5EFXA

Crystal structure of rho gtpase regulator
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
144
structure length
144
Chain Sequence
GARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of hGEF-H1 PH domain provides insight into incapability in phosphoinositide binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 2
total genus 36
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5efxA00
2P8VA 1W1DA 1DROA 2YS1A 5D3XA 2BCJA 3D8DA 3GYPA 2RVBB 2LOXA 1U5FA 4HAWB 1KZ7A 3PSCA 2I1KA 2YT0A 3LJUX 2H7DA 3NSUA 2R0DA 5HE3A 2J59M 4CHJA 4MY6A 2Z0PA 2YS5A 4HAXB 1UEFA 2DA0A 1FB8A 4K81A 1MIZB 1P5TA 5C79A 4DXAB 3AJ4A 1W1GA 3T06A 3PVUA 3G9WA 1MPHA 2J0MA 2KGXB 4A6FB 5CLLB 1UPQA 1RRPB 2DYQA 4HAUB 1I2HA 2AEHA 3KRWA 2CY5A 1V5MA 1M7EA 5D3VA 2YRYA 2GJYA 1K5DB 2D10A 2EC1A 1UNQA 3SNHA 5LONB 1XD4A 1ISNA 2M14A 1I7AA 5FI1A 2ROVA 1GG3A 2W2XC 4GZUA 5KQ1A 1ZVRA 1FGYA 5J3TA 2DYNA 1MKEA 3QWMA 4ZRIA 3DXEA 3MPXA 1W1HA 2R09A 1V61A 4HAYB 4GMVA 1H10A 3GYOA 2MWNB 2V76A 1EF1A 1K5GB 4MK0A 2DHIA 3PP2A 2X18A 1E5WA 1NTVA 3SUZA 3BINA 3PZDA 4GXBA 4TKNA 1IRSA 5D27A 4IAPA 2COFA 1WI1A 2YVCA 3SO6A 1X05A 3PVLA 1U27A 4EMOA 1BTKA 1U2BA 1BTNA 3P6AA 1X1GA 2DFKA 1U5GA 2W2WA 5JP4A 2Y7BA 1RJ2A 2MFQA 4K17A 1KZGA 1J19A 2LYDA 1WGQA 1FHXA 3RCPA 2QKLA 3ODWA 2D9VA 3TVVA 3PEGA 4PQ0A 5DHAB 4B6HA 2COAA 4F7UP 2YT1A 2K00A 1FOEA 4YONA 2CAYA 2VRWB 2D4QA 4D0NB 4C0AA 1U29A 4A6HA 3ODXA 4PNKA 5C16A 2RLOA 3KRXA 5FI0A 1WJMA 4CYEA 3CIKA 1N3HA 4DX8A 2ROZB 4XWXA 3VOQA 1TQZA 1AQCA 2HTHB 4WVFB 2GCJA 2P0FA 4KHOA 1BWNA 4EJNA 1B55A 4A6FA 2RNRB 3WYFB 4IFSA 2UZRA 3U7DA 4P7IA 2L2IA 5C5BA 3HQCA 2DTCA 4K2PA 1MAIA 2VKIA 4L6EA 2I1JA 4Z2NA 1DYNA 5KCVA 2XQNM 3TFMA 3N7CA 1OMWA 2D9XA 2EJ8A 3CXBB 4GN1A 3OANA 2Y8GA 2DKPA 1X1FA 1X11A 2YS3A 2DX1A 1DDVA 4HATB 2Y8FA 2CY4A 1UNRA 2ELAA 4KHAA 3P7ZA 5JLJB 1XKEA 3HW2B 1GC6A 1GC7A 4GMXB 5HE1A 1FHOA 1FAOA 4ZRJA 1ZM0A 2LG1A 1Q67A 2K2UA 3PVWA 2Z0QA 1FGZA 3KZ1A 2LULA 2RSGA 1PLSA 3KY9A 5DI9B 2W2XD 3ULCA 2DKQA 4GPTB 4K2OA 3ML4A 5HE2A 2I5CA 3FEHA 3O96A 2RUKB 5C5BB 4YL8A 2KCJA 2IFSA 2NMBA 3ODOA 1P3RA 2D11A 4HB2B 2J0JA 1Y5OA 3AU5A 1PFJA 3PG7A 4ZRKA 4KAXB 5EFXA 1SHCA 3ZDTA 3AU4A 1U5EA 3KSYA 1DBHA 4WJ7A 4HAVB 2VSZA 4EKUA 1XCGA 2DHJA 1LW3A 2YF0A 2DX5A 4A5KA 2PZ1A 1QC6A 2I5FA 2OQBA 3A8PA 4HB3B 2AL6A 3HK0A 2E2XA 1OQNA 1TXDA 1ZSQA 1XR0B 3TW1A 1FHWA 5DHFB 4DBBA 3VIAA 5DH9B 2D9WA 4KVGB 2Z0OA 5GOWB 3TO1A 1H4RA 2QKMA 5JHGA 4BBKA 3A98B 1UPRA 1DDMA 5HE0A 1KI1B 3UZTA 1SGHA 3F0WA 2IYBA 1NU2A 4HDQA 4DX90 3QIJA 1EAZA 1XX0A 1BAKA 3QBVB 4HB4B 5J3QA 1EGXA 3ZVRA 2P0DA 2CRFA 2N23A 4H8SA 2N0YA 2YSZA 2UZSA 1V5UA 1Y19B 4WSFA 2K2JA 4HDOA 1EVHA 1V5PA 2GCLA 4NSWA 1QQGA 2LKOA 2ZPYA 2COCA 2L1CA 2J0KA 2EMSA 1OY2A 1NTYA 1MK9B 2GS0A 1UNPA 1DDWA 1ZC3B 3SYXA 2LOZA 3SV1A 3TCAA 1M7RA 4HB0B 1XODA 3D8FA 1WVHA 1V88A 5CLQB 1WG7A 1J0WA 5DIFB 3U8ZA 1ZC4B 4F7GA 2D2QA 1X86A 5LOPB 1V89A 4Z2MB 3M1IB 3X23A 3D8EA 2DN6A 2FJLA 2NZ8B 4NY0A 2OTXA 3MDBC 2M38A 2RGNB 2G35A 2HE7A 5J3YA 3A8QA 4Y94A 1WGUA 3DXDA 2MKRA 5KQ4A 1Z87A 2CODA 5D3YA 2H7EA 4IOYX 2MDXA 2P0HA 3ULBA 1MK7B 1NI2A 4CHMA 3BJIA 3DXCA 5JHHA 2D9YA 2D9ZA 1LB1A 5D3WA 3V5WA 1TJ6A 2KUPA 2JP2A 1PMSA 4TYZA 3WA0A 4HHVA 2UVMA 4F7HA 3IVFA 4A6KA 2DHKA 1AWEA 3FM8C 4HAZB 2Q13A 2ELBA 2DLWA 1MIXA 2ADZA 1WJ1A 5C6RA 3F5RA 5L81A 3FSSA 4MT7A 1U5DA 1P6SA 2EMTA 4KHBB
