5EG4A

Bovine trypsin in complex with cyclic inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Optimization of Cyclic Plasmin Inhibitors: From Benzamidines to Benzylamines.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eg4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5eg4A02
1P57B 2XC5A 3A86A 3D62A 3GCTG 1FUJA 1GG6C 1GHYH 1TB6H 5TJXA 2GP9B 4H6TA 1RIWC 3VEQB 2FI3E 3LGIA 1O38A 4X8SH 2CMYA 3RDZA 2F9UA 2B9LA 4MPXA 5EOKA 1P3CA 1O2MA 1BDAA 2OUAA 3AAVA 1H9HE 4IBLH 1ABJH 5IDKA 2ZU2A 1AZZA 4QT8C 3BV9B 4CH8B 4RKJB 4GHQA 2BYAX 2FOEA 2A7JA 1TNLA 2BDAA 3IWMA 4AX9H 1PPBH 4LXBH 1AUTC 1YPHC 2QXIA 1UHBA 2GMTC 3S7KB 2WPLS 4O3UA 2VIWA 3M5NA 3OU0A 4AN7A 1Q3XA 3ZV8A 4AGJA 4ABEA 4F49A 4BAKB 3RUOA 3U9AH 2OP9A 1EKBB 1Q31A 1TGNA 2FI4E 1N8OB 4Y8YA 4ABFA 1C2DA 4X8TH 5FX6A 1AN1E 3D65E 5F8TA 2VWNA 1O2HA 1QQ4A 1Y5BT 2SGAA 4CRBA 1HNEE 1F5LA 1AE8H 4CR5A 2ZGHA 1LQDB 2A0QB 1LQEA 1THSH 2BX4A 2XTTB 4AOQA 1RS0A 2A2XH 1SMFE 1LKBA 3GY5A 2OBQA 1P06A 1BJVA 2C90B 1B7XB 2NWNA 2BY7X 1XX9A 4NSVA 4MPUA 1O3FA 2ZTZA 2A32A 2RA3A 3TNSA 3ODDA 1V2UT 4FUIA 1ZTKA 2R2WU 1KSNA 2FODA 1TGBA 2FS8A 1LHGH 5DP9A 1J14A 4MNYA 2K1QA 2Y5HA 1NFYA 1YLCA 1XKAC 4Q7XA 1YPMH 1VCQA 4I8HA 2Z3DA 2R2MB 3I78A 3EE0B 3SJOA 2THFB 2WPHS 2WUCA 3DUXH 1ZMJA 3N7OA 1J9CH 1TONA 1FN6A 2ILNA 4OS2A 1BBRH 1GBCA 8ESTE 1TOMH 1H1BA 2TGTA 1K1OA 3SJIA 3SV8A 1TGTA 2C8ZB 1C5ZB 1MKWH 3RMMH 2BD9A 4ZH8A 3BTME 1D9IA 3T27A 3KQCA 5LPRA 1EOLA 3ATLA 3RXEA 2H9EH 1AHTH 1WQSA 3A85A 1H9IE 1OP0A 1Z7KA 5LH8A 1THRH 1ETRH 1UMAH 4AORA 1C2MA 1YCPH 3BEIB 4XDEA 3QN7A 3SQHE 1TNGA 1OWKA 4XBCA 1LHCH 2GDDA 2ZECA 3SNBA 1XXDA 1P2OA 2SGEE 1C4U2 3RXIA 1LVBA 3SV2H 1C1PA 5JYIA 5EXLA 4GSOA 1OWEA 2J92A 1WUNH 1DXPA 2SGQE 3BTKE 3NPSA 1FY4A 3M5OA 5FPSA 4ZUHA 1C1QA 1IHSH 4A6LA 3UNRA 3IG6B 3URCA 5C2ZA 2QYIA 1GBEA 3GICB 3AW1A 3H7TA 4MPWA 5A8XA 1E38B 1G37A 4FUHA 1KYNA 1AZ8A 1C5SA 5DO4H 3PLKA 5TCAA 1AY6H 3SI3H 2ZU5A 2QC2A 1BJUA 1CO7E 1SGTA 1BHXB 1AFQC 1HFDA 1O5GH 1FAXA 1KXCA 2GKVE 1GHAF 2ZPSA 4D7GA 2ZFSA 1FI8A 3ZZ6A 4A1VA 1YM0A 1GBLA 2PTCE 3MNSA 2W5EA 1AE5A 2QIQA 1ZHRA 1ZSJA 2Z9GA 3RMOH 5A09A 1FY8E 1EB1H 2DE9A 4D9QA 3QZQA 1JIRA 5EXNA 5BPEA 1S81A 4MTBA 1V6DA 4JYUH 5HXFA 1F5RA 1JRTA 3JZ2B 1C9PA 3TGIE 1QGFA 5DP4A 1O35A 2FOMB 1DSUA 1T4VH 5HM9A 2W3IA 1DX5M 3OY5U 1EOJA 1P3EA 2JH0D 4AG2A 3E8LA 3ZZ5A 1NESE 2OC1A 1UTMA 3DFJA 4FUGA 1EPTC 4YOIA 2ZHDA 1MAYA 2A5KA 3ZZ9A 4X6NA 2HPQH 1TWXB 5DGJA 1GBHA 1QY6A 1CHGA 3BTFE 4B1TA 2BD7A 1F92A 2P93A 1K2I1 1AKSA 1GVZA 3UNQA 3GY8A 4CRDA 4YLUA 1PQ5A 1P0SH 1WSSH 5DKMA 1HPGA 3MH5A 1ELEE 3SW2B 1C2LA 3LC3A 4LZ1H 3U8OH 3ATKA 2VH6A 4XFQA 1DWEH 4CREA 3MYWA 3RXKA 2OCVB 4WH8A 5BRRE 1O5FH 5EW2H 1BTUA 1OPHB 4BXSA 4X2XA 5AF9H 1ABIH 1GHZA 1EZUC 2AIQA 1O2WA 1WV7H 3FP6E 1ELGA 2A7HA 4NWKA 1G30B 2AIPA 4K1TA 2F9VA 2YNAA 2P94A 3RU4D 1V2MT 2FZZA 2HNTC 1IQMA 1CE5A 2RA0A 2P16A 4ESTE 3S9BA 3UOPA 4BOHA 1C2JA 2BLVA 3B23B 2UWLA 1DWBH 1A0LA 3SGBE 3CP7A 1S84A 4FXGH 5GXPA 2HWLB 4Z6AH 3O8RA 1A3BH 2ZCHP 2GGVB 1ORFA 3DHKH 3QLPH 2SNWA 1MU6B 3PMHB 2GT7A 4DGJA 1GJ7B 2BM2A 4K1EA 2EI8A 2ZU3A 1P9SA 3PTNA 2Z94A 2D8WA 1DUAA 1O3NA 4Y6DA 2A7CA 2WINI 5G4BA 3SZNA 2O9QA 2FWWA 1W11U 1CA0C 3EYDA 2CF9H 1EP5A 2G52A 1GJ6A 2H6MA 4AG1A 1NPMA 1G3EA 2PUXB 4JK6A 5HGGA 1SGIB 2ZHWH 2A31A 1C2FA 4E7RG 1ZPCA 4AGKA 1ELDE 1BRBE 3KCGH 1C1MA 2CV3A 4ZXYH 2FOHA 1MAXA 1C2KA 2VIPA 1SL3A 1T4UH 1YBWA 1SGNE 4ZHAA 1GDNA 3K9XB 4FUDA 4NA8A 3L6PA 4X1NU 1QL7A 4BAHB 4Y71A 1GMCG 2ANYA 3MU5A 1UTJA 4JZFH 3SUGA 2HNTF 2TGDA 1G3BA 3BEFB 4OS1A 1XUKA 5GCHG 1PJPA 1W12U 3BTWE 3RMNH 3M7UA 5EU8A 1YLDA 2UUYA 2ZDNA 2C8WB 1LHFH 2FESH 1TRYA 4FUEA 1Y3XA 4AB9A 3HPTB 4H42U 1S85A 2BLOA 1B5GH 3ZZ7A 3P8OA 2PSXA 1TE0A 1HJ8A 1PPZA 1INCA 2BD5A 4XE4A 2B7DH 4Y79A 2W7SA 4PROA 4CRFA 2VIVA 5HMAA 2CGAA 2PR3A 4IGDA 1YGCH 3VPKA 8KME2 4KTUA 1V2QT 1LTOA 2XBWA 3VB4A 4A1XA 1ID5H 3TITA 4INHA 1MTNB 1MD7A 4X2WA 4BAMB 1ANCA 1G32B 1TABE 4A5TS 3A89A 1A61H 1C1VH 4TYDA 4UD9H 5C67A 1N8OC 1DY9A 3RXJA 3G01A 5GPIB 1C5UA 1WOFA 3LGUA 1ZLRA 2FTMA 1OYTH 2RDLA 4GAWA 4TWWA 1Y3VA 2BQ7B 3C27B 2BVXH 3ZZ3A 1XUJA 3EQ0H 5JBTA 1ANEA 3BTTE 3FP8E 1ZSLA 4JYVH 1NRSH 4WY3A 1C5MD 2F9NA 3L3TA 4TPIZ 3SHAH 2ZI2H 3QGNB 2BVSH 3K6ZA 1EPTA 1LVMA 1V2LT 3RMLH 1KXFA 1WTHD 3U1IB 1VITH 1KLIH 1BZXE 2XXLA 2ZWLH 2Y6TA 1SPJA 2JETC 5L30H 1MTWA 4LZ4B 4WMDA 5FCRA 4O97A 3UREA 2BD8A 2ZPQA 3GDUA 2VINA 2XC0A 2A5IA 1HAZB 2HGTH 1GCTC 8GCHF 1W0YH 1TQ0B 2BLQA 1MMJN 3M35A 1EZQA 5CHAB 1BMAA 1VGCB 1C5PA 3T2NA 1E34B 1THPB 1Z71A 3TGKE 1ZHMA 3ENSB 3PM3A 1SBWA 1D4PB 1O3IA 4ZKRU 1DLEA 1SGCA 1TYNA 5B6OA 5GJ4B 2VIQA 3R0FA 4WVPE 2BDGA 2PWXA 1GVKB 2V6NA 3AW0A 7GCHF 3U69H 1ZYOA 2Y81A 1FIZA 1EXFA 4B2CA 4WF8A 3RXTA 2BDYA 1MH0A 2BDBA 3KL6A 3R3GB 3ATIA 1TMTH 1EAIA 3HK6B 4JYTA 3BEUA 1CSOE 4YT6H 1FMGA 3MU8A 1JMOH 4AFUA 1GHXH 4INKA 3F6UH 5CE1A 2HLCA 3M61U 1UK3A 1HLTH 4E05H 1DSTA 1C5LH 5DG6A 4ASHA 1GI7B 2V35A 1VITF 2KAIA 1FONA 5DK1A 1W0ZU 2XNIA 5TCCA 2IOTA 2H5CA 3M7TA 2GCHF 3SUFA 1GJ9B 1YKTA 4CRGA 2OC0A 3A83A 1HIAA 1UTPA 3BTDE 1UTOA 4ZHMU 1O2PA 4BTTB 1N6YA 3URDA 4IC6A 1SQTA 3UWIA 4X8VH 