5EGMB

Development of a novel tricyclic class of potent and selective fixa inhibitors
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
VTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a novel tricyclic class of potent and selective FIXa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Coagulation factor IX
total genus 11
structure length 54
sequence length 54
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 5egmB00
2WPKE 4Z6AL 1ZAQA 1W7XL 3HS6A 1ATEA 3TH3L 5KIRA 1HRFA 1G1QA 3TZIA 2W3IB 5JB9E 1N7DA 2J95B 3TK5B 4FM5A 4BTTA 2P3TA 3U73A 3CS7L 1PTHA 1A3PA 4NGAL 5IKQA 3M37L 2PR3B 4CUFA 1CQEA 1NFWB 3GISX 4MMZB 2Y5FL 1IJQA 3CA7A 2Y5HL 2Q1JB 2Y81B 2F9BL 5IKVA 3R05A 4ISHL 2XBVL 3SOQA 1AUTL 1IQFL 2W26B 4X8UL 3NT1A 4XL1A 4Z0KB 5JVYA 1URKA 1DVAL 1MOXC 4RUTA 1F7EA 1WHFA 1DIYA 2PUQL 2TGFA 4NA9L 3IJEB 2WPJE 4Y7BB 3NJPC 3HO4A 2BO2A 2VVCK 2GD4A 2Y38A 2FZZL 5IKRA 3KCGL 1G2LB 5I46L 3ENSA 5JW1A 4C16A 2FLGA 2K2TA 2NPRA 2WPLE 1CEJA 2P95L 1PFXL 3C9AC 4RS0A 1HT8A 2WPHE 2I9AA 4YZUB 1JBUL 2CJIB 3EGFA 2W2NE 1C5MF 1IQIL 1ATDA 1EQGA 2J94B 3LTFB 5JBBE 3SOVA 4BDWA 5COXA 1APQA 2P26A 1CVWL 2P16L 2BQWA 1IOEL 2XBXL 3KQDL 3MDLA 2G00L 3QMOA 2UWPB 4JYUL 2VWOL 3V65B 2Y82B 1NFYB 2BOKL 2XBYL 1EAIC 1GK5A 3LC3B 1UZPA 4PH9A 3LAQA 3OLUA 2FLRL 1FAXL 2BQ6A 2EI7B 3N8XA 2P93L 4AQTA 4Z0LA 2Y7ZB 2VWNL 3ASIA 1IGXA 1XDTR 1IQKL 6COXA 2P3FL 3HO3A 1IOXA 1HREA 1EPIA 3FBYA 4ZAEB 2VVVL 3IITB 2YGPA 4E1GA 1HZ8A 4RRWA 3SOBB 3ELAL 3ZYGA 5JBAE 3POYA 3HO5A 5F1AA 1WU1B 2UWLB 4Y7AB 1IQJL 1HCGB 1COUA 2WYJB 4X8SL 1YO8A 2J2UB 1HAEA 1PRHA 1UZJA 4M10A 1NFUB 1BF9A 3FCSB 5EGMB 4ZXYL 3ZYIB 1O5DL 3MQEA 2ADXA 1XFEA 1LMJA 3SW2A 1KLOA 4BDXA 1I0UA 1EPJA 2VVUL 1NFXB 1MQ5L 3K9XA 3M36L 1APOA 4LMFA 2WG4B 1EPGA 1IQML 3BPSE 2VWLL 1M1XB 3NTBA 3PGHA 4ZH8B 3HS7A 1DX5I 2UWOB 2YGOA 1FSBA 4XLWA 1LPGA 3RR3A 5KN5C 3TBDA 4RRZA 2XC0L 2Y5GL 3N8YB 4JZDL 2W2ME 1KLJL 1XKAL 5CKMA 2JKHL 2WFTA 1UZQA 3TK6B 3KRKA 2RA0L 3N8YA 