chains in the Genus database with same CATH superfamily
2P8VA 1W1DA 1DROA 2YS1A 5D3XA 4GNKB 2BCJA 3D8DA 3GYPA 2RVBB 2LOXA 1U5FA 4KHBA 4D6WA 4HAWB 1KZ7A 3PSCA 2I1KA 2YT0A 3HIEA 3LJUX 2H7DA 3NSUA 2R0DA 4QJ3B 5HE3A 2J59M 4CHJA 4MY6A 2Z0PA 2YS5A 4HAXB 1UEFA 2DA0A 1FB8A 5I2SA 4K81A 1MIZB 2YT2A 1P5TA 4QJ5B 4DIXA 5C79A 4DXAB 3AJ4A 1W1GA 3T06A 3PVUA 3G9WA 1MPHA 2J0MA 2KGXB 4A6FB 5CLLB 1UPQA 1RRPB 2DYQA 4HAUB 1I2HA 2AEHA 3KRWA 2CY5A 2KUQA 1V5MA 1M7EA 2NBVA 5D3VA 2YRYA 2GJYA 1K5DB 2D10A 2EC1A 2KIGA 1UNQA 3SNHA 5LONB 1XD4A 1ISNA 2K8EA 2M14A 1I7AA 5FI1A 2ROVA 1GG3A 2W2XC 4GZUA 5KQ1A 1ZVRA 1FGYA 5J3TA 2DYNA 1MKEA 3QWMA 4ZRIA 3DXEA 3MPXA 1W1HA 2R09A 1V61A 4HAYB 4GMVA 1H10A 3GYOA 2MWNB 2V76A 1EF1A 1K5GB 4MK0A 2DHIA 3PP2A 2Z14A 2X18A 1E5WA 3NWAA 3NW8A 1NTVA 3SUZA 3BINA 3PZDA 4GXBA 4TKNA 1IRSA 5D27A 2COFA 4IAPA 1WI1A 2YVCA 3SO6A 1X05A 3PVLA 1U27A 1ZYIA 4EMOA 1BTKA 1U2BA 1BTNA 3P6AA 1X1GA 4QXAB 2DFKA 3NWFA 4GOUA 1U5GA 2W2WA 5JP4A 2Y7BA 1RJ2A 2MFQA 4K17A 1KZGA 1J19A 2LYDA 1WGQA 1FHXA 4QJ4B 3RCPA 2QKLA 3U12A 3ODWA 2D9VA 3A58A 3TVVA 3PEGA 4PQ0A 5DHAB 4B6HA 2COAA 4F7UP 2YT1A 2K00A 1FOEA 4YONA 2CAYA 2VRWB 2D4QA 4D0NB 4C0AA 1U29A 4A6HA 3ODXA 4PNKA 5C16A 2RLOA 3KRXA 5FI0A 1WJMA 4CYEA 3CIKA 1N3HA 4DX8A 2ROZB 4XWXA 3VOQA 1TQZA 1AQCA 2HTHB 4WVFB 2GCJA 2P0FA 4KHOA 1BWNA 4EJNA 2KR0A 1B55A 5M4YB 4A6FA 2RNRB 3WYFB 4L1RA 4IFSA 2UZRA 3U7DA 4P7IA 2L2IA 5C5BA 3HQCA 2DTCA 2Z13A 4K2PA 1MAIA 2VKIA 4L6EA 2I1JA 4Z2NA 1DYNA 5KCVA 2XQNM 3TFMA 3N7CA 1OMWA 4OT1A 2D9XA 2EJ8A 3CXBB 4GN1A 3OANA 2Y8GA 2DKPA 1X1FA 1X11A 1T77A 2YS3A 2DX1A 1DDVA 4HATB 2Y8FA 2CY4A 1UNRA 2ELAA 4KHAA 2K49A 3P7ZA 5JLJB 1XKEA 3HW2B 1GC6A 1GC7A 4GMXB 5HE1A 1FHOA 1FAOA 4ZRJA 1ZM0A 2FJUB 2LG1A 2R2YA 3B77A 1Q67A 2K2UA 3PVWA 2Z0QA 1FGZA 3KZ1A 2LULA 2RSGA 1PLSA 3KY9A 5DI9B 2W2XD 3ULCA 2DKQA 4GPTB 4K2OA 5I2MA 3ML4A 5HE2A 2I5CA 3FEHA 3O96A 2RUKB 5C5BB 4YL8A 2KCJA 2IFSA 2NMBA 3ODOA 1P3RA 2D11A 4HB2B 2J0JA 3OHMB 1Y5OA 3AU5A 1PFJA 3PG7A 4ZRKA 4KAXB 5EFXA 1SHCA 3ZDTA 3AU4A 1U5EA 3KSYA 1DBHA 4WJ7A 4HAVB 2VSZA 4EKUA 2Z4DA 1XCGA 2DHJA 1LW3A 2YF0A 2DX5A 4A5KA 2PZ1A 1QC6A 2I5FA 2OQBA 3A8PA 4HB3B 2AL6A 3HK0A 2E2XA 5LG4B 1OQNA 1TXDA 1ZSQA 4HSIA 1XR0B 3TW1A 1FHWA 5DHFB 4DBBA 3VIAA 5DH9B 2D9WA 4KVGB 2Z0OA 5GOWB 3TO1A 1H4RA 2QKMA 5JHGA 4BBKA 3A98B 1UPRA 1DDMA 5HE0A 1KI1B 3UZTA 1SGHA 3F0WA 2IYBA 1NU2A 4HDQA 4DX90 3QIJA 1EAZA 1XX0A 1BAKA 2RRFA 3QBVB 4HB4B 5J3QA 1EGXA 3HSAA 3ZVRA 2P0DA 2CRFA 2N23A 4H8SA 5IRSA 2N0YA 2YSZA 2UZSA 