1CGJE 1XXFA 3SHCH 1NN6A 4ZXXH 5T6DA 2ODPA 3A81A 1BMLA 1CT4E 1N6XA 2VWMA 5T6FA 2BY5X 1O3LA 2IPHA 1P2KA 2GZ8A 2GX4A 5J4SA 1CA8B 2Z7FE 4X1PU 2NU3E 1EJMA 1KXAA 6GCHF 2W3KA 3RXDA 3PB1E 2FLBH 2VH0A 1GGDB 1SQOA 4NA9H 1KIGH 1YPLH 4BAOB 2FO9A 1ZZZA 2BVRH 2Q6FA 1IQHA 4BANB 3AASA 1ZOMA 1MCVA 4DJZB 9ESTA 4MNWA 2BOKA 2Z9JA 1GI0A 5ESTE 4M7GA 1W8BH 2OLGA 1WU1A 3PLPA 4WXVA 1NROH 3HATH 1BRAA 2QA9E 1O2LA 1S82A 1BQYA 2NU4E 2NU2E 1C2IA 4NG9H 4NWLA 2SGFE 1CQQA 1O3AA 1ZMLA 3PMBB 1ELTA 1SGPE 2AFQB 2PTNA 3D23A 1GDUA 5LPEA 2GD4B 2ANKH 3PROA 1GJ4H 3ZVAA 4CRAA 1ZTLA 1O2OA 2Q6DA 4NA7A 3ZVCA 2ZZUH 3MH7A 2Z3EA 3SV9A 1PPGE 1K1JA 2ZFRH 1C2GA 2Z9KA 4AFZA 2CJIA 1BHXF 1S5SA 3GY3A 1C9TA 1MTVA 2ZC9H 3MU0A 3SU5A 5FPYA 1AD8H 1BBRK 1V2NT 2BQ6B 1QR3E 4D7FA 3MOCA 3M36A 1HAOH 3UY9A 4INLA 1A4WH 3ZVDA 1T7CA 2ZP0H 2HALA 3I29A 1MKWK 2PKAB 4I32A 3BG4B 2EI7A 2PHBA 2A4QA 1H8IH 4OS6A 1QL9A 5F8ZA 4GPGA 1HB0B 5C1UA 1GCDA 1ELVA 1YCPK 1DWDH 3LT3A 1V2ST 2ZKSA 2SGDE 3T62A 1BCUH 1YPGH 1O2NA 1K28D 3HKJB 1OWHA 3L33A 1MKXH 1O2XA 1NFWA 3VXFH 5C5NA 1HBTH 2XW9A 2Z6BD 4BXWA 1C5VA 1MTUA 3ZZ4A 4DOQA 3M3TA 2BDIA 3SI4H 1K1PA 1C1WH 3Q3XA 3GY2A 3DFLA 3CENA 3LIWA 1W7GH 3LGVA 3TGJE 1OYQA 1DANH 5JPMH 2OQ5A 1ACBE 2P8OB 3LH3A 3P92A 2G4TA 3NXPA 1BRUP 1SI5H 1O3MA 3BTEE 3UNSA 2XBXA 3PLBA 4XSKU 2BQWB 4FUCA 1OP8A 1GMHF 2Z3CA 4YOGA 2SFAA 3KHVA 5FPTA 1OWIA 1ANBA 1YPKH 4YESB 3STIA 1GI5A 1GI6A 1RGQA 5EQRA 2FTLE 1QBNA 3K2UA 1ETSH 2UUFB 3VGCB 3RXQA 1J8AA 1O5DH 1W3CA 1QIXB 5FHTA 3H7OA 3UPEA 2P59A 2ZFFH 1PFXC 1DOJA 2V0BA 1O33A 5AHGH 2W7UA 2FX6A 3Q77A 5A0CA 1QRWA 1ZJDA 1GBMA 3P8NA 4J2YB 2AMQA 1DS2E 1QCPA 3A7XA 3PV4A 4WMFA 1F2SE 1FY3A 2DUCA 1RTKA 1TX7A 2PGBB 1AGJA 4H4FA 1GBFA 1O2GH 1LCYA 5I46H 1YP9A 1PPFE 4FUJA 3PYHA 2HRVA 4AYYB 1T32A 2F9PA 2ZF0H 3PO1B 1SGFG 3T29A 5EG4A 2F3CE 1T8NA 3RM2H 1T8MA 3W95A 3QK1A 3V7TA 1HAVB 1FN8A 2TIOA 1UTLM 4YZUA 3HGPA 1O2JA 1NM6A 1HYLA 1QB9A 1ZGIA 2ODYB 1ZSKA 2QN5T 2CHAB 3ZVFA 4Y7AA 5C1XA 5AFYH 2BZAA 2BZ6H 1GJ8B 4Y76A 2WUBA 4IS5A 2EA3A 2IJOB 2ZA5A 2ULLA 1MTNC 1HXFH 4ABBA 1LPZB 1SGFA 2PW8H 1OS8A 3QTOH 1GBKA 1A0JA 1EUFA 1L4ZA 4Y8ZA 1A2CH 3MU4A 3MNXA 1Y3YA 5C5OA 4IC5A 3VB5A 5FX5A 3A8AA 2I6QA 1BUIA 4MPVA 3PTBA 2V3HH 1MD8A 4Y7BA 4X6PA 6CHAC 1F0RA 3VB6A 2OTVA 1W7XH 3E3TA 5FXLA 4LOYH 2XCFA 2ZEBA 3KEEA 4IMQA 3KQEA 3TJVA 2H5DA 2FDAA 3SORA 1HDTH 2PUQH 3RXRA 3DD2H 4WH6A 3RM0H 1EAXA 1ESTA 4FUFA 4Q2KA 1EZSC 1P02A 1SR5C 1Y5AT 2VIDA 3ZVBA 1BRCE 5LGOA 1GMDF 3A7TA 2FS9A 3E16B 3FANA 5A0BA 3M7QA 3SJ8A 1XM1A 3TLOA 5F03A 4GCHF 1BTWA 4NZLA 4SGBE 4AB8A 3OX7U 1BT7A 4K5ZA 1IQEA 4X8UH 1QHRB 2WPIS 5CHAC 5CMXH 1VGCC 4ABJA 1LDTT 1HXEH 3P8FA 2P3FH 1PYTC 1MCTA 3GOVB 1NRNH 4B2AA 1TPSA 1GHWH 3T25A 1O3EA 5FAHA 5JBBS 4AFSA 2QGRA 2FP7B 3RXUA 2P3TB 1C1UH 2XWBI 1BMNH 2R9PA 2VIOA 2ZGXH 2ZO3H 2A4OA 1GI4A 2FI5E 4K69A 3LGWA 2TPIZ 4CRCA 2F9OA 1NC6A 1B0EA 4J1YA 1NS3A 1UK4A 1UCYK 1Z1JA 3UQVA 4DY7B 1OXGA 3A82A 4IW4E 1SGYE 3ZZDA 4Y0YE 7ESTE 3ELAH 5EQSA 1A0HB 1GHAG 4RSPA 4B2BA 1NTPA 2OC8A 4X6OA 1N1LA 2QXGA 3T26A 1C5OH 2QF3A 1O32A 1PQ7A 2FX4A 4FVBA 2WYJA 1D3PB 1NRRH 4ZKOU 1LO6A 1P10A 2G5NA 1PYTD 1OWJA 2QAAA 3SNEA 5GIBA 3SU3A 2CXVA 3BTQE 4JK5A 1UTQA 2ZDLA 4XOJA 1CHOF 1GBIA 5E2OA 3BF6H 4ISHH 2VVVA 4UE7H 2JKHA 2C93B 1CT2E 1ELBA 4D8NA 4BNRA 4U2WA 3ZZBA 3M3SA 4GCHG 3HK3B 4Z0KA 2Z9LA 2XBVA 1GGDC 3EA8A 3RXOA 1O5EH 3VXEH 1C5RA 1GBDA 3EGKH 1CGIE 3V12A 1EJAA 3RLYH 1C2EA 1DM4B 1XKBC 1SB1H 2P3UB 5AVDA 3AVZA 1DLKB 4TPYA 3GISB 2J2UA 2BY6X 3MNCA 4R0IA 3GY4A 1O2IA 2RCEA 4H6SB 1TAWA 2FOCA 4KTCA 3A88A 1HAPH 1WAYB 3WY8A 4DW2U 2TGPZ 3Q3KA 3RXLA 1C5TA 1E0FD 1A7SA 2O8MA 2PGQB 1TFXA 3W94A 1H8DH 1AQ7A 3OTJE 1O37A 1GJDB 2ZPRA 2W26A 4U01A 1YF4A 3QTVH 4JZ1A 3QX5H 5DJ7A 1MQ6A 2ESTE 4ZROA 1A5GH 4YM9A 2BB4A 4ABIA 1EQ9A 3O8DA 3TPIZ 1IQJA 3TK5A 4CHAB 3ATWA 3GCHB 1J17T 1CVWH 1KTTB 3MO9A 3RXHA 1A5HA 4MNVA 2BDHA 4JZDH 1RD3B 4NIXA 1UJ1A 3F1SB 4U32A 3BG4C 1TNJA 1C1OA 3E1XB 4F4OC 3TJNA 4D9RA 4K3JA 7LPRA 3SU2A 2AGGX 1O3GA 2OINA 3BIVH 1W14U 5A0AE 2JH5D 1AWHB 2HPPH 2PLXA 3CS0A 3SU1A 1NO9H 1GPZA 1SSXA 4ISIH 2XBYA 3A8BA 4SGAE 1DVAH 1HAHH 1TBZH 3LPRA 4LK4A 3AAUA 1GHBF 2GCTB 2ZU4A 3QDZB 1O3CA 3RXBA 4MG3A 1GBAA 2P8OC 3S9CA 3GCNA 2QY0B 4E06H 1HAGE 3F9HA 3LGYA 2J34A 2ZGJA 3Q76A 1AFQB 1T8OA 1P2MA 1W2KH 1AWFH 1XMNB 2VNTA 2F83A 1KDQB 1UTNA 1QNJA 1QFKH 5E0HA 3TJOA 2BY8X 2UUJB 3UQOA 1DFPA 3K6YA 1U6QA 4GHTA 1E36B 4YTAA 3RXSA 2HOBA 1D3TB 5C3NA 1IQLA 2VWOA 1FY1A 2SGPE 3ODFA 3MO3A 1IHTH 4HTCH 4E7NA 1GJ5H 2FOGA 3RXFA 3VGCC 3SU0A 1Q2WA 1ZHPA 1NT1A 3KIDU 3MH6A 2UWPA 4CBOA 1TA6A 2GDEH 2BOHB 3SUEA 3ZVGA 2FYRA 4NCYA 1FQ3A 3QWCH 1V2RT 3LJOA 3PMAB 2EI6A 1P05A 2XYAA 1BITA 2QXJA 3PMJA 4Q7YA 4RKOB 3HKIB 3PO1C 4I7YH 1MUEB 1AMHA 3B9FH 2I6SA 1EASA 1S0RA 1TBRH 2VJ1A 1IQGA 1O2VA 1G3DA 1VJ9U 4FUBA 3LDXH 1BTYA 3SQEE 2A1DB 1QTFA 3NWUA 4O9VA 4WJG2 2G8TA 1SLVB 2J4IA 2CHAC 1FDPA 3BG8A 2C3SA 3OY6U 1UVTH 2HVXA 1EAWA 2R3YA 1RTFB 1WCZA 3S7HB 3GCTF 4NIYA 3TK9A 1SVPA 2GV6A 1MBMA 4CBNA 2GTBA 1YPHE 2LNCA 2VU8E 1P11E 1TPAE 1F0UA 3NK8A 1PQAA 1Z6JH 4YT7H 1NU9A 1P2NA 5F6MA 4MDSA 2G4UA 5ESBA 1P8VC 