZT A;  2CRF A;  5C5B A;  3V5W A;  1V61 A;  1V5P A;  2DKP A;  4QXA B;  2I5F A;  4YL8 A;  1RJ2 A;  1DBH A;  4BBK A;  1FHW A;  2R09 A;  4IAP A;  3B77 A;  4C0A A;  1LB1 A;  2GS0 A;  4NSW A;  1DYN A;  1OY2 A;  3X23 A;  2Z59 A;  2KUQ A;  2MDX A;  2LOZ A;  1EVH A;  3DXE A;  4K2O A;  1EAZ A;  4ZRJ A;  2M38 A;  4WJ7 A;  2HE7 A;  5J3T A;  3SNH A;  2R2Y A;  2CY4 A;  3FVC A;  3PSC A;  1MIX A;  1QQG A;  1FGY A;  2VRW B;  3F5R A;  4D0N B;  1BAK A;  3HSA A;  3SV1 A;  4CHJ A;  1XR0 B;  1Q67 A;  1ZC3 B;  4GPT B;  1GC7 A;  3A8P A;  4A6F A;  1U2B A;  2X18 A;  3ODO A;  4YON A;  2MWN B;  5KQ1 A;  1AQC A;  5D27 A;  1ZYI A;  3DCX A;  1K5G B;  4HAZ B;  1BTK A;  1W1G A;  2CY5 A;  4QJ3 B;  2Q13 A;  5C5B B;  2Z14 A;  1MAI A;  3VOQ A;  5IRS A;  5D3X A;  2J0J A;  2D9V A;  1TQZ A;  4PNK A;  3D8F A;  2W2W A;  5JP4 A;  3TVV A;  2QKL A;  2GCL A;  2LYD A;  2G35 A;  3SYX A;  1XX0 A;  2OQB A;  3IVF A;  1SGH A;  1QC6 A;  2P0F A;  3FSS A;  2DYN A;  3PVL A;  3M1I B;  1P6S A;  2AEH A;  5HE2 A;  1H4R A;  5FI1 A;  3ZVR A;  3P7Z A;  2ADZ A;  4K2P A;  2Y8G A;  5C16 A;  4CSQ A;  2D2Q A;  1OQN A;  2W2X D;  3AU5 A;  2D4Q A;  1U27 A;  4HDQ A;  4CHM A;  3OAN A;  3ZDT A;  1I2H A;  5LG4 B;  4OSN A;  1AWE A;  4A6F B;  3NWF A;  4QJ4 B;  4F7U P;  1RRP B;  2R0D A;  3U8Z A;  2NZ8 B;  3HW2 B;  2YF0 A;  1FGZ A;  1XD4 A;  1ZM0 A;  4HAW B;  2E2X A;  1MK7 B;  3HK0 A;  1X11 A;  2P8V A;  3A58 A;  1OMW A;  1FB8 A;  2V76 A;  1KI1 B;  1IRS A;  5I2S A;  3WYF B;  1XKE A;  1PFJ A;  4HB2 B;  2DLW A;  2MFQ A;  2H7E A;  2D10 A;  2Y7B A;  3NW8 A;  4F7G A;  2KIE A;  2K49 A;  5CLL B;  4D6W A;  3ML4 A;  1FHO A;  2Z0O A;  2K2U A;  2K8E A;  3KY9 A;  1KZG A;  3DXC A;  5D3Y A;  1X86 A;  4ZRI A;  2DTC A;  2GJY A;  5JHH A;  4GMX B;  2AL6 A;  1WGU A;  1Y5O A;  4F7H A;  1BWN A;  4A6K A;  3U12 A;  2EJ8 A;  1ZSQ A;  5HE3 A;  1J0W A;  1X1F A; 
#chains in the Genus database with same CATH homology