1V5UA 4CSQA 1Y19B 4WSFA 2K2JA 2Z59A 4HDOA 1EVHA 1V5PA 2GCLA 4NSWA 1QQGA 2LKOA 2ZPYA 2COCA 2L1CA 2J0KA 2EMSA 1OY2A 1NTYA 1MK9B 2GS0A 1UNPA 1DDWA 3NWDA 1ZC3B 3SYXA 2LOZA 4OSNA 3SV1A 3TCAA 1M7RA 4HB0B 1XODA 3D8FA 1WVHA 1V88A 5CLQB 1WG7A 1J0WA 5DIFB 3U8ZA 1ZC4B 4F7GA 2D2QA 1X86A 5LOPB 1V89A 4Z2MB 3M1IB 3X23A 3D8EA 2DN6A 2FJLA 2NZ8B 4NY0A 2OTXA 3MDBC 2M38A 2RGNB 2G35A 2HE7A 5J3YA 3A8QA 4Y94A 1WGUA 3DXDA 3FVCA 2ZKMX 2MKRA 2KIEA 5KQ4A 1Z87A 2CODA 5D3YA 2H7EA 4IOYX 1MI1A 2MDXA 2P0HA 3ULBA 1MK7B 1NI2A 4CHMA 3BJIA 3DXCA 5JHHA 2D9YA 2D9ZA 1LB1A 5D3WA 3V5WA 1TJ6A 2KUPA 2JP2A 1PMSA 4TYZA 3WA0A 4HHVA 2UVMA 4F7HA 3IVFA 4A6KA 2DHKA 1AWEA 3FM8C 4HAZB 2Q13A 2ELBA 3DCXA 2DLWA 1MIXA 2ADZA 1WJ1A 2GUMA 5C6RA 3F5RA 5L81A 3FSSA 4MT7A 1U5DA 1P6SA 2EMTA 4KHBB
chains in the Genus database with same CATH topology
2P8VA 1W1DA 1DROA 2YS1A 5D3XA 2BCJA 3D8DA 3GYPA 2RVBB 2LOXA 1U5FA 4HAWB 1KZ7A 3PSCA 2I1KA 2YT0A 3LJUX 2H7DA 3NSUA 2R0DA 5HE3A 2J59M 4CHJA 4MY6A 2Z0PA 2YS5A 4HAXB 1UEFA 2DA0A 1FB8A 4K81A 1MIZB 1P5TA 5C79A 4DXAB 3AJ4A 1W1GA 3T06A 3PVUA 3G9WA 1MPHA 2J0MA 2KGXB 4A6FB 5CLLB 1UPQA 1RRPB 2DYQA 4HAUB 1I2HA 2AEHA 3KRWA 2CY5A 1V5MA 1M7EA 5D3VA 2YRYA 2GJYA 1K5DB 2D10A 2EC1A 1UNQA 3SNHA 5LONB 1XD4A 1ISNA 2M14A 1I7AA 5FI1A 2ROVA 1GG3A 2W2XC 4GZUA 5KQ1A 1ZVRA 1FGYA 5J3TA 2DYNA 1MKEA 3QWMA 4ZRIA 3DXEA 3MPXA 1W1HA 2R09A 1V61A 4HAYB 4GMVA 1H10A 3GYOA 2MWNB 2V76A 1EF1A 1K5GB 4MK0A 2DHIA 3PP2A 2X18A 1E5WA 1NTVA 3SUZA 3BINA 3PZDA 4GXBA 4TKNA 1IRSA 5D27A 4IAPA 2COFA 1WI1A 2YVCA 3SO6A 1X05A 3PVLA 1U27A 4EMOA 1BTKA 1U2BA 1BTNA 3P6AA 1X1GA 2DFKA 1U5GA 2W2WA 5JP4A 2Y7BA 1RJ2A 2MFQA 4K17A 1KZGA 1J19A 2LYDA 1WGQA 1FHXA 3RCPA 2QKLA 3ODWA 2D9VA 3TVVA 3PEGA 4PQ0A 5DHAB 4B6HA 2COAA 4F7UP 2YT1A 2K00A 1FOEA 4YONA 2CAYA 2VRWB 2D4QA 4D0NB 4C0AA 1U29A 4A6HA 3ODXA 4PNKA 5C16A 2RLOA 3KRXA 5FI0A 1WJMA 4CYEA 3CIKA 1N3HA 4DX8A 2ROZB 4XWXA 3VOQA 1TQZA 1AQCA 2HTHB 4WVFB 2GCJA 2P0FA 4KHOA 1BWNA 4EJNA 1B55A 4A6FA 2RNRB 3WYFB 4IFSA 2UZRA 3U7DA 4P7IA 2L2IA 5C5BA 3HQCA 2DTCA 4K2PA 1MAIA 2VKIA 4L6EA 2I1JA 4Z2NA 1DYNA 5KCVA 2XQNM 3TFMA 3N7CA 1OMWA 2D9XA 2EJ8A 3CXBB 4GN1A 3OANA 2Y8GA 2DKPA 1X1FA 1X11A 2YS3A 2DX1A 1DDVA 4HATB 2Y8FA 2CY4A 1UNRA 2ELAA 4KHAA 3P7ZA 5JLJB 1XKEA 3HW2B 1GC6A 1GC7A 4GMXB 5HE1A 1FHOA 1FAOA 4ZRJA 1ZM0A 2LG1A 1Q67A 2K2UA 3PVWA 2Z0QA 1FGZA 3KZ1A 2LULA 2RSGA 1PLSA 3KY9A 5DI9B 2W2XD 3ULCA 2DKQA 4GPTB 4K2OA 3ML4A 5HE2A 2I5CA 3FEHA 3O96A 2RUKB 5C5BB 4YL8A 2KCJA 2IFSA 2NMBA 3ODOA 1P3RA 2D11A 4HB2B 2J0JA 1Y5OA 3AU5A 1PFJA 3PG7A 4ZRKA 4KAXB 5EFXA 1SHCA 3ZDTA 3AU4A 1U5EA 3KSYA 1DBHA 4WJ7A 4HAVB 2VSZA 4EKUA 1XCGA 2DHJA 1LW3A 2YF0A 2DX5A 4A5KA 2PZ1A 1QC6A 2I5FA 2OQBA 3A8PA 4HB3B 2AL6A 3HK0A 2E2XA 1OQNA 1TXDA 1ZSQA 1XR0B 3TW1A 1FHWA 5DHFB 4DBBA 3VIAA 5DH9B 2D9WA 4KVGB 2Z0OA 5GOWB 3TO1A 1H4RA 2QKMA 5JHGA 4BBKA 3A98B 1UPRA 1DDMA 5HE0A 1KI1B 3UZTA 1SGHA 3F0WA 2IYBA 1NU2A 4HDQA 4DX90 3QIJA 1EAZA 1XX0A 1BAKA 3QBVB 4HB4B 5J3QA 1EGXA 3ZVRA 2P0DA 2CRFA 2N23A 4H8SA 2N0YA 2YSZA 2UZSA 1V5UA 1Y19B 4WSFA 2K2JA 4HDOA 1EVHA 1V5PA 2GCLA 4NSWA 1QQGA 2LKOA 2ZPYA 2COCA 2L1CA 2J0KA 2EMSA 1OY2A 1NTYA 1MK9B 2GS0A 1UNPA 1DDWA 1ZC3B 3SYXA 2LOZA 3SV1A 3TCAA 1M7RA 4HB0B 1XODA 3D8FA 1WVHA 1V88A 5CLQB 1WG7A 1J0WA 5DIFB 3U8ZA 1ZC4B 4F7GA 2D2QA 1X86A 5LOPB 1V89A 4Z2MB 3M1IB 3X23A 3D8EA 2DN6A 2FJLA 2NZ8B 4NY0A 2OTXA 3MDBC 2M38A 2RGNB 2G35A 2HE7A 5J3YA 3A8QA 4Y94A 1WGUA 3DXDA 2MKRA 5KQ4A 1Z87A 2CODA 5D3YA 2H7EA 4IOYX 2MDXA 2P0HA 3ULBA 1MK7B 1NI2A 4CHMA 3BJIA 3DXCA 5JHHA 2D9YA 2D9ZA 1LB1A 5D3WA 3V5WA 1TJ6A 2KUPA 2JP2A 1PMSA 4TYZA 3WA0A 4HHVA 2UVMA 4F7HA 3IVFA 4A6KA 2DHKA 1AWEA 3FM8C 4HAZB 2Q13A 2ELBA 2DLWA 1MIXA 2ADZA 1WJ1A 5C6RA 3F5RA 5L81A 3FSSA 4MT7A 1U5DA 1P6SA 2EMTA 4KHBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8V A;  1W1D A;  1DRO A;  2YS1 A;  5D3X A;  2BCJ A;  3D8D A;  3GYP A;  2RVB B;  2LOX A;  1U5F A;  4HAW B;  1KZ7 A;  3PSC A;  2I1K A;  2YT0 A;  3LJU X;  2H7D A;  3NSU A;  2R0D A;  5HE3 A;  2J59 M;  4CHJ A;  4MY6 A;  2Z0P A;  2YS5 A;  4HAX B;  1UEF A;  2DA0 A;  1FB8 A;  4K81 A;  1MIZ B;  1P5T A;  5C79 A;  4DXA B;  3AJ4 A;  1W1G A;  3T06 A;  3PVU A;  3G9W A;  1MPH A;  2J0M A;  2KGX B;  4A6F B;  5CLL B;  1UPQ A;  1RRP B;  2DYQ A;  4HAU B;  1I2H A;  2AEH A;  3KRW A;  2CY5 A;  1V5M A;  1M7E A;  5D3V A;  2YRY A;  2GJY A;  1K5D B;  2D10 A;  2EC1 A;  1UNQ A;  3SNH A;  5LON B;  1XD4 A;  1ISN A;  2M14 A;  1I7A A;  5FI1 A;  2ROV A;  1GG3 A;  2W2X C;  4GZU A;  5KQ1 A;  1ZVR A;  1FGY A;  5J3T A;  2DYN A;  1MKE A;  3QWM A;  4ZRI A;  3DXE A;  3MPX A;  1W1H A;  2R09 A;  1V61 A;  4HAY B;  4GMV A;  1H10 A;  3GYO A;  2MWN B;  2V76 A;  1EF1 A;  1K5G B;  4MK0 A;  2DHI A;  3PP2 A;  2X18 A;  1E5W A;  1NTV A;  3SUZ A;  3BIN A;  3PZD A;  4GXB A;  4TKN A;  1IRS A;  5D27 A;  4IAP A;  2COF A;  1WI1 A;  2YVC A;  3SO6 A;  1X05 A;  3PVL A;  1U27 A;  4EMO A;  1BTK A;  1U2B A;  1BTN A;  3P6A A;  1X1G A;  2DFK A;  1U5G A;  2W2W A;  5JP4 A;  2Y7B A;  1RJ2 A;  2MFQ A;  4K17 A;  1KZG A;  1J19 A;  2LYD A;  1WGQ A;  1FHX A;  3RCP A;  2QKL A;  3ODW A;  2D9V A;  3TVV A;  3PEG A;  4PQ0 A;  5DHA B;  4B6H A;  2COA A;  4F7U P;  2YT1 A;  2K00 A;  1FOE A;  4YON A;  2CAY A;  2VRW B;  2D4Q A;  4D0N B;  4C0A A;  1U29 A;  4A6H A;  3ODX A;  4PNK A;  5C16 A;  2RLO A;  3KRX A;  5FI0 A;  1WJM A;  4CYE A;  3CIK A;  1N3H A;  4DX8 A;  2ROZ B;  4XWX A;  3VOQ A;  1TQZ A;  1AQC A;  2HTH B;  4WVF B;  2GCJ A;  2P0F A;  4KHO A;  1BWN A;  4EJN A;  1B55 A;  4A6F A;  2RNR B;  3WYF B;  4IFS A;  2UZR A;  3U7D A;  4P7I A;  2L2I A;  5C5B A;  3HQC A;  2DTC A;  4K2P A;  1MAI A;  2VKI A;  4L6E A;  2I1J A;  4Z2N A;  1DYN A;  5KCV A;  2XQN M;  3TFM A;  3N7C A;  1OMW A;  2D9X A;  2EJ8 A;  3CXB B;  4GN1 A;  3OAN A;  2Y8G A;  2DKP A;  1X1F A;  1X11 A;  2YS3 A;  2DX1 A;  1DDV A;  4HAT