1V2JT 1IQKA 2ZHFH 2PFEA 3E0PB 1ESBA 3A7ZA 3QZRA 1G2MA 4HZHA 5DP6A 1TNKA 2ZHQH 2WYGA 1RFNA 4X6MA 5DP3A 1TMUH 2D26C 2XWAA 3M5MA 2XC4A 5SGAE 1DY8A 3DA9B 2BD3A 3LH1A 8GCHG 3SUDA 1QBOA 1MKXK 2F91A 2VVUA 1GJBB 4NFEA 2TGAA 1TX6A 2KAIB 1K21H 4MLFB 1G2LA 1V2VT 3GY7A 1M9UA 1D3QB 3UWJH 1QB6A 4WWYA 7GCHG 3FP7E 2J38A 3EAJA 4K8YA 1PQ8A 5C1YA 1D6RA 1BBRE 1X7AC 2A45B 3MH4A 1BTHH 2BXTH 3F9EA 1P09A 1GBJA 4K2YA 1KXEA 4NSYA 4OGYA 3KQDA 2ZCLP 1MTSA 3ZZ8A 1MZDA 1LPGB 5I25A 4WXIA 4DIHH 4IMZA 1BTZA 1ELCA 3SJ9A 3Q3YA 2ZDKA 4I33A 1PPEE 1C2HA 1SGQE 2FM2A 1VITG 2QF0A 1HJAB 3RC5A 4I31A 3MO6A 2C4FH 4B73A 3RXGA 2B5TB 3GDSA 1JIMA 2GCHG 1FV9A 2A2QH 1TBQH 3BTHE 3SGAE 4UEHH 1C1TA 1Y3UA 4YOJA 3TU7H 3FFGA 5EQQA 4B74A 6LPRA 5JB9S 1GBTA 1ANDA 1CBWB 1GL0E 1Y3WA 3F68H 5LPFA 1C1RA 2G81E 1LVOA 3GDVA 2BD2A 3M37A 1GDQA 4FU8A 3SOSA 1S83A 2CF8H 1JOUB 4OS5A 1KLJH 4UFGH 3K65B 2TRMA 6GCHG 1O2KA 1PPCE 1RJXB 1WQVH 4IN2A 3TVJB 3KNXA 1O2UA 1L2EA 2OQUA 1AB9B 2Y5GA 3JZ1B 3ZZAA 3U1JB 1MU8B 2F9BH 5ETXA 5FBEA 1QL8A 1L1NA 1K9OE 1ETTH 3P70B 2J95A 1W10U 1Y59T 2NU1E 4ABHA 4AZ2B 1IQIA 1Z6EA 1AUJA 2BTCE 3PWCA 5L6NH 2TBSA 3OYPA 1EATA 1UHBB 1LHDH 1SHHB 2GZ7A 1XUHA 2A5AA 5FBIA 1F0SA 1SG8B 1XUFA 2VWLA 3VFEA 3LC5A 1C1NA 1HAYB 5K7RA 2ZIQH 2RG3A 1NU7B 2GZ9A 1HAVA 1AFEH 1HV7A 1O0DH 1QJ6B 3MWIU 1XVMA 1KXDA 3RU4E 5EW1H 5L2YH 2B0FA 1DWCH 1TLDA 3LONA 2AGEX 4DVAU 2JETB 1P2JA 1H9LB 3EDXB 3LKWA 1QRXA 3SNDA 3MHWU 1ARBA 2H2ZA 1HJ9A 1FIWA 1LVYA 3TIUA 2PKSB 2Q1JA 2O8LA 5E2PA 1RTLA 1T31A 1GCTB 1YC0A 1YPJH 4JZEH 5DP8A 1PPHE 3RC4A 3UTUH 1VZQH 4YO9A 1XUIA 1O2RA 5JBAS 3MMGA 3RXMA 3A7YA 3UFAA 4D76A 2VGCB 1GBBA 1YPEH 4CHAC 1G36A 3E6PH 3TH4H 3KN2A 3GCHC 3SGQE 1GI3A 2OBOA 1O5AB 1OSSA 4FU9A 1NZQH 1L4DA 4B76A 1HRTH 1YYY1 3A8DA 4ABDA 2GVFA 1BOQA 5DP7A 1TPPA 3O8BA 2DE8A 1L1GA 1O2SA 4ZHLU 1TGSZ 1GI8B 1AVXA 1SLWB 4GLYA 4KGAA 5JB8S 4X0WU 5HM2A 4NZQA 2NU0E 2ASUB 4DG4A 4MNXA 5EXMA 1V2WT 5GWZA 2BLWA 4ISNA 2AYWA 3KQBA 2PSYA 1SQAA 2WPMS 1O30A 2FOBA 3T28A 2HNTE 3RXPA 1FLEE 2UUKB 1EB2A 2GCTC 3ATMA 1OP2A 3RU4T 3SV7A 1BTXA 1Z8IB 1HAIH 2ZU1A 1GI1A 3SJKA 1SHYA 4HGCA 1GMHG 1JBUH 1V3XA 4HFPB 1VCPA 1HAXB 1EJNA 1O34A 1F5KU 1S6FA 3O8CA 1OKXA 3SU4A 2FIRH 1NRPH 1Z1IA 4FVDA 1SOZA 4GUXA 4Y11E 5FCKA 1AVGH 4UFDH 2ODQA 1KY9A 2ZTYA 2Y82A 3LOXA 1GWAA 1TOCB 1IQNA 1CGHA 3NUMA 1V2PT 3A87A 4KP0A 5E0JA 2ZFPH 1O3DA 1BA8B 1QRZA 2OXSA 2WV5A 4VGCB 1SOTA 2FMJA 3EA7A 1KTSB 1F7ZA 3GYLB 1TALA 5F8XA 5AFZH 1GHVH 4BTUB 5A8ZA 1O2ZA 1DDJA 4X2VA 3B8JA 3VB3A 1XUGA 4A7IB 3P95A 3A7VA 2EEKA 1UCYE 3UUZA 1Z8GA 1AI8H 3OSYA 1ARCA 1AU8A 1ZRBA 1UO6A 4A92A 1SFIA 3FZDA 1CT0E 1FJSA 1OWDA 5A2MH 5E0GA 1G3CA 3ZYDA 1J15A 1BIOA 3A7WA 4CR9A 9LPRA 1GL1A 1VR1H 2Q6GA 2CN0H 1NRQH 1GG6B 1C5NH 2EC9H 3ZV9A 3RXVA 1RIWB 4UFEH 2G51A 1LPKB 3ITIA 3BN9A 5EPYA 1HGTH 3TJUA 3M3VA 5HYOA 3QO6A 1K1NA 1GMCF 1YCPM 1ELFA 1NFXA 5IYTA 2PV9B 2STAE 4JCNA 2A4GA 4JMYA 3PWBA 1NY22 4NIWA 5GCHF 3MTYA 3NKKA 3Q00A 4IN1A 1O5CB 1A3EH 1L1JA 1O36A 2P95A 1Z8JB 2GMTB 1AKSB 3P8GA 3U98H 1P9UA 4MQAA 4AFQA 1MZAA 1O3JA 3P17H 1V2TT 1AIXH 1UVUH 1FY5A 3FVFB 4O03A 1GMDG 4BTIB 2ALVA 1FXYA 1K22H 2FOAA 1TNHA 1MQ5A 2QCYA 4UONA 1DUEA 1RRKA 3U8TH 2ZQ2A 1E35B 1VCWA 2G00A 5L2ZH 1E37B 4NGAH 1V2KT 1C4Y2 2VB0A 3RLWH 4OS4A 1FAKH 1WTGH 1ZJKA 3MU1A 4JZIA 2BX3A 8LPRA 3FAOA 2G55A 1KLTA 3KGPA 4K60A 1G9IE 4OS7A 1SFQB 1LHEH 1OX1A 1WYKA 3MNBA 4TWYA 1O3OA 2R0LA 2AGIX 3LGTA 4U30A 4ABGA 5J4QA 1P01A 1QA0A 2FEQH 4ZAEA 1QURH 1J16A 4GVUA 2BHGA 3QGJA 2BD4A 4I8KA 3SNCA 1SGDE 2LPRA 2AERH 2YOLA 3BIUH 5EODA 3TNTA 1QJ7B 3BTGE 3LU9B 5E8EH 1SC8U 5GDSH 2C8XB 1UVPA 1W13U 2XRCA 2Y7XA 1TNIA 2J94A 3A84A 1K1LA 1UCYH 2R3UA 1O3PB 4RN6A 3UR6A 5JBCS 1JWTA 1Y8TA 4KKDA 3TH3H 1A46H 2B8OH 2M5TA 1EAUA 1HJAC 1EP6A 4OGXA 1T8LA 2OD3B 4ISOA 3ZYEA 2ZQ1A 1GI2A 1FNIA 1P2QA 3H5CB 3TK6A 1ZPZA 2AH4X 2D1JA 3EA9A 1KXBA 2Z9IA 1UVOA 2R0KA 4ZKSU 1DE7H 1TA2A 1BB0B 5DPAA 2O8WA 1AO5A 1MBQA 1ZGVA 4Y0ZE 3TH2H 4DT7B 1HCGA 3MFJA 1CBWC 3RC6A 2UWOA 2ZGBH 4MVNA 3CS7A 4KTSA 4Q7ZA 2FOFA 4UDWH 2C8YB 4X1QU 1KDQA 3SV6A 1CHOG 2BY9X 2A4RA 3RP2A 3NZIA 2WPKS 2SNVA 3GCOA 1DT2A 1C5QA 3STJA 2ZFQH 1C4V2 4ABAA 1TIOA 3QUMP 5JDUB 2V3OH 4TY6A 1K1IA 1AB9C 2BDCA 6ESTA 1O2QA 4O3TA 2AMDA 2J9NA 2ZFTA 3NCLA 4AYVB 3KF2A 3SU6A 3I77A 1D3DB 2Y7ZA 1ZTJA 3S69A 3SN8A 5A8YA 1P2IA 3F9FA 5T6GA 3A8CA 4XBBA 1IAUA 6CHAB 1TRNA 3V3MA 3E91A 1O3BA 1O3KA 5H4IB 1BMMH 2XCNA 1SLXB 1SGRE 1SGEE 3C1KA 1RXPA 1OOKB 3BSQA 4Y10E 1C5WB 1O39A 1TPOA 2ANWA 3LJJA 1ESAA 1ZPBA 3E90B 2ZG0H 3F9GA 3IITA 4TY7A 1BTPA 1UTKA 1P12E 2OC7A 2O8UA 2O8TA 1TX8A 1P04A 2ZGCA 1L0ZA 1C5YB 2PKSC 2GV7A 2ZHEH 1GJAB 3GY6A 5DP5A 1QB1A 1ZMNA 1ZRKA 1VJAU 1TGCA 1JXPA 1FZZA 3SNAA 4NFFA 1JRSA 1EPTB 2FLRH 1LKAA 1LMWB 4R8TB 4XBDA 2AMPA 3S9AA 4WMEA 2YNBA 2FYQA 2VGCC 1SLUB 2IN2A 1S0QA 4I8JA 3SO3A 1FPCH 4Y8XA 1CU1A 1O31A 1TMBH 4I8LA 1IQFA 1DITH 1F0TA 1DPOA 1EZXC 2ALPA 1V2OT 3HGNA 2AEIH 3VB7A 2JH6D 5ABWA 4DIIH 2FXRA 4ZKNU 2FPZA 1QBVH 2WPJS 3P6ZB 3RXAA 2ZDAH 4Q80A 1GHBG 3E0NB 4BAQB 2G5VA 3FZZA 4KELA 1AVWA 1O2TA 3MI4A 1S6HA 4A1TA 1B0FA 4NIVA 5EGMA 3ZZCA 5K0HA 1ZR0A 1TQ7B 5EPNA 2BMGB 3UIRA 3U8RH 2ZTXA 2QV1A 2H1UA 3T5FH 2VVCA 3UOUA 2STBE 2ANMH 1GJCB 1UK2A 2WV4A 1QQUA 1EX3A 1O5BB 3V13A 1DXWA 4HI3A 1O2YA 2ZNKH 2BXUH 2ZDVH 3ESTA 5C20A 1UVSH 4FU7A 3SBKA 3A80A 2Y5FA 1TRMA 4X1RU 2H9HA 4ISLA 2AS9A 4DCDA 1Y5UT 4B71A 4THNH 1Z8RA 2GT8A 3DT0H 3M5LA 2ZCKP 1NFUA 4YLQH 1C1SA 1GI9B 4B75A 2QXHA 1QJ1B 1FPHH 4VGCC 4I8GA 3V0XA 5PTPA 1A5IA 7KMEH 1CA0B 4ZMAH 1A1RA 1HUTH 3S0NA 1O3HA 4K8BA 1HIAB 1GVLA 4X1SU 3D49H 4X2YA 2PKAA 2Y80A 1D6WA 4CH2B 3RXCA 1DICA 1WBGB 3ZVEA 2H9TH 4K1SA 2ZDMA 1ELAA 1P03A 4UFFH 1QA7A 4DURA 1C5XB 5T3HA 1IOEA 3UR9A 1H4WA 1XVOA 3GYMA 2D2DA 1K1MA