 2DHK A;  2KGX B;  3QWM A;  3KSY A;  1E5W A;  1P3R A;  3A8Q A;  4DX9 0;  5HE0 A;  1WVH A;  5JLJ B;  3KRX A;  1V5U A;  4EKU A;  3P6A A;  1MPH A;  1UNP A;  3MPX A;  2RUK B;  5CLQ B;  2COC A;  4IFS A;  4WSF A;  3T06 A;  2HTH B;  1BTN A;  3RCP A;  2IYB A;  3CIK A;  1WI1 A;  5L81 A;  2PZ1 A;  3CXB B;  2VKI A;  2Z0P A;  2ZPY A;  3FM8 C;  1W1H A;  3G9W A;  3TW1 A;  1N3H A;  4DXA B;  3PVW A;  4DBB A;  2I1K A;  2DN6 A;  2D9Z A;  1SHC A;  2EMT A;  4K81 A;  4KHO A;  5GOW B;  4MT7 A;  2EMS A;  1U29 A;  2N23 A;  4GXB A;  3FEH A;  2N0Y A;  3PP2 A;  5JHG A;  2UZR A;  1EF1 A;  2DX1 A;  4Z2N A;  1ISN A;  2DHI A;  4K17 A;  5KCV A;  4A6H A;  3ULB A;  3WA0 A;  2OTX A;  5DHF B;  1GC6 A;  1FHX A;  2Y8F A;  3SO6 A;  2L1C A;  2DHJ A;  4XWX A;  3MDB C;  2I5C A;  5J3Y A;  1U5G A;  2GCJ A;  3BIN A;  3D8D A;  4KHA A;  4HB3 B;  2H7D A;  1UPQ A;  1TJ6 A;  1ZC4 B;  2D9Y A;  2COF A;  4MY6 A;  4CYE A;  1NTV A;  4HAT B;  5C6R A;  1PMS A;  3ODX A;  2IFS A;  2I1J A;  5C79 A;  3GYP A;  4P7I A;  2ROV A;  4IOY X;  3TCA A;  2Z0Q A;  1NTY A;  1V88 A;  2YRY A;  1W1D A;  2LKO A;  4KVG B;  5KQ4 A;  3ULC A;  2ELB A;  3AJ4 A;  2MKR A;  4WVF B;  5DH9 B;  2COD A;  3O96 A;  4KHB B;  2UZS A;  1MK9 B;  1DRO A;  2YVC A;  3QIJ A;  2DKQ A;  1WGQ A;  2FJL A;  5D3W A;  1MIZ B;  3HQC A;  2YT1 A;  2EC1 A;  2YS3 A;  3BJI A;  1WG7 A;  5DHA B;  3TFM A;  2BCJ A;  1XCG A;  3F0W A;  4GZU A;  5EFX A;  1UPR A;  2DFK A;  4GN1 A;  2COA A;  2LUL A;  3PVU A;  4A5K A;  4NY0 A;  3AU4 A;  3QBV B;  1Z87 A;  1DDV A;  4B6H A;  2P0H A;  4HAY B;  3PEG A;  2YT0 A;  3DXD A;  4HAX B;  3D8E A;  2YS5 A;  4ZRK A;  1UEF A;  1I7A A;  1KZ7 A;  3U7D A;  1LW3 A;  1ZVR A;  2NMB A;  4TKN A;  2VSZ A;  2J0K A;  5HE1 A;  4EMO A;  1H10 A;  1EGX A;  1V5M A;  1P5T A;  2L2I A;  1DDW A;  4KAX B;  2ELA A;  2XQN M;  4GMV A;  4HDO A;  4L6E A;  4PQ0 A;  1U5E A;  5DI9 B;  1J19 A;  1X1G A;  2CAY A;  2RSG A;  4HB4 B;  4EJN A;  2YS1 A;  1GG3 A;  5J3Q A;  2KUP A;  4H8S A;  3PG7 A;  5DIF B;  5LOP B;  3ODW A;  2J0M A;  1FAO A;  4HAV B;  4Z2M B;  1XOD A;  2LG1 A;  2M14 A;  2RNR B;  4HHV A;  4HB0 B;  2YSZ A;  3KZ1 A;  4Y94 A;  1K5D B;  1M7R A;  2J59 M;  1U5D A;  1WJM A;  2UVM A;  1UNQ A;  3LJU X;  2LOX A;  3SUZ A;  3NSU A;  1U5F A;  2QKM A;  4TYZ A;  3TO1 A;  3VIA A;  2K2J A;  1Y19 B;  2DX5 A;  5FI0 A;  5LON B;  3A98 B;  1MKE A;  1DDM A;  1PLS A;  2KCJ A;  1M7E A;  1V89 A;  2RLO A;  2P0D A;  4HAU B;  2D9X A;  2RGN B;  3KRW A;  1TXD A;  1X05 A;  4MK0 A;  2JP2 A;  2D11 A;  1B55 A;  2K00 A;  2W2X C;  2D9W A;  1NI2 A;  2ROZ B;  3GYO A;  3N7C A;  1NU2 A;  2RVB B;  5D3V A;  1UNR A;  2DYQ A;  2DA0 A;  3PZD A;  1FOE A;  4DX8 A;  1WJ1 A;  3UZT A;  2CRF A;  5C5B A;  3V5W A;  1V61 A;  1V5P A;  2DKP A;  2I5F A;  4YL8 A;  1RJ2 A;  1DBH A;  4BBK A;  1FHW A;  2R09 A;  4IAP A;  4C0A A;  1LB1 A;  2GS0 A;  4NSW A;  1DYN A;  1OY2 A;  3X23 A;  2MDX A;  2LOZ A;  1EVH A;  3DXE A;  4K2O A;  1EAZ A;  4ZRJ A;  2M38 A;  4WJ7 A;  2HE7 A;  5J3T A;  3SNH A;  3PSC A;  2CY4 A;  1MIX A;  1QQG A;  1FGY A;  2VRW B;  3F5R A;  4D0N B;  1BAK A;  3SV1 A;  4CHJ A;  1XR0 B;  1Q67 A;  1ZC3 B;  4GPT B;  1GC7 A;  3A8P A;  4A6F A;  1U2B A;  2X18 A;  3ODO A;  4YON A;  2MWN B;  5KQ1 A;  1AQC A;  5D27 A;  1K5G B;  4HAZ B;  1BTK A;  1W1G A;  2CY5 A;  2Q13 A;  5C5B B;  1MAI A;  3VOQ A;  5D3X A;  2J0J A;  2D9V A;  1TQZ A;  4PNK A;  3D8F A;  2W2W A;  5JP4 A;  3TVV A;  2QKL A;  2GCL A;  2LYD A;  2G35 A;  3SYX A;  1XX0 A;  2OQB A;  3IVF A;  1SGH A;  1QC6 A;  2P0F A;  3FSS A;  2DYN A;  3PVL A;  3M1I B;  1P6S A;  2AEH A;  5HE2 A;  1H4R A;  5FI1 A;  3ZVR A;  3P7Z A;  2ADZ A;  4K2P A;  2Y8G A;  5C16 A;  2D2Q A;  1OQN A;  2W2X D;  3AU5 A;  2D4Q A;  1U27 A;  4HDQ A;  4CHM A;  3OAN A;  3ZDT A;  1I2H A;  1AWE A;  4A6F B;  4F7U P;  1RRP B;  2R0D A;  3U8Z A;  2NZ8 B;  3HW2 B;  2YF0 A;  1FGZ A;  1XD4 A;  1ZM0 A;  4HAW B;  2E2X A;  1MK7 B;  3HK0 A;  1X11 A;  2P8V A;  1OMW A;  1FB8 A;  2V76 A;  1KI1 B;  1IRS A;  3WYF B;  1XKE A;  1PFJ A;  4HB2 B;  2DLW A;  2MFQ A;  2H7E A;  2D10 A;  2Y7B A;  4F7G A;  5CLL B;  3ML4 A;  1FHO A;  2Z0O A;  2K2U A;  3KY9 A;  1KZG A;  3DXC A;  5D3Y A;  1X86 A;  4ZRI A;  2DTC A;  2GJY A;  5JHH A;  4GMX B;  2AL6 A;  1WGU A;  1Y5O A;  4F7H A;  1BWN A;  4A6K A;  2EJ8 A;  1ZSQ A;  5HE3 A;  1J0W A;  1X1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...