B;  2Y8F A;  2CY4 A;  1UNR A;  2ELA A;  4KHA A;  3P7Z A;  5JLJ B;  1XKE A;  3HW2 B;  1GC6 A;  1GC7 A;  4GMX B;  5HE1 A;  1FHO A;  1FAO A;  4ZRJ A;  1ZM0 A;  2LG1 A;  1Q67 A;  2K2U A;  3PVW A;  2Z0Q A;  1FGZ A;  3KZ1 A;  2LUL A;  2RSG A;  1PLS A;  3KY9 A;  5DI9 B;  2W2X D;  3ULC A;  2DKQ A;  4GPT B;  4K2O A;  3ML4 A;  5HE2 A;  2I5C A;  3FEH A;  3O96 A;  2RUK B;  5C5B B;  4YL8 A;  2KCJ A;  2IFS A;  2NMB A;  3ODO A;  1P3R A;  2D11 A;  4HB2 B;  2J0J A;  1Y5O A;  3AU5 A;  1PFJ A;  3PG7 A;  4ZRK A;  4KAX B;  5EFX A;  1SHC A;  3ZDT A;  3AU4 A;  1U5E A;  3KSY A;  1DBH A;  4WJ7 A;  4HAV B;  2VSZ A;  4EKU A;  1XCG A;  2DHJ A;  1LW3 A;  2YF0 A;  2DX5 A;  4A5K A;  2PZ1 A;  1QC6 A;  2I5F A;  2OQB A;  3A8P A;  4HB3 B;  2AL6 A;  3HK0 A;  2E2X A;  1OQN A;  1TXD A;  1ZSQ A;  1XR0 B;  3TW1 A;  1FHW A;  5DHF B;  4DBB A;  3VIA A;  5DH9 B;  2D9W A;  4KVG B;  2Z0O A;  5GOW B;  3TO1 A;  1H4R A;  2QKM A;  5JHG A;  4BBK A;  3A98 B;  1UPR A;  1DDM A;  5HE0 A;  1KI1 B;  3UZT A;  1SGH A;  3F0W A;  2IYB A;  1NU2 A;  4HDQ A;  4DX9 0;  3QIJ A;  1EAZ A;  1XX0 A;  1BAK A;  3QBV B;  4HB4 B;  5J3Q A;  1EGX A;  3ZVR A;  2P0D A;  2CRF A;  2N23 A;  4H8S A;  2N0Y A;  2YSZ A;  2UZS A;  1V5U A;  1Y19 B;  4WSF A;  2K2J A;  4HDO A;  1EVH A;  1V5P A;  2GCL A;  4NSW A;  1QQG A;  2LKO A;  2ZPY A;  2COC A;  2L1C A;  2J0K A;  2EMS A;  1OY2 A;  1NTY A;  1MK9 B;  2GS0 A;  1UNP A;  1DDW A;  1ZC3 B;  3SYX A;  2LOZ A;  3SV1 A;  3TCA A;  1M7R A;  4HB0 B;  1XOD A;  3D8F A;  1WVH A;  1V88 A;  5CLQ B;  1WG7 A;  1J0W A;  5DIF B;  3U8Z A;  1ZC4 B;  4F7G A;  2D2Q A;  1X86 A;  5LOP B;  1V89 A;  4Z2M B;  3M1I B;  3X23 A;  3D8E A;  2DN6 A;  2FJL A;  2NZ8 B;  4NY0 A;  2OTX A;  3MDB C;  2M38 A;  2RGN B;  2G35 A;  2HE7 A;  5J3Y A;  3A8Q A;  4Y94 A;  1WGU A;  3DXD A;  2MKR A;  5KQ4 A;  1Z87 A;  2COD A;  5D3Y A;  2H7E A;  4IOY X;  2MDX A;  2P0H A;  3ULB A;  1MK7 B;  1NI2 A;  4CHM A;  3BJI A;  3DXC A;  5JHH A;  2D9Y A;  2D9Z A;  1LB1 A;  5D3W A;  3V5W A;  1TJ6 A;  2KUP A;  2JP2 A;  1PMS A;  4TYZ A;  3WA0 A;  4HHV A;  2UVM A;  4F7H A;  3IVF A;  4A6K A;  2DHK A;  1AWE A;  3FM8 C;  4HAZ B;  2Q13 A;  2ELB A;  2DLW A;  1MIX A;  2ADZ A;  1WJ1 A;  5C6R A;  3F5R A;  5L81 A;  3FSS A;  4MT7 A;  1U5D A;  1P6S A;  2EMT A;  4KHB B; 
#chains in the Genus database with same CATH topology
 2P8V A;  1W1D A;  1DRO A;  2YS1 A;  5D3X A;  4GNK B;  2BCJ A;  3D8D A;  3GYP A;  2RVB B;  2LOX A;  1U5F A;  4KHB A;  4D6W A;  4HAW B;  1KZ7 A;  3PSC A;  2I1K A;  2YT0 A;  3HIE A;  3LJU X;  2H7D A;  3NSU A;  2R0D A;  4QJ3 B;  5HE3 A;  2J59 M;  4CHJ A;  4MY6 A;  2Z0P A;  2YS5 A;  4HAX B;  1UEF A;  2DA0 A;  1FB8 A;  5I2S A;  4K81 A;  1MIZ B;  2YT2 A;  1P5T A;  4QJ5 B;  4DIX A;  5C79 A;  4DXA B;  3AJ4 A;  1W1G A;  3T06 A;  3PVU A;  3G9W A;  1MPH A;  2J0M A;  2KGX B;  4A6F B;  5CLL B;  1UPQ A;  1RRP B;  2DYQ A;  4HAU B;  