chains in the Genus database with same CATH superfamily
1P57B 2XC5A 3A86A 3D62A 3GCTG 1FUJA 1GG6C 1GHYH 1TB6H 5TJXA 2GP9B 4H6TA 1RIWC 3VEQB 2FI3E 3LGIA 1O38A 4X8SH 2CMYA 3RDZA 2F9UA 2B9LA 4MPXA 2JIZD 5EOKA 1P3CA 1O2MA 1BDAA 2OUAA 3AAVA 1H9HE 4IBLH 1ABJH 5IDKA 2ZU2A 1AZZA 4QT8C 3BV9B 4CH8B 4RKJB 4GHQA 2BYAX 2FOEA 2A7JA 1QZ8A 1TNLA 2BDAA 3IWMA 4AX9H 1PPBH 4LXBH 1AUTC 1YPHC 2QXIA 1UHBA 2GMTC 3S7KB 2WPLS 4O3UA 2VIWA 3M5NA 3OU0A 4AN7A 1Q3XA 3ZV8A 4AGJA 4ABEA 4F49A 4BAKB 3RUOA 3U9AH 2OP9A 1EKBB 1Q31A 1TGNA 2FI4E 1N8OB 4Y8YA 4ABFA 1C2DA 4X8TH 5FX6A 1AN1E 3D65E 5F8TA 2VWNA 1O2HA 1QQ4A 1Y5BT 2SGAA 4CRBA 1HNEE 1F5LA 1AE8H 4CR5A 2AHME 2ZGHA 1LQDB 2A0QB 1LQEA 1THSH 2BX4A 2XTTB 4AOQA 1RS0A 1KMHB 2A2XH 1SMFE 1LKBA 3GY5A 2OBQA 1WXRA 1P06A 1BJVA 2C90B 1B7XB 2NWNA 2BY7X 5KECA 1XX9A 4NSVA 4MPUA 1O3FA 2ZTZA 1S6LA 2A32A 2RA3A 5T1VA 3TNSA 3ODDA 1V2UT 3U28C 4FUIA 1ZTKA 2R2WU 1KSNA 2FODA 1K0HA 1TGBA 2FS8A 1LHGH 5DP9A 1J14A 4MNYA 4ACBA 2J5UA 2K1QA 2Y5HA 1NFYA 4Q63A 1YLCA 1XKAC 4Q7XA 1YPMH 2LP6A 1VCQA 4I8HA 2Z3DA 2R2MB 3I78A 3EE0B 3SJOA 2THFB 2WPHS 2WUCA 3DUXH 1ZMJA 3N7OA 1J9CH 1TONA 1FN6A 2ILNA 4OS2A 1BBRH 1GBCA 8ESTE 1TOMH 1H1BA 2TGTA 1K1OA 3SJIA 3SV8A 1TGTA 2C8ZB 1C5ZB 1MKWH 3RMMH 2BD9A 4ZH8A 3BTME 1D9IA 3T27A 3KQCA 5LPRA 1EOLA 3ATLA 3RXEA 2H9EH 1AHTH 1WQSA 3A85A 1H9IE 1OP0A 1Z7KA 5LH8A 1THRH 1ETRH 1UMAH 4AORA 1C2MA 1YCPH 3BEIB 4XDEA 3QN7A 3SQHE 1TNGA 1OWKA 4XBCA 1LHCH 2GDDA 2ZECA 3SNBA 1XXDA 1P2OA 2SGEE 1C4U2 3RXIA 1LVBA 3SV2H 1C1PA 5JYIA 5EXLA 4GSOA 1OWEA 2J92A 1WUNH 1DXPA 2SGQE 3BTKE 3NPSA 1FY4A 3M5OA 3PV2A 4I86A 5FPSA 4ZUHA 1C1QA 1IHSH 4A6LA 3UNRA 3IG6B 3URCA 5C2ZA 2QYIA 1GBEA 3GICB 3AW1A 3H7TA 4MPWA 5A8XA 1YLNA 1E38B 1G37A 4FUHA 1KYNA 1AZ8A 1C5SA 5DO4H 3PLKA 5TCAA 1AY6H 3SI3H 2ZU5A 2QC2A 1BJUA 1CO7E 1SGTA 1BHXB 1AFQC 1HFDA 1O5GH 1FAXA 1KXCA 2GKVE 1GHAF 2ZPSA 4D7GA 2ZFSA 1FI8A 3ZZ6A 4A1VA 1YM0A 1GBLA 2PTCE 3MNSA 2W5EA 1AE5A 3OAAD 5B6LA 2QIQA 1ZHRA 1ZSJA 2Z9GA 3RMOH 5A09A 1FY8E 1EB1H 2DE9A 2V3MA 4D9QA 3QZQA 1JIRA 5EXNA 5BPEA 1S81A 4MTBA 1V6DA 4JYUH 5HXFA 1F5RA 1JRTA 3JZ2B 1C9PA 3TGIE 1QGFA 5DP4A 1O35A 2FOMB 3KYFA 5CHBA 1DSUA 1T4VH 5HM9A 2W3IA 1DX5M 1YY3A 3OY5U 1EOJA 1P3EA 2JH0D 2F4LA 4AG2A 3E8LA 3ZZ5A 1NESE 2OC1A 1UTMA 3DFJA 4FUGA 1EPTC 4YOIA 2ZHDA 1MAYA 2A5KA 5KGOA 4X6NA 3ZZ9A 2HPQH 1TWXB 5DGJA 1GBHA 1QY6A 1CHGA 3BTFE 4B1TA 4ZCNA 2BD7A 1F92A 2P93A 1K2I1 1AKSA 1GVZA 3UNQA 3GY8A 4CRDA 3PRDA 4YLUA 1PQ5A 1P0SH 1WSSH 5DKMA 1HPGA 3MH5A 1ELEE 3SW2B 1C2LA 3LC3A 4LZ1H 3U8OH 3ATKA 2VH6A 4XFQA 1DWEH 4CREA 3MYWA 3RXKA 2OCVB 4WH8A 5BRRE 1O5FH 1E79D 5EW2H 1BTUA 1OPHB 4BXSA 4X2XA 5AF9H 1ABIH 1GHZA 1EZUC 2AIQA 1O2WA 1WV7H 3FP6E 1ELGA 2A7HA 3GS9A 4NWKA 1G30B 2AIPA 4K1TA 2F9VA 2YNAA 2P94A 3RU4D 1V2MT 2FZZA 2HNTC 1IQMA 5DN6D 1CE5A 2RA0A 2P16A 4ESTE 3S9BA 3UOPA 4BOHA 1C2JA 2BLVA 3B23B 2UWLA 1DWBH 1A0LA 4M9FA 3SGBE 3CP7A 1S84A 4FXGH 3KYGA 5GXPA 2HWLB 4Z6AH 3O8RA 1A3BH 2ZCHP 4P00A 2GGVB 1ORFA 3DHKH 3QLPH 2SNWA 1MU6B 3PMHB 2GT7A 4DGJA 1GJ7B 2BM2A 4K1EA 2EI8A 2ZU3A 4RT0A 1P9SA 3PTNA 2Z94A 2D8WA 1DUAA 1O3NA 4Y6DA 2A7CA 2WINI 5G4BA 3SZNA 2O9QA 2FWWA 1W11U 1CA0C 3EYDA 2CF9H 2F43B 1EP5A 2G52A 1GJ6A 2H6MA 4AG1A 1NPMA 1G3EA 2PUXB 4JK6A 5HGGA 1SGIB 2ZHWH 2A31A 1C2FA 4E7RG 1ZPCA 4AGKA 1ELDE 1BRBE 3KCGH 1C1MA 2CV3A 4ZXYH 2FOHA 1MAXA 1C2KA 2VIPA 1SL3A 1T4UH 1YBWA 1SGNE 4ZHAA 1GDNA 3K9XB 4FUDA 3W1EA 4NA8A 2YMSB 3L6PA 4X1NU 1QL7A 4BAHB 4Y71A 1GMCG 2ANYA 3MU5A 1UTJA 4JZFH 3SUGA 2HNTF 2TGDA 1G3BA 3BEFB 4OS1A 1XUKA 5GCHG 1PJPA 1W12U 3F2GA 3BTWE 3RMNH 3M7UA 5EU8A 1YLDA 2UUYA 4F48B 2ZDNA 2C8WB 1LHFH 2FESH 1TRYA 4FUEA 1Y3XA 4AB9A 3HPTB 4H42U 1S85A 2BLOA 1B5GH 3ZZ7A 3P8OA 2PSXA 1TE0A 1HJ8A 2RFKC 1PPZA 1INCA 2BD5A 4XE4A 2B7DH 3OFND 4Y79A 2W7SA 4PROA 4CRFA 2VIVA 5HMAA 2CGAA 2PR3A 4IGDA 1YGCH 3VPKA 8KME2 4KTUA 1V2QT 1LTOA 2XBWA 3VB4A 4A1XA 3MQKC 1ID5H 3TITA 4INHA 1MTNB 5HKKD 1MD7A 4X2WA 4BAMB 1ANCA 1G32B 1TABE 4A5TS 3A89A 1A61H 5EJZA 1C1VH 4TYDA 4UD9H 5C67A 1N8OC 1DY9A 3RXJA 3G01A 5GPIB 1C5UA 1WOFA 3LGUA 1ZLRA 2FTMA 1OYTH 2RDLA 4GAWA 4TWWA 1Y3VA 2BQ7B 3C27B 2BVXH 3ZZ3A 1XUJA 3EQ0H 2L74A 5JBTA 2QF4A 1ANEA 3BTTE 3FP8E 1ZSLA 4JYVH 1NRSH 4WY3A 1C5MD 2F9NA 2J97A 2EQNA 3L3TA 4TPIZ 3SHAH 2ZI2H 3QGNB 2BVSH 3K6ZA 1EPTA 1LVMA 2EY4C 1V2LT 3RMLH 2W6JD 1KXFA 1WTHD 3U1IB 1VITH 1KLIH 1BZXE 2XXLA 2ZWLH 2Y6TA 1SPJA 2JETC 5L30H 4FOUC 1MTWA 4LZ4B 4WMDA 5FCRA 4O97A 3UREA 2BD8A 2ZPQA 3GDUA 2VINA 5F53A 2XC0A 2A5IA 2QF5A 1HAZB 