1FJSL 3Q7DA 3GCXE 1SZBA 1TPGA 3GCWE 1EGFA 1TOZA 1LPKA 4D0EA 3CENL 1IGZA 1X7AL 1ATAA 3KQCL 2W2OE 3N8VA 1G1RA 4G1MB 2Y80B 1W8BL 2VH6B 5K0HB 2I9BA 2XC4L 2KL7A 1K37A 4D90A 1B9WA 1IQLL 3N8WA 4BTUA 4CUEA 4JYVL 3LN0A 2D1JB 1G1SA 1YGCL 4YT6L 4JZFL 4X8TL 3F1SB 4Y6DB 1QFKL 1IQEL 3N8WB 1KIGL 2AYLA 2P3UA 1DQBA 2DDUA 3KQEL 2J4IB 4BTIA 2BOUA 1HAFA 1P0SL 1IP0A 1NT0A 1JV2B 2MGRA 1V3XB 2RNLA 1HX2A 1U8CB 2P3FN 3LC5B 1FF7A 5L30L 1LPZA 2BOHA 4O1ZA 1WHEA 1L5GB 1IVOC 1DDXA 1U67A 4RRXA 5F19A 4BXSA 2BMGA 1EPHA 2OYEP 4A7IA 2VJ3A 1UZKA 1EMOA 4D0FA 3CFWA 1F0RB 5E8DA 1JL9A 5JBCE 3V64C 1G2MB 5JB8E 2WYGB 4X8VL 4M11A 4CSYA 3KL6B 2H9EL 2W2PE 4ZXXL 1YUGA 1ATBA 2PHBB 3U7UG 1Z6EL 2XC5L 1J9CL 1NPEB 1PGEA 2P94L 2Y7XB 2RHPA 3LN1A 4JZEL 2KV4A 3ZYJB 4ZHAB 1CX2A 1FE2A 4TGFA 1HJ7A 3Q3KB 1G1TA 4ISIL 1KSNB 2WPIE 5FDQA 1Z6CA 3BT2A 4YT7L 2W86A 3KK6A 2BZ6L 4OTYA 1PXXA 2XBWL 1NZIA 5CKQA 1HT5A 2FD6A 1K36A 2MGPA 2FLBL 4MMXB 4MMYB 2EI8B 1YUFA 4CUDA 5CKNA 4OTJA 1CCFA 2BQ7A 3DEMA 5L2YL 1L3YA 1IQGL 1F0SB 4XBMA 4Y71B 3N8ZA 1CCVA 4LORA 1IQNL 1N1IA 1Q4GA 3QCWA 2WFXB 1MQ6L 3TGFA 2K2SB 4RRYA 4COXA 1YUKB 1P9JA 5CISA 2J38B 3FFGL 2VH0B 1EMNA 3HPTA 2WPME 2P28B 3LIWB 1TLEA 2OYUP 3LTGD 4O02B 1RFNB 1LQDA 3F6UL 1ADXA 3NTGA 1IQHL 3H5CB 2WG3C 1OB1C 4Y79B 2B7DL 3QH0A 4Y76B 2M74A 2EI6B 5IKTA 3P5BL 3BT1A 2BOXA 1NQLB 2MHPA 1CVUA 1EZQB 1EBVA 1FFMA 1KLIL 4BXWA 2W2QE 3OLTA 1FAKL 1XKBA 5JVZA 5L2ZL 2J34B 3KQBL 1F7MA 2KB9A 1EQHA 2VWMK 4NG9L 2W3KB 3HS5A
chains in the Genus database with same CATH superfamily
2WPKE 4Z6AL 1ZAQA 1W7XL 3HS6A 1ATEA 3TH3L 5KIRA 1HRFA 1G1QA 3TZIA 2W3IB 5JB9E 1N7DA 2J95B 3TK5B 4FM5A 4BTTA 2P3TA 3U73A 4GU3A 3CS7L 1PTHA 1A3PA 4NGAL 5IKQA 3M37L 2PR3B 4CUFA 1CQEA 1NFWB 3GISX 4MMZB 2Y5FL 1IJQA 3CA7A 2Y5HL 2Q1JB 2Y81B 2F9BL 5IKVA 3R05A 4ISHL 2XBVL 3SOQA 1AUTL 1IQFL 2W26B 4X8UL 3NT1A 4XL1A 4Z0KB 5JVYA 1URKA 1DVAL 1MOXC 4RUTA 1F7EA 1WHFA 1DIYA 2PUQL 2TGFA 4NA9L 3IJEB 2WPJE 4Y7BB 1V1IA 3NJPC 3HO4A