1I2H A;  2AEH A;  3KRW A;  2CY5 A;  2KUQ A;  1V5M A;  1M7E A;  2NBV A;  5D3V A;  2YRY A;  2GJY A;  1K5D B;  2D10 A;  2EC1 A;  2KIG A;  1UNQ A;  3SNH A;  5LON B;  1XD4 A;  1ISN A;  2K8E A;  2M14 A;  1I7A A;  5FI1 A;  2ROV A;  1GG3 A;  2W2X C;  4GZU A;  5KQ1 A;  1ZVR A;  1FGY A;  5J3T A;  2DYN A;  1MKE A;  3QWM A;  4ZRI A;  3DXE A;  3MPX A;  1W1H A;  2R09 A;  1V61 A;  4HAY B;  4GMV A;  1H10 A;  3GYO A;  2MWN B;  2V76 A;  1EF1 A;  1K5G B;  4MK0 A;  2DHI A;  3PP2 A;  2Z14 A;  2X18 A;  1E5W A;  3NWA A;  3NW8 A;  1NTV A;  3SUZ A;  3BIN A;  3PZD A;  4GXB A;  4TKN A;  1IRS A;  5D27 A;  2COF A;  4IAP A;  1WI1 A;  2YVC A;  3SO6 A;  1X05 A;  3PVL A;  1U27 A;  1ZYI A;  4EMO A;  1BTK A;  1U2B A;  1BTN A;  3P6A A;  1X1G A;  4QXA B;  2DFK A;  3NWF A;  4GOU A;  1U5G A;  2W2W A;  5JP4 A;  2Y7B A;  1RJ2 A;  2MFQ A;  4K17 A;  1KZG A;  1J19 A;  2LYD A;  1WGQ A;  1FHX A;  4QJ4 B;  3RCP A;  2QKL A;  3U12 A;  3ODW A;  2D9V A;  3A58 A;  3TVV A;  3PEG A;  4PQ0 A;  5DHA B;  4B6H A;  2COA A;  4F7U P;  2YT1 A;  2K00 A;  1FOE A;  4YON A;  2CAY A;  2VRW B;  2D4Q A;  4D0N B;  4C0A A;  1U29 A;  4A6H A;  3ODX A;  4PNK A;  5C16 A;  2RLO A;  3KRX A;  5FI0 A;  1WJM A;  4CYE A;  3CIK A;  1N3H A;  4DX8 A;  2ROZ B;  4XWX A;  3VOQ A;  1TQZ A;  1AQC A;  2HTH B;  4WVF B;  2GCJ A;  2P0F A;  4KHO A;  1BWN A;  4EJN A;  2KR0 A;  1B55 A;  5M4Y B;  4A6F A;  2RNR B;  3WYF B;  4L1R A;  4IFS A;  2UZR A;  3U7D A;  4P7I A;  2L2I A;  5C5B A;  3HQC A;  2DTC A;  2Z13 A;  4K2P A;  1MAI A;  2VKI A;  4L6E A;  2I1J A;  4Z2N A;  1DYN A;  5KCV A;  2XQN M;  3TFM A;  3N7C A;  1OMW A;  4OT1 A;  2D9X A;  2EJ8 A;  3CXB B;  4GN1 A;  3OAN A;  2Y8G A;  2DKP A;  1X1F A;  1X11 A;  1T77 A;  2YS3 A;  2DX1 A;  1DDV A;  4HAT B;  2Y8F A;  2CY4 A;  1UNR A;  2ELA A;  4KHA A;  2K49 A;  3P7Z A;  5JLJ B;  1XKE A;  3HW2 B;  1GC6 A;  1GC7 A;  4GMX B;  5HE1 A;  1FHO A;  1FAO A;  4ZRJ A;  1ZM0 A;  2FJU B;  2LG1 A;  2R2Y A;  3B77 A;  1Q67 A;  2K2U A;  3PVW A;  2Z0Q A;  1FGZ A;  3KZ1 A;  2LUL A;  2RSG A;  1PLS A;  3KY9 A;  5DI9 B;  2W2X D;  3ULC A;  2DKQ A;  4GPT B;  4K2O A;  5I2M A;  3ML4 A;  5HE2 A;  2I5C A;  3FEH A;  3O96 A;  2RUK B;  5C5B B;  4YL8 A;  2KCJ A;  2IFS A;  2NMB A;  3ODO A;  1P3R A;  2D11 A;  4HB2 B;  2J0J A;  3OHM B;  1Y5O A;  3AU5 A;  1PFJ A;  3PG7 A;  4ZRK A;  4KAX B;  5EFX A;  1SHC A;  3ZDT A;  3AU4 A;  1U5E A;  3KSY A;  1DBH A;  4WJ7 A;  4HAV B;  2VSZ A;  4EKU A;  2Z4D A;  1XCG A;  2DHJ A;  1LW3 A;  2YF0 A;  2DX5 A;  4A5K A;  2PZ1 A;  1QC6 A;  2I5F A;  2OQB A;  3A8P A;  4HB3 B;  2AL6 A;  3HK0 A;  2E2X A;  5LG4 B;  1OQN A;  1TXD A;  1ZSQ A;  4HSI A;  1XR0 B;  3TW1 A;  1FHW A;  5DHF B;  4DBB A;  3VIA A;  5DH9 B;  2D9W A;  4KVG B;  2Z0O A;  5GOW B;  3TO1 A;  1H4R A;  2QKM A;  5JHG A;  4BBK A;  3A98 B;  1UPR A;  1DDM A;  5HE0 A;  1KI1 B;  3UZT A;  1SGH A;  3F0W A;  2IYB A;  1NU2 A;  4HDQ A;  4DX9 0;  3QIJ A;  1EAZ A;  1XX0 A;  1BAK A;  2RRF A;  3QBV B;  4HB4 B;  5J3Q A;  1EGX A;  3HSA A;  3ZVR A;  2P0D A;  2CRF A;  2N23 A;  4H8S A;  5IRS A;  2N0Y A;  2YSZ A;  2UZS A;  1V5U A;  4CSQ A;  1Y19 B;  4WSF A;  2K2J A;  2Z59 A;  4HDO A;  1EVH A;  1V5P A;  2GCL A;  4NSW A;  1QQG A;  2LKO A;  2ZPY A;  2COC A;  2L1C A;  2J0K A;  2EMS A;  1OY2 A;  1NTY A;  1MK9 B;  2GS0 A;  1UNP A;  1DDW A;  3NWD A;  1ZC3 B;  3SYX A;  2LOZ A;  4OSN A;  3SV1 A;  3TCA A;  1M7R A;  4HB0 B;  1XOD A;  3D8F A;  1WVH A;  1V88 A;  5CLQ B;  1WG7 A;  1J0W A;  5DIF B;  3U8Z A;  1ZC4 B;  4F7G A;  2D2Q A;  1X86 A;  5LOP B;  1V89 A;  4Z2M B;  3M1I B;  3X23 A;  3D8E A;  2DN6 A;  2FJL A;  2NZ8 B;  4NY0 A;  2OTX A;  3MDB C;  2M38 A;  2RGN B;  2G35 A;  2HE7 A;  5J3Y A;  3A8Q A;  4Y94 A;  1WGU A;  3DXD A;  3FVC A;  2ZKM X;  2MKR A;  2KIE A;  5KQ4 A;  1Z87 A;  2COD A;  5D3Y A;  2H7E A;  4IOY X;  1MI1 A;  2MDX A;  2P0H A;  3ULB A;  1MK7 B;  1NI2 A;  4CHM A;  3BJI A;  3DXC A;  5JHH A;  2D9Y A;  2D9Z A;  1LB1 A;  5D3W A;  3V5W A;  1TJ6 A;  2KUP A;  2JP2 A;  1PMS A;  4TYZ A;  3WA0 A;  4HHV A;  2UVM A;  4F7H A;  3IVF A;  4A6K A;  2DHK A;  1AWE A;  3FM8 C;  4HAZ B;  2Q13 A;  2ELB A;  3DCX A;  2DLW A;  1MIX A;  2ADZ A;  1WJ1 A;  2GUM A;  5C6R A;  3F5R A;  5L81 A;  3FSS A;  4MT7 A;  1U5D A;  1P6S A;  2EMT A;  4KHB B; 
#chains in the Genus database with same CATH homology
 2P8V A;  1W1D A;  1DRO A;  2YS1 A;  5D3X A;  2BCJ A;  3D8D A;  3GYP A;  2RVB B;  2LOX A;  1U5F A;  4HAW B;  1KZ7 A;  3PSC A;  2I1K A;  2YT0 A;  3LJU X;  2H7D A;  3NSU A;  2R0D A;  5HE3 A;  2J59 M;  4CHJ A;  4MY6 A;  2Z0P A;  2YS5 A;  4HAX B;  1UEF A;  2DA0 A;  1FB8 A;  4K81 A;  1MIZ B;  1P5T A;  5C79 A;  4DXA B;  3AJ4 A;  1W1G A;  3T06 A;  3PVU A;  3G9W A;  1MPH A;  2J0M A;  2KGX B;  4A6F B;  5CLL B;  1UPQ A;  1RRP B;  2DYQ A;  4HAU B;  1I2H A;  2AEH A;  3KRW A;  2CY5 A;  1V5M A;  1M7E A;  5D3V A;  2YRY A;  2GJY A;  1K5D B;  2D10 A;  2EC1 A;  1UNQ A;  3SNH A;  5LON B;  1XD4 A;  1ISN A;  2M14 A;  1I7A A;  5FI1 A;  2ROV A;  1GG3 A;  2W2X C;  4GZU A;  5KQ1 A;  1ZVR A;  1FGY A;  5J3T A;  2DYN A;  1MKE A;  3QWM A;  4ZRI A;  3DXE A;  3MPX A;  1W1H A;  2R09 A;  1V61 A;  4HAY B;  4GMV A;  1H10 A;  3GYO A;  2MWN B;  2V76 A;  1EF1 A;  1K5G B;  4MK0 A;  2DHI A;  3PP2 A;  2X18 A;  1E5W A;  1NTV A;  3SUZ A;  3BIN A;  3PZD A;  4GXB A;  4TKN A;  1IRS A;  5D27 A;  4IAP A;  2COF A;  1WI1 A;  2YVC A;  3SO6 A;  1X05 A;  3PVL A;  1U27 A;  4EMO A;  1BTK A;  1U2B A;  1BTN A;  3P6A A;  1X1G A;  2DFK A;  1U5G A;  2W2W A;  5JP4 A;  2Y7B A;  1RJ2 A;  2MFQ A;  4K17 A;  1KZG A;  1J19 A;  2LYD A;  1WGQ A;  1FHX A;  3RCP A;  2QKL A;  3ODW A;  2D9V A;  3TVV A;  3PEG A;  4PQ0 A;  5DHA B;  4B6H A;  2COA A;  4F7U P;  2YT1 A;  2K00 A;  1FOE A;  4YON A;  2CAY A;  2VRW B;  2D4Q A;  4D0N B;  4C0A A;  1U29 A;  4A6H A;  3ODX A;  