2HGTH 1GCTC 8GCHF 1W0YH 1TQ0B 2BLQA 1MMJN 3M35A 1EZQA 5CHAB 1BMAA 1VGCB 1C5PA 3T2NA 1E34B 1THPB 1Z71A 3TGKE 1ZHMA 3ENSB 3PM3A 1SBWA 1D4PB 1O3IA 4ZKRU 1DLEA 1SGCA 1TYNA 5B6OA 5GJ4B 2VIQA 3R0FA 4WVPE 2BDGA 2PWXA 1GVKB 2V6NA 3AW0A 7GCHF 3U69H 1ZYOA 2Y81A 1FIZA 1EXFA 4B2CA 4WF8A 2RDEA 3RXTA 2BDYA 1MH0A 2BDBA 3KL6A 3R3GB 3ATIA 1TMTH 1EAIA 3HK6B 4JYTA 3BEUA 1CSOE 4YT6H 1FMGA 3MU8A 1JMOH 4AFUA 1GHXH 4INKA 3F3BA 3F6UH 5CE1A 2HLCA 4F55A 3M61U 1UK3A 3WW7A 1HLTH 4E05H 1DSTA 1C5LH 5DG6A 4ASHA 1GI7B 2V35A 1VITF 2KAIA 1FONA 5DK1A 3UB0A 1W0ZU 2XNIA 5TCCA 2PP6A 2IOTA 2H5CA 3M7TA 2GCHF 3SUFA 1GJ9B 1YKTA 4CRGA 2OC0A 3A83A 1HIAA 1UTPA 3BTDE 1UTOA 4ZHMU 1O2PA 4BTTB 2KZ4A 1N6YA 3URDA 4IC6A 1SQTA 3UWIA 4X8VH 1CGJE 1XXFA 3SHCH 1NN6A 1YWUA 4ZXXH 2ODPA 3A81A 5T6DA 3VG8A 1BMLA 1CT4E 1N6XA 2VWMA 5T6FA 2BY5X 3KQ5A 1O3LA 2IPHA 1P2KA 2GZ8A 2GX4A 5J4SA 1CA8B 2J98B 2Z7FE 4X1PU 2NU3E 1EJMA 1KXAA 6GCHF 2W3KA 3RXDA 3PB1E 2FLBH 2VH0A 1GGDB 1SQOA 4NA9H 1KIGH 1YPLH 4BAOB 2FO9A 1ZZZA 2BVRH 2Q6FA 1IQHA 3N7EA 4BANB 3AASA 1ZOMA 1MCVA 4DJZB 9ESTA 4MNWA 2BOKA 2Z9JA 1GI0A 5ESTE 4M7GA 1W8BH 1WU1A 2OLGA 3PLPA 4WXVA 1NROH 3HATH 1BRAA 2QA9E 1O2LA 1S82A 1BQYA 2NU4E 2NU2E 1C2IA 4NG9H 4NWLA 2SGFE 1CQQA 1O3AA 1ZMLA 3PMBB 1ELTA 1SGPE 2AFQB 2PTNA 3D23A 1GDUA 5LPEA 2GD4B 2ANKH 3PROA 1GJ4H 3ZVAA 4CRAA 1ZTLA 1O2OA 2Q6DA 4NA7A 3ZVCA 2ZZUH 3MH7A 2Z3EA 3SV9A 1PPGE 1K1JA 2ZFRH 1C2GA 2Z9KA 4AFZA 2CJIA 1BHXF 1S5SA 3GY3A 5DSFA 3ZIAD 1C9TA 1MTVA 2ZC9H 3MU0A 4FETA 3SU5A 5FPYA 1AD8H 1BBRK 1V2NT 2BQ6B 1QR3E 4D7FA 3MOCA 3M36A 1HAOH 3UY9A 4INLA 1A4WH 3ZVDA 1T7CA 2ZP0H 2HALA 3I29A 1MKWK 2PKAB 4I32A 3BG4B 2EI7A 2PHBA 2A4QA 1H8IH 3OEED 4OS6A 1QL9A 5F8ZA 4GPGA 1HB0B 5C1UA 1GCDA 1ELVA 1YCPK 1DWDH 3LT3A 1V2ST 2ZKSA 2SGDE 3T62A 1BCUH 1YPGH 2HLDD 1O2NA 1K28D 3HKJB 1OWHA 3L33A 1MKXH 1O2XA 4Q4LA 1NFWA 3VXFH 5C5NA 1HBTH 2XW9A 3F0OA 2Z6BD 4BXWA 1C5VA 1MTUA 3ZZ4A 4DOQA 3M3TA 2BDIA 3SI4H 1K1PA 1C1WH 3Q3XA 3GY2A 3DFLA 3CENA 3LIWA 1W7GH 3LGVA 3TGJE 1OYQA 1DANH 5JPMH 2OQ5A 1ACBE 2P8OB 3LH3A 3P92A 2G4TA 3NXPA 1BRUP 1SI5H 1O3MA 3BTEE 3UNSA 2XBXA 3PLBA 4XSKU 2BQWB 1VKYA 4FUCA 1OP8A 1GMHF 2Z3CA 4YOGA 2SFAA 1H8ED 3KHVA 3PRBA 5FPTA 2K0QA 1OWIA 1ANBA 5HIZA 1YPKH 4YESB 3STIA 1GI5A 1GI6A 1RGQA 5EQRA 5C17A 2FTLE 1QBNA 3EE7A 3K2UA 1ETSH 2UUFB 3VGCB 3RXQA 1J8AA 1O5DH 1W3CA 1QIXB 2KCPA 5FHTA 3H7OA 3UPEA 2P59A 2ZFFH 1PFXC 1DOJA 2V0BA 2YMSC 1O33A 5AHGH 2W7UA 1NBME 2FX6A 2XNDD 1QRWA 3Q77A 5A0CA 1ZJDA 1GBMA 3P8NA 4J2YB 2AMQA 1DS2E 1QCPA 3A7XA 3PV4A 4WMFA 1F2SE 1FY3A 2DUCA 1RTKA 1TX7A 2PGBB 1AGJA 4H4FA 1GBFA 1O2GH 1LCYA 5I46H 1YP9A 1PPFE 4FUJA 3PYHA 2HRVA 4AYYB 1T32A 2F9PA 2ZF0H 3DCLA 3PO1B 1SGFG 3T29A 5EG4A 2F3CE 1T8NA 3RM2H 1T8MA 3W95A 3QK1A 3V7TA 1HAVB 1FN8A 2TIOA 1UTLM 4YZUA 3HGPA 1O2JA 1NM6A 1HYLA 1QB9A 1ZGIA 2ODYB 1ZSKA 2QN5T 5EJLA 2CHAB 3ZVFA 4Y7AA 5C1XA 5AFYH 2BZAA 2BZ6H 1GJ8B 4Y76A 4YXWD 2WUBA 4IS5A 2EA3A 2IJOB 2ZA5A 2ULLA 1MTNC 1HXFH 4ABBA 1LPZB 1SGFA 2PW8H 1OS8A 3QTOH 1GBKA 3F2HA 1A0JA 1EUFA 1L4ZA 4ASUD 5GNDA 4Y8ZA 1A2CH 3MU4A 3MNXA 1Y3YA 5C5OA 4IC5A 3VB5A 5FX5A 3A8AA 2YMSD 2I6QA 1BUIA 4MPVA 3PTBA 2V3HH 1MD8A 4Y7BA 4X6PA 6CHAC 1F0RA 3VB6A 2OTVA 1W7XH 3E3TA 5FXLA 4LOYH 2XCFA 2ZEBA 3KEEA 4IMQA 3KQEA 5FL7D 3TJVA 2H5DA 2FDAA 3SORA 1HDTH 2PUQH 3RXRA 3DD2H 4WH6A 3RM0H 1EAXA 1ESTA 4FUFA 4Q2KA 1EZSC 1P02A 1SR5C 1Y5AT 2VIDA 3ZVBA 1BRCE 5LGOA 1GMDF 3A7TA 2FS9A 3E16B 3FANA 5A0BA 3M7QA 3SJ8A 1XM1A 3TLOA 5F03A 4GCHF 1BTWA 4NZLA 4SGBE 4AB8A 1W0JD 3OX7U 1BT7A 4K5ZA 1IQEA 4X8UH 5HIYA 1QHRB 2WPIS 5CHAC 5CMXH 1VGCC 4ABJA 1LDTT 1HXEH 3P8FA 2P3FH 1PYTC 1MCTA 3GOVB 1NRNH 4B2AA 1TPSA 1GHWH 3T25A 1O3EA 5FAHA 5JBBS 4AFSA 2QGRA 3AK5A 2FP7B 3RXUA 2P3TB 1C1UH 5C0TA 2XWBI 1BMNH 2R9PA 2VIOA 2ZGXH 2ZO3H 2A4OA 1GI4A 2FI5E 4K69A 1BMFD 3LGWA 2TPIZ 4CRCA 2F9OA 1NC6A 1B0EA 4J1YA 1NS3A 1UK4A 1UCYK 1Z1JA 3UQVA 4DY7B 1OXGA 3A82A 4IW4E 1SGYE 3ZZDA 4Y0YE 7ESTE 3ELAH 5EQSA 1A0HB 1GHAG 4RSPA 4B2BA 1NTPA 2OC8A 4X6OA 1N1LA 2QXGA 3T26A 1C5OH 2QF3A 1O32A 1PQ7A 2FX4A 4FVBA 2WYJA 4OM9A 1D3PB 1NRRH 4ZKOU 1LO6A 1P10A 2G5NA 1PYTD 1OWJA 2WPDD 2QAAA 3SNEA 5GIBA 3SU3A 2CXVA 3BTQE 4JK5A 1EFRD 1UTQA 2ZDLA 4XOJA 1NBMD 3UAIC 1CHOF 1GBIA 5E2OA 3BF6H 4ISHH 2VVVA 4UE7H 4P02A 2JKHA 2C93B 1CT2E 1ELBA 4D8NA 4BNRA 4U2WA 3ZZBA 3M3SA 4GCHG 3HK3B 4Z0KA 2Z9LA 2XBVA 1GGDC 3EA8A 3RXOA 1O5EH 3VXEH 1C5RA 1GBDA 3EGKH 1CGIE 3V12A 1EJAA 3RLYH 1C2EA 1DM4B 1XKBC 1SB1H 2P3UB 5AVDA 3AVZA 1DLKB 4TPYA 3GISB 2J2UA 2BY6X 3MNCA 4R0IA 3GY4A 1O2IA 2K8IA 2RCEA 4H6SB 1TAWA 2FOCA 4KTCA 2KR7A 3A88A 1HAPH 1WAYB 3WY8A 4DW2U 2TGPZ 3Q3KA 2WHXA 3RXLA 1C5TA 1E0FD 1A7SA 2O8MA 2PGQB 1TFXA 3W94A 1H8DH 1AQ7A 3OTJE 1O37A 1GJDB 2ZPRA 2W26A 4U01A 1YF4A 3QTVH 4JZ1A 3QX5H 5DJ7A 1MQ6A 2ESTE 4ZROA 1A5GH 4YM9A 2BB4A 4ABIA 1EQ9A 3O8DA 3TPIZ 1IQJA 3TK5A 4CHAB 3ATWA 3GCHB 1J17T 1CVWH 1KTTB 3MO9A 4XRNA 3RXHA 1A5HA 4MNVA 2BDHA 4JZDH 1RD3B 4NIXA 1UJ1A 3F1SB 4U32A 3BG4C 1TNJA 1C1OA 3E1XB 4F4OC 3TJNA 4D9RA 4K3JA 7LPRA 3SU2A 2AGGX 1O3GA 2OINA 3BIVH 1W14U 5A0AE 2M2AA 2JH5D 1AWHB 3WWFA 2HPPH 2PLXA 3CS0A 3SU1A 1NO9H 1GPZA 1SSXA 3WWBA 4ISIH 2XBYA 3A8BA 1WDIA 4SGAE 1DVAH 1HAHH 1TBZH 3LPRA 3FO8D 4LK4A 3AAUA 1GHBF 2GCTB 2ZU4A 3QDZB 1O3CA 3RXBA 4MG3A 1GBAA 2P8OC 3S9CA 3GCNA 2QY0B 4E06H 1HAGE 3F9HA 3LGYA 2J34A 2ZGJA 3Q76A 1AFQB 1T8OA 1P2MA 1W2KH 1AWFH 1XMNB 2VNTA 3DSOA 2F83A 1KDQB 1UTNA 1QNJA 1QFKH 5E0HA 3TJOA 2BY8X 2UUJB 3UQOA 4RT1A 1DFPA 3K6YA 1U6QA 4GHTA 1E36B 4YTAA 3RXSA 2HOBA 1D3TB 5C3NA 1IQLA 2VWOA 1FY1A 2SGPE 3ODFA 3MO3A 1IHTH 4HTCH 4E7NA 1GJ5H 2FOGA 3RXFA 3VGCC 3SU0A 1Q2WA 1ZHPA 1NT1A 2GJGA 3KIDU 3CNRA 3MH6A 2VBCA 2UWPA 4CBOA 1TA6A 2GDEH 2BOHB 3SUEA 3ZVGA 2LELA 2FYRA 4NCYA 1FQ3A 3QWCH 1V2RT 3LJOA 3PMAB 2EI6A 1P05A 2XYAA 1BITA 2QXJA 3PMJA 4Q7YA 4RKOB 3HKIB 3PO1C 4I7YH 1MUEB 1AMHA 3B9FH 2I6SA 1EASA 1S0RA 1TBRH 2VJ1A 1IQGA 1O2VA 1G3DA 1VJ9U 4FUBA 3SZEA 3LDXH 1BTYA 3SQEE 2A1DB 1QTFA 3NWUA 4O9VA 4WJG2 2G8TA 3FOAA 1SLVB 2J4IA 2CHAC 1FDPA 3BG8A 2C3SA 3OY6U 1UVTH 2HVXA 1EAWA 2R3YA 1RTFB 1WCZA 3S7HB 3GCTF 4NIYA 3TK9A 1SVPA 2GV6A 1MBMA 4CBNA 2GTBA 2KCAA 1YPHE 2LNCA 2VU8E 1P11E 1TPAE 1F0UA 3NK8A 1PQAA 1Z6JH 4YT7H 1NU9A 1P2NA 5F6MA 4MDSA 4AC9A 2G4UA 5ESBA 1P8VC 1V2JT 3NRLA 1IQKA 2ZHFH 2PFEA 3E0PB 1ESBA 3A7ZA 3QZRA 1G2MA 4HZHA 5DP6A 1TNKA 2ZHQH 2WYGA 1RFNA 4X6MA 5DP3A 3N99A 1TMUH 2D26C 2XWAA 3M5MA 2XC4A 5SGAE 1DY8A 3DA9B 2BD3A 3LH1A 8GCHG 3SUDA 1QBOA 1MKXK 2F91A 2VVUA 1GJBB 4NFEA 2TGAA 1TX6A 2KAIB 1K21H 4MLFB 1G2LA 1V2VT 3GY7A 1M9UA 1D3QB 1E1RD 1SQRA 3SYJA 3UWJH 1QB6A 4WWYA 7GCHG 2KM0A 3FP7E 2J38A 3EAJA 4K8YA 1PQ8A 5C1YA 1D6RA 1BBRE 1X7AC 2A45B 3OEHD 3MH4A 1BTHH 2BXTH 3F9EA 1P09A 1GBJA 4K2YA 1KXEA 4NSYA 4OGYA 3KQDA 2ZCLP 1MTSA 3ZZ8A 1MZDA 1LPGB 5I25A 4WXIA 4DIHH 4IMZA 1BTZA 1ELCA 3SJ9A 3Q3YA 2ZDKA 4I33A 1PPEE 1C2HA 1SGQE 2FM2A 2QE7D 1VITG 2QF0A 1HJAB 3RC5A 4I31A 3MO6A 4HG6A 2C4FH 4B73A 3RXGA 2B5TB 4XD7D 3GDSA 1JIMA 2GCHG 1FV9A 2A2QH 1TBQH 3BTHE 3SGAE 4UEHH 1C1TA 1E1QD 1Y3UA 4YOJA 3TU7H 3FFGA 5EQQA 4B74A 6LPRA 5JB9S 1GBTA 1ANDA 1CBWB 1GL0E 1Y3WA 3F68H 5LPFA 1C1RA 2G81E 1LVOA 3GDVA 2BD2A 3M37A 1GDQA 4FU8A 3SOSA 1S83A 2CF8H 1JOUB 4OS5A 1KLJH 4UFGH 3K65B 2IJD1 2TRMA 6GCHG 1O2KA 1PPCE 1RJXB 1WQVH 4IN2A 3TVJB 3KNXA 1O2UA 1L2EA 2OQUA 1AB9B 2Y5GA 3JZ1B 3ZZAA 3U1JB 1MU8B 2F9BH 5ETXA 5FBEA 1QL8A 1L1NA 1K9OE 1ETTH 3P70B 2J95A 1W10U 1Y59T 2NU1E 4ABHA 4AZ2B 1IQIA 2KCYA 1Z6EA 1AUJA 2BTCE 3PWCA 5L6NH 2TBSA 3OYPA 1EATA 1UHBB 1LHDH 1SHHB 2GZ7A 1XUHA 2A5AA 4TSFD 5FBIA 1F0SA 1SG8B 1XUFA 2VWLA 3VFEA 3LC5A 1C1NA 1HAYB 5K7RA 2ZIQH 2RG3A 1NU7B 2GZ9A 1HAVA 1AFEH 1HV7A 1O0DH 1QJ6B 3MWIU 2JDID 1XVMA 1KXDA 3RU4E 5EW1H 5L2YH 2B0FA 1DWCH 1TLDA 3LONA 2AGEX 4DVAU 2JETB 1P2JA 1H9LB 3EDXB 3LKWA 1QRXA 3OE7D 3SNDA 3MHWU 4Z1MD 1ARBA 2H2ZA 1HJ9A 1FIWA 1LVYA 3TIUA 2PKSB 2IPQX 2Q1JA 2O8LA 5E2PA 4RI0A 1RTLA 1T31A 1GCTB 1YC0A 5EIYA 3FKSD 1YPJH 4JZEH 5DP8A 1PPHE 3RC4A 3UTUH 1VZQH 4YO9A 1XUIA 1O2RA 5JBAS 3MMGA 3RXMA 3A7YA 5C0UA 3UFAA 4D76A 2VGCB 1GBBA 1YPEH 4CHAC 1G36A 3E6PH 3TH4H 3KN2A 3GCHC 3SGQE 2WSSD 1GI3A 2OBOA 1O5AB 5KEDA 1OSSA 4FU9A 1NZQH 1L4DA 4B76A 1HRTH 1YYY1 3A8DA 4ABDA 4TT3D 2GVFA 1BOQA 5DP7A 1TPPA 3O8BA 2DE8A 1L1GA 1O2SA 4ZHLU 1TGSZ 1GI8B 1AVXA 1SLWB 2KX4A 4GLYA 4KGAA 5JB8S 4X0WU 5HM2A 4NZQA 2NU0E 2ASUB 4DG4A 4MNXA 5EXMA 1V2WT 5GWZA 2BLWA 4ISNA 2AYWA 3KQBA 2PSYA 1SQAA 2WPMS 1O30A 2FOBA 3T28A 2HNTE 3RXPA 1FLEE 2UUKB 1EB2A 2V7QD 2GCTC 3ATMA 1OP2A 3RU4T 3SV7A 1BTXA 1Z8IB 1HAIH 2ZU1A 1GI1A 3SJKA 1SHYA 4HGCA 2JJ1D 1GMHG 1JBUH 1V3XA 4HFPB 1VCPA 1HAXB 1EJNA 4B6EA 1O34A 1F5KU 1S6FA 3O8CA 3F0PA 1OKXA 3SU4A 2FIRH 1NRPH 1Z1IA 4FVDA 3F2FA 1SOZA 4GUXA 4Y11E 5FCKA 1AVGH 4UFDH 2ODQA 1KY9A 2ZTYA 3PV5A 2Y82A 3LOXA 2WV9A 1GWAA 1TOCB 1IQNA 1CGHA 2JJ2D 1V2PT 3NUMA 3A87A 4KP0A 5E0JA 2ZFPH 1O3DA 1BA8B 1QRZA 2OXSA 2WV5A 4VGCB 1SOTA 3DSGA 2FMJA 3EA7A 1KTSB 1SKYE 1F7ZA 3GYLB 1TALA 5F8XA 5AFZH 1GHVH 4BTUB 5A8ZA 1O2ZA 1DDJA 4X2VA 3B8JA 3VB3A 1XUGA 4A7IB 3P95A 3A7VA 2EEKA 1UCYE 3UUZA 1Z8GA 1AI8H 3OSYA 1ARCA 1AU8A 1ZRBA 1UO6A 4A92A 1SFIA 3FZDA 1CT0E 1FJSA 1OWDA 5A2MH 5E0GA 1G3CA 3ZYDA 1J15A 1BIOA 3A7WA 4CR9A 9LPRA 1GL1A 1VR1H 2KCOA 1FX0B 2Q6GA 2CN0H 1NRQH 1GG6B 1C5NH 2EC9H 3ZV9A 3RXVA 1RIWB 4UFEH 2G51A 1LPKB 3ITIA 3BN9A 5EPYA 1HGTH 3TJUA 3M3VA 2WZQA 5HYOA 3QO6A 1K1NA 1GMCF 1YCPM 1ELFA 1NFXA 5IYTA 5CDFE 2PV9B 2STAE 4JCNA 2A4GA 4JMYA 3PWBA 1NY22 4NIWA 5GCHF 3MTYA 3NKKA 3Q00A 4IN1A 1O5CB 1A3EH 3FN8A 1L1JA 1O36A 2P95A 1Z8JB 2GMTB 1AKSB 3P8GA 3U98H 1P9UA 4MQAA 4AFQA 1MZAA 1O3JA 3P17H 1V2TT 1AIXH 1UVUH 1FY5A 3FVFB 4O03A 1GMDG 3OTPA 2ALVA 1FXYA 4BTIB 1K22H 2FOAA 1TNHA 1OHHD 1MQ5A 2QCYA 4UONA 1DUEA 1RRKA 3U8TH 2ZQ2A 1E35B 1VCWA 2G00A 5L2ZH 1E37B 4NGAH 1V2KT 1C4Y2 2VB0A 3RLWH 4OS4A 1FAKH 1WTGH 1H8HD 1ZJKA 3MU1A 4JZIA 2BX3A 8LPRA 3FAOA 2G55A 1KLTA 3KGPA 4K60A 1G9IE 4OS7A 1SFQB 1LHEH 1OX1A 1WYKA 3MNBA 4TWYA 1O3OA 2R0LA 2AGIX 3LGTA 5IK2D 4U30A 4ABGA 5J4QA 3DSPA 1P01A 1QA0A 2FEQH 4ZAEA 1QURH 1J16A 4GVUA 2BHGA 3QGJA 2BD4A 4I8KA 3SNCA 1SGDE 2LPRA 2AERH 2YOLA 3BIUH 5EODA 3TNTA 1QJ7B 3BTGE 3LU9B 5E8EH 1SC8U 5GDSH 2C8XB 1UVPA 1W13U 2XRCA 2Y7XA 1TNIA 2J94A 5EJ1A 3A84A 1K1LA 1UCYH 2R3UA 1O3PB 4RN6A 3UR6A 5JBCS 1JWTA 1Y8TA 4KKDA 3TH3H 1A46H 2B8OH 2M5TA 2XOKD 1EAUA 1HJAC 1EP6A 4OGXA 1T8LA 2OD3B 4ISOA 3ZYEA 2ZQ1A 1GI2A 1FNIA 1P2QA 3H5CB 3TK6A 1ZPZA 2AH4X 2D1JA 3EA9A 1KXBA 2Z9IA 1UVOA 2R0KA 4ZKSU 1DE7H 1TA2A 1BB0B 5DPAA 2O8WA 1AO5A 1MBQA 1ZGVA 4Y0ZE 3TH2H 4DT7B 1HCGA 3MFJA 1CBWC 3RC6A 4B6FA 2UWOA 2ZGBH 1W0KD 4MVNA 1MABB 3CS7A 4KTSA 4Q7ZA 2FOFA 4UDWH 2C8YB 4X1QU 1KDQA 3SV6A 1CHOG 2BY9X 2A4RA 3RP2A 3NZIA 2WPKS 2SNVA 3GCOA 1DT2A 1C5QA 3STJA 2ZFQH 1COWD 1C4V2 4ABAA 1TIOA 3QUMP 5JDUB 2V3OH 4TY6A 1K1IA 1AB9C 2BDCA 3N7DA 6ESTA 1O2QA 4O3TA 2AMDA 2J9NA 2ZFTA 3NCLA 4AYVB 3KF2A 3SU6A 3I77A 1D3DB 2Y7ZA 1ZTJA 3S69A 3SN8A 5A8YA 1P2IA 3F9FA 5T6GA 3A8CA 4XBBA 1IAUA 6CHAB 1TRNA 3V3MA 3E91A 1O3BA 1O3KA 5H4IB 1BMMH 2XCNA 1SLXB 1SGRE 2W6ID 1SGEE 3C1KA 1RXPA 1OOKB 3BSQA 4Y10E 1C5WB 1O39A 1TPOA 2ANWA 3LJJA 4DT4A 1ESAA 3H09A 1ZPBA 3E90B 2ZG0H 3F9GA 3IITA 4TY7A 1BTPA 1UTKA 1P12E 2OC7A 2O8UA 2OK5A 2O8TA 1TX8A 1P04A 2ZGCA 1L0ZA 1C5YB 2KFWA 2PKSC 2GV7A 2ZHEH 1GJAB 3GY6A 5DP5A 1QB1A 1ZMNA 1ZRKA 1VJAU 1TGCA 1JXPA 1FZZA 3SNAA 4NFFA 1JRSA 1EPTB 2FLRH 1LKAA 1LMWB 4R8TB 4XBDA 2AMPA 3S9AA 4WMEA 2YNBA 2FYQA 2VGCC 1SLUB 2IN2A 1S0QA 4I8JA 3SO3A 1FPCH 4Y8XA 1CU1A 1O31A 1TMBH 4I8LA 1IQFA 1DITH 1F0TA 1DPOA 1EZXC 2ALPA 1V2OT 3HGNA 2AEIH 3VB7A 2JH6D 5ABWA 4DIIH 2FXRA 4ZKNU 2FPZA 1QBVH 2WPJS 3P6ZB 3RXAA 2ZDAH 4Q80A 1GHBG 3E0NB 4BAQB 2G5VA 2J98A 3FZZA 4KELA 1AVWA 1O2TA 3MI4A 1S6HA 4A1TA 1B0FA 4NIVA 5EGMA 3ZZCA 5K0HA 1ZR0A 1TQ7B 5EPNA 2BMGB 3UIRA 3U8RH 2ZTXA 2QV1A 2H1UA 3T5FH 2VVCA 3UOUA 2STBE 2ANMH 1GJCB 1UK2A 2WV4A 1QQUA 1EX3A 1O5BB 3V13A 2HVYB 1DXWA 4HI3A 5C94A 1O2YA 2ZNKH 2BXUH 2ZDVH 3ESTA 5C20A 1UVSH 4FU7A 3SBKA 3A80A 2Y5FA 1TRMA 4X1RU 2H9HA 4ISLA 2AS9A 4DCDA 1Y5UT 4B71A 4THNH 1Z8RA 2GT8A 3DT0H 3M5LA 2ZCKP 1NFUA 4YLQH 1C1SA 1GI9B 4B75A 2QXHA 1QJ1B 1FPHH 4VGCC 4I8GA 3V0XA 5PTPA 1A5IA 7KMEH 1CA0B 4ZMAH 1A1RA 1HUTH 3S0NA 1O3HA 4K8BA 1HIAB 1GVLA 4X1SU 2L6OA 3D49H 4X2YA 2PKAA 2Y80A 1D6WA 2CK3D 4CH2B 4ACAA 3RXCA 1DICA 1WBGB 3ZVEA 1UW7A 2H9TH 4K1SA 2ZDMA 1ELAA 1P03A 4UFFH 1QA7A 4DURA 1C5XB 5T3HA 1IOEA 3UR9A 1H4WA 1XVOA 3GYMA 2D2DA 1K1MA
chains in the Genus database with same CATH topology
1P57B 2XC5A 3A86A 3D62A 3GCTG 1FUJA 1GG6C 1GHYH 1TB6H 5TJXA 2GP9B 4H6TA 1RIWC 3VEQB 2FI3E 3LGIA 1O38A 4X8SH 2CMYA 3RDZA 2F9UA 2B9LA 4MPXA 5EOKA 1P3CA 1O2MA 1BDAA 2OUAA 3AAVA 1H9HE 4IBLH 1ABJH 5IDKA 2ZU2A 1AZZA 4QT8C 3BV9B 4CH8B 4RKJB 4GHQA 2BYAX 2FOEA 2A7JA 1TNLA 2BDAA 3IWMA 4AX9H 1PPBH 4LXBH 1AUTC 1YPHC 2QXIA 1UHBA 2GMTC 3S7KB 2WPLS 4O3UA 2VIWA 3M5NA 3OU0A 4AN7A 1Q3XA 3ZV8A 4AGJA 4ABEA 4F49A 4BAKB 3RUOA 3U9AH 2OP9A 1EKBB 1Q31A 1TGNA 2FI4E 1N8OB 4Y8YA 4ABFA 1C2DA 4X8TH 5FX6A 1AN1E 3D65E 5F8TA 2VWNA 1O2HA 1QQ4A 1Y5BT 2SGAA 4CRBA 1HNEE 1F5LA 1AE8H 4CR5A 2ZGHA 1LQDB 2A0QB 1LQEA 1THSH 2BX4A 2XTTB 4AOQA 1RS0A 2A2XH 1SMFE 1LKBA 3GY5A 2OBQA 1P06A 1BJVA 2C90B 1B7XB 2NWNA 2BY7X 1XX9A 4NSVA 4MPUA 1O3FA 2ZTZA 2A32A 2RA3A 3TNSA 3ODDA 1V2UT 4FUIA 1ZTKA 2R2WU 1KSNA 2FODA 1TGBA 2FS8A 1LHGH 5DP9A 1J14A 4MNYA 2K1QA 2Y5HA 1NFYA 1YLCA 1XKAC 4Q7XA 1YPMH 1VCQA 4I8HA 2Z3DA 2R2MB 3I78A 3EE0B 3SJOA 2THFB 2WPHS 2WUCA 3DUXH 1ZMJA 3N7OA 1J9CH 1TONA 1FN6A 2ILNA 4OS2A 1BBRH 1GBCA 8ESTE 1TOMH 1H1BA 2TGTA 1K1OA 3SJIA 3SV8A 1TGTA 2C8ZB 1C5ZB 1MKWH 3RMMH 2BD9A 4ZH8A 3BTME 1D9IA 3T27A 3KQCA 5LPRA 1EOLA 3ATLA 3RXEA 2H9EH 1AHTH 1WQSA 3A85A 1H9IE 1OP0A 1Z7KA 5LH8A 1THRH 1ETRH 1UMAH 4AORA 1C2MA 1YCPH 3BEIB 4XDEA 3QN7A 3SQHE 1TNGA 1OWKA 4XBCA 1LHCH 2GDDA 2ZECA 3SNBA 1XXDA 1P2OA 2SGEE 1C4U2 3RXIA 1LVBA 3SV2H 1C1PA 5JYIA 5EXLA 4GSOA 1OWEA 2J92A 1WUNH 1DXPA 2SGQE 3BTKE 3NPSA 1FY4A 3M5OA 5FPSA 4ZUHA 1C1QA 1IHSH 4A6LA 3UNRA 3IG6B 3URCA 5C2ZA 2QYIA 1GBEA 3GICB 3AW1A 3H7TA 4MPWA 5A8XA 1E38B 1G37A 4FUHA 1KYNA 1AZ8A 1C5SA 5DO4H 3PLKA 5TCAA 1AY6H 3SI3H 2ZU5A 2QC2A 1BJUA 1CO7E 1SGTA 1BHXB 1AFQC 1HFDA 1O5GH 1FAXA 1KXCA 2GKVE 1GHAF 2ZPSA 4D7GA 2ZFSA 1FI8A 3ZZ6A 4A1VA 1YM0A 1GBLA 2PTCE 3MNSA 2W5EA 1AE5A 2QIQA 1ZHRA 1ZSJA 2Z9GA 3RMOH 5A09A 1FY8E 1EB1H 2DE9A 4D9QA 3QZQA 1JIRA 5EXNA 5BPEA 1S81A 4MTBA 1V6DA 4JYUH 5HXFA 1F5RA 1JRTA 3JZ2B 1C9PA 3TGIE 1QGFA 5DP4A 1O35A 2FOMB 1DSUA 1T4VH 5HM9A 2W3IA 1DX5M 3OY5U 1EOJA 1P3EA 2JH0D 4AG2A 3E8LA 3ZZ5A 1NESE 2OC1A 1UTMA 3DFJA 4FUGA 1EPTC 4YOIA 2ZHDA 1MAYA 2A5KA 3ZZ9A 4X6NA 2HPQH 1TWXB 5DGJA 1GBHA 1QY6A 1CHGA 3BTFE 4B1TA 2BD7A 1F92A 2P93A 1K2I1 1AKSA 1GVZA 3UNQA 3GY8A 4CRDA 4YLUA 1PQ5A 1P0SH 1WSSH 5DKMA 1HPGA 3MH5A 1ELEE 3SW2B 1C2LA 3LC3A 4LZ1H 3U8OH 3ATKA 2VH6A 4XFQA 1DWEH 4CREA 3MYWA 3RXKA 2OCVB 4WH8A 5BRRE 1O5FH 5EW2H 1BTUA 1OPHB 4BXSA 4X2XA 5AF9H 1ABIH 1GHZA 1EZUC 2AIQA 1O2WA 1WV7H 3FP6E 1ELGA 2A7HA 4NWKA 1G30B 2AIPA 4K1TA 2F9VA 2YNAA 2P94A 3RU4D 1V2MT 2FZZA 2HNTC 1IQMA 1CE5A 2RA0A 2P16A 4ESTE 3S9BA 3UOPA 4BOHA 1C2JA 2BLVA 3B23B 2UWLA 1DWBH 1A0LA 3SGBE 3CP7A 1S84A 4FXGH 5GXPA 2HWLB 4Z6AH 3O8RA 1A3BH 2ZCHP 2GGVB 1ORFA 3DHKH 3QLPH 2SNWA 1MU6B 3PMHB 2GT7A 4DGJA 1GJ7B 2BM2A 4K1EA 2EI8A 2ZU3A 1P9SA 3PTNA 2Z94A 2D8WA 1DUAA 1O3NA 4Y6DA 2A7CA 2WINI 5G4BA 3SZNA 2O9QA 2FWWA 1W11U 1CA0C 3EYDA 2CF9H 1EP5A 2G52A 1GJ6A 2H6MA 4AG1A 1NPMA 1G3EA 2PUXB 4JK6A 5HGGA 1SGIB 2ZHWH 2A31A 1C2FA 4E7RG 1ZPCA 4AGKA 1ELDE 1BRBE 3KCGH 1C1MA 2CV3A 4ZXYH 2FOHA 1MAXA 1C2KA 2VIPA 1SL3A 1T4UH 1YBWA 1SGNE 4ZHAA 1GDNA 3K9XB 4FUDA 4NA8A 3L6PA 4X1NU 1QL7A 4BAHB 4Y71A 1GMCG 2ANYA 3MU5A 1UTJA 4JZFH 3SUGA 2HNTF 2TGDA 1G3BA 3BEFB 4OS1A 1XUKA 5GCHG 1PJPA 1W12U 3BTWE 3RMNH 3M7UA 5EU8A 1YLDA 2UUYA 2ZDNA 2C8WB 1LHFH 2FESH 1TRYA 4FUEA 1Y3XA 4AB9A 3HPTB 4H42U 1S85A 2BLOA 1B5GH 3ZZ7A 3P8OA 2PSXA 1TE0A 1HJ8A 1PPZA 1INCA 2BD5A 4XE4A 2B7DH 4Y79A 2W7SA 4PROA 4CRFA 2VIVA 5HMAA 2CGAA 2PR3A 4IGDA 1YGCH 3VPKA 8KME2 4KTUA 1V2QT 1LTOA 2XBWA 3VB4A 4A1XA 1ID5H 3TITA 4INHA 1MTNB 1MD7A 4X2WA 4BAMB 1ANCA 1G32B 1TABE 4A5TS 3A89A 1A61H 1C1VH 4TYDA 4UD9H 5C67A 1N8OC 1DY9A 3RXJA 3G01A 5GPIB 1C5UA 1WOFA 3LGUA 1ZLRA 2FTMA 1OYTH 2RDLA 4GAWA 4TWWA 1Y3VA 2BQ7B 3C27B 2BVXH 3ZZ3A 1XUJA 3EQ0H 5JBTA 1ANEA 3BTTE 3FP8E 1ZSLA 4JYVH 1NRSH 4WY3A 1C5MD 2F9NA 3L3TA 4TPIZ 3SHAH 2ZI2H 3QGNB 2BVSH 3K6ZA 1EPTA 1LVMA 1V2LT 3RMLH 1KXFA 1WTHD 3U1IB 1VITH 1KLIH 1BZXE 2XXLA 2ZWLH 2Y6TA 1SPJA 2JETC 5L30H 1MTWA 4LZ4B 4WMDA 5FCRA 4O97A 3UREA 2BD8A 2ZPQA 3GDUA 2VINA 2XC0A 2A5IA 1HAZB 2HGTH 1GCTC 8GCHF 1W0YH 1TQ0B 2BLQA 1MMJN 3M35A 1EZQA 5CHAB 1BMAA 1VGCB 1C5PA 3T2NA 1E34B 1THPB 1Z71A 3TGKE 1ZHMA 3ENSB 3PM3A 1SBWA 1D4PB 1O3IA 4ZKRU 1DLEA 1SGCA 1TYNA 5B6OA 5GJ4B 2VIQA 3R0FA 4WVPE 2BDGA 2PWXA 1GVKB 2V6NA 3AW0A 7GCHF 3U69H 1ZYOA 2Y81A 1FIZA 1EXFA 4B2CA 4WF8A 3RXTA 2BDYA 1MH0A 2BDBA 3KL6A 3R3GB 3ATIA 1TMTH 1EAIA 3HK6B 4JYTA 3BEUA 1CSOE 4YT6H 1FMGA 3MU8A 1JMOH 4AFUA 1GHXH 4INKA 3F6UH 5CE1A 2HLCA 3M61U 1UK3A 1HLTH 4E05H 1DSTA 1C5LH 5DG6A 4ASHA 1GI7B 2V35A 1VITF 2KAIA 1FONA 5DK1A 1W0ZU 2XNIA 5TCCA 2IOTA 2H5CA 3M7TA 2GCHF 3SUFA 1GJ9B 1YKTA 4CRGA 2OC0A 3A83A 1HIAA 1UTPA 3BTDE 1UTOA 4ZHMU 1O2PA 4BTTB 1N6YA 3URDA 4IC6A 1SQTA 3UWIA 4X8VH 1CGJE 1XXFA 3SHCH 1NN6A 4ZXXH 5T6DA 2ODPA 3A81A 1BMLA 1CT4E 1N6XA 2VWMA 5T6FA 2BY5X 1O3LA 2IPHA 1P2KA 2GZ8A 2GX4A 5J4SA 1CA8B 2Z7FE 4X1PU 2NU3E 1EJMA 1KXAA 6GCHF 2W3KA 3RXDA 3PB1E 2FLBH 2VH0A 1GGDB 1SQOA 4NA9H 1KIGH 1YPLH 4BAOB 2FO9A 1ZZZA 2BVRH 2Q6FA 1IQHA 4BANB 3AASA 1ZOMA 1MCVA 4DJZB 9ESTA 4MNWA 2BOKA 2Z9JA 1GI0A 5ESTE 4M7GA 1W8BH 2OLGA 1WU1A 3PLPA 4WXVA 1NROH 3HATH 1BRAA 2QA9E 1O2LA 1S82A 1BQYA 2NU4E 2NU2E 1C2IA 4NG9H 4NWLA 2SGFE 1CQQA 1O3AA 1ZMLA 3PMBB 1ELTA 1SGPE 2AFQB 2PTNA 3D23A 1GDUA 5LPEA 2GD4B 2ANKH 3PROA 1GJ4H 3ZVAA 4CRAA 1ZTLA 1O2OA 2Q6DA 4NA7A 3ZVCA 2ZZUH 3MH7A 2Z3EA 3SV9A 1PPGE 1K1JA 2ZFRH 1C2GA 2Z9KA 4AFZA 2CJIA 1BHXF 1S5SA 3GY3A 1C9TA 1MTVA 2ZC9H 3MU0A 3SU5A 5FPYA 1AD8H 1BBRK 1V2NT 2BQ6B 1QR3E 4D7FA 3MOCA 3M36A 1HAOH 3UY9A 4INLA 1A4WH 3ZVDA 1T7CA 2ZP0H 2HALA 3I29A 1MKWK 2PKAB 4I32A 3BG4B 2EI7A 2PHBA 2A4QA 1H8IH 4OS6A 1QL9A 5F8ZA 4GPGA 1HB0B 5C1UA 1GCDA 1ELVA 1YCPK 1DWDH 3LT3A 1V2ST 2ZKSA 2SGDE 3T62A 1BCUH 1YPGH 1O2NA 1K28D 3HKJB 1OWHA 3L33A 1MKXH 1O2XA 1NFWA 3VXFH 5C5NA 1HBTH 2XW9A 2Z6BD 4BXWA 1C5VA 1MTUA 3ZZ4A 4DOQA 3M3TA 2BDIA 3SI4H 1K1PA 1C1WH 3Q3XA 3GY2A 3DFLA 3CENA 3LIWA 1W7GH 3LGVA 3TGJE 1OYQA 1DANH 5JPMH 2OQ5A 1ACBE 2P8OB 3LH3A 3P92A 2G4TA 3NXPA 1BRUP 1SI5H 1O3MA 3BTEE 3UNSA 2XBXA 3PLBA 4XSKU 2BQWB 4FUCA 1OP8A 1GMHF 2Z3CA 4YOGA 2SFAA 3KHVA 5FPTA 1OWIA 1ANBA 1YPKH 4YESB 3STIA 1GI5A 1GI6A 1RGQA 5EQRA 2FTLE 1QBNA 3K2UA 1ETSH 2UUFB 3VGCB 3RXQA 1J8AA 1O5DH 1W3CA 1QIXB 5FHTA 3H7OA 3UPEA 2P59A 2ZFFH 1PFXC 1DOJA 2V0BA 1O33A 5AHGH 2W7UA 2FX6A 3Q77A 5A0CA 1QRWA 1ZJDA 1GBMA 3P8NA 4J2YB 2AMQA 1DS2E 1QCPA 3A7XA 3PV4A 4WMFA 1F2SE 1FY3A 2DUCA 1RTKA 1TX7A 2PGBB 1AGJA 4H4FA 1GBFA 1O2GH 1LCYA 5I46H 1YP9A 1PPFE 4FUJA 3PYHA 2HRVA 4AYYB 1T32A 2F9PA 2ZF0H 3PO1B 1SGFG 3T29A 5EG4A 2F3CE 1T8NA 3RM2H 1T8MA 3W95A 3QK1A 3V7TA 1HAVB 1FN8A 2TIOA 1UTLM 4YZUA 3HGPA 1O2JA 1NM6A 1HYLA 1QB9A 1ZGIA 2ODYB 1ZSKA 2QN5T 2CHAB 3ZVFA 4Y7AA 5C1XA 5AFYH 2BZAA 2BZ6H 1GJ8B 4Y76A 2WUBA 4IS5A 2EA3A 2IJOB 2ZA5A 2ULLA 1MTNC 1HXFH 4ABBA 1LPZB 1SGFA 2PW8H 1OS8A 3QTOH 1GBKA 1A0JA 1EUFA 1L4ZA 4Y8ZA 1A2CH 3MU4A 3MNXA 1Y3YA 5C5OA 4IC5A 3VB5A 5FX5A 3A8AA 2I6QA 1BUIA 4MPVA 3PTBA 2V3HH 1MD8A 4Y7BA 4X6PA 6CHAC 1F0RA 3VB6A 2OTVA 1W7XH 3E3TA 5FXLA 4LOYH 2XCFA 2ZEBA 3KEEA 4IMQA 3KQEA 3TJVA 2H5DA 2FDAA 3SORA 1HDTH 2PUQH 3RXRA 3DD2H 4WH6A 3RM0H 1EAXA 1ESTA 4FUFA 4Q2KA 1EZSC 1P02A 1SR5C 1Y5AT 2VIDA 3ZVBA 1BRCE 5LGOA 1GMDF 3A7TA 2FS9A 3E16B 3FANA 5A0BA 3M7QA 3SJ8A 1XM1A 3TLOA 5F03A 4GCHF 1BTWA 4NZLA 4SGBE 4AB8A 3OX7U 1BT7A 4K5ZA 1IQEA 4X8UH 1QHRB 2WPIS 5CHAC 5CMXH 1VGCC 4ABJA 1LDTT 1HXEH 3P8FA 2P3FH 1PYTC 1MCTA 3GOVB 1NRNH 4B2AA 1TPSA 1GHWH 3T25A 1O3EA 5FAHA 5JBBS 4AFSA 2QGRA 2FP7B 3RXUA 2P3TB 1C1UH 2XWBI 1BMNH 2R9PA 2VIOA 2ZGXH 2ZO3H 2A4OA 1GI4A 2FI5E 4K69A 3LGWA 2TPIZ 4CRCA 2F9OA 1NC6A 1B0EA 4J1YA 1NS3A 1UK4A 1UCYK 1Z1JA 3UQVA 4DY7B 1OXGA 3A82A 4IW4E 1SGYE 3ZZDA 4Y0YE 7ESTE 3ELAH 5EQSA 1A0HB 1GHAG 4RSPA 4B2BA 1NTPA 2OC8A 4X6OA 1N1LA 2QXGA 3T26A 1C5OH 2QF3A 1O32A 1PQ7A 2FX4A 4FVBA 2WYJA 1D3PB 1NRRH 4ZKOU 1LO6A 1P10A 2G5NA 1PYTD 1OWJA 2QAAA 3SNEA 5GIBA 3SU3A 2CXVA 3BTQE 4JK5A 1UTQA 2ZDLA 4XOJA