4PNK A;  5C16 A;  2RLO A;  3KRX A;  5FI0 A;  1WJM A;  4CYE A;  3CIK A;  1N3H A;  4DX8 A;  2ROZ B;  4XWX A;  3VOQ A;  1TQZ A;  1AQC A;  2HTH B;  4WVF B;  2GCJ A;  2P0F A;  4KHO A;  1BWN A;  4EJN A;  1B55 A;  4A6F A;  2RNR B;  3WYF B;  4IFS A;  2UZR A;  3U7D A;  4P7I A;  2L2I A;  5C5B A;  3HQC A;  2DTC A;  4K2P A;  1MAI A;  2VKI A;  4L6E A;  2I1J A;  4Z2N A;  1DYN A;  5KCV A;  2XQN M;  3TFM A;  3N7C A;  1OMW A;  2D9X A;  2EJ8 A;  3CXB B;  4GN1 A;  3OAN A;  2Y8G A;  2DKP A;  1X1F A;  1X11 A;  2YS3 A;  2DX1 A;  1DDV A;  4HAT B;  2Y8F A;  2CY4 A;  1UNR A;  2ELA A;  4KHA A;  3P7Z A;  5JLJ B;  1XKE A;  3HW2 B;  1GC6 A;  1GC7 A;  4GMX B;  5HE1 A;  1FHO A;  1FAO A;  4ZRJ A;  1ZM0 A;  2LG1 A;  1Q67 A;  2K2U A;  3PVW A;  2Z0Q A;  1FGZ A;  3KZ1 A;  2LUL A;  2RSG A;  1PLS A;  3KY9 A;  5DI9 B;  2W2X D;  3ULC A;  2DKQ A;  4GPT B;  4K2O A;  3ML4 A;  5HE2 A;  2I5C A;  3FEH A;  3O96 A;  2RUK B;  5C5B B;  4YL8 A;  2KCJ A;  2IFS A;  2NMB A;  3ODO A;  1P3R A;  2D11 A;  4HB2 B;  2J0J A;  1Y5O A;  3AU5 A;  1PFJ A;  3PG7 A;  4ZRK A;  4KAX B;  5EFX A;  1SHC A;  3ZDT A;  3AU4 A;  1U5E A;  3KSY A;  1DBH A;  4WJ7 A;  4HAV B;  2VSZ A;  4EKU A;  1XCG A;  2DHJ A;  1LW3 A;  2YF0 A;  2DX5 A;  4A5K A;  2PZ1 A;  1QC6 A;  2I5F A;  2OQB A;  3A8P A;  4HB3 B;  2AL6 A;  3HK0 A;  2E2X A;  1OQN A;  1TXD A;  1ZSQ A;  1XR0 B;  3TW1 A;  1FHW A;  5DHF B;  4DBB A;  3VIA A;  5DH9 B;  2D9W A;  4KVG B;  2Z0O A;  5GOW B;  3TO1 A;  1H4R A;  2QKM A;  5JHG A;  4BBK A;  3A98 B;  1UPR A;  1DDM A;  5HE0 A;  1KI1 B;  3UZT A;  1SGH A;  3F0W A;  2IYB A;  1NU2 A;  4HDQ A;  4DX9 0;  3QIJ A;  1EAZ A;  1XX0 A;  1BAK A;  3QBV B;  4HB4 B;  5J3Q A;  1EGX A;  3ZVR A;  2P0D A;  2CRF A;  2N23 A;  4H8S A;  2N0Y A;  2YSZ A;  2UZS A;  1V5U A;  1Y19 B;  4WSF A;  2K2J A;  4HDO A;  1EVH A;  1V5P A;  2GCL A;  4NSW A;  1QQG A;  2LKO A;  2ZPY A;  2COC A;  2L1C A;  2J0K A;  2EMS A;  1OY2 A;  1NTY A;  1MK9 B;  2GS0 A;  1UNP A;  1DDW A;  1ZC3 B;  3SYX A;  2LOZ A;  3SV1 A;  3TCA A;  1M7R A;  4HB0 B;  1XOD A;  3D8F A;  1WVH A;  1V88 A;  5CLQ B;  1WG7 A;  1J0W A;  5DIF B;  3U8Z A;  1ZC4 B;  4F7G A;  2D2Q A;  1X86 A;  5LOP B;  1V89 A;  4Z2M B;  3M1I B;  3X23 A;  3D8E A;  2DN6 A;  2FJL A;  2NZ8 B;  4NY0 A;  2OTX A;  3MDB C;  2M38 A;  2RGN B;  2G35 A;  2HE7 A;  5J3Y A;  3A8Q A;  4Y94 A;  1WGU A;  3DXD A;  2MKR A;  5KQ4 A;  1Z87 A;  2COD A;  5D3Y A;  2H7E A;  4IOY X;  2MDX A;  2P0H A;  3ULB A;  1MK7 B;  1NI2 A;  4CHM A;  3BJI A;  3DXC A;  5JHH A;  2D9Y A;  2D9Z A;  1LB1 A;  5D3W A;  3V5W A;  1TJ6 A;  2KUP A;  2JP2 A;  1PMS A;  4TYZ A;  3WA0 A;  4HHV A;  2UVM A;  4F7H A;  3IVF A;  4A6K A;  2DHK A;  1AWE A;  3FM8 C;  4HAZ B;  2Q13 A;  2ELB A;  2DLW A;  1MIX A;  2ADZ A;  1WJ1 A;  5C6R A;  3F5R A;  5L81 A;  3FSS A;  4MT7 A;  1U5D A;  1P6S A;  2EMT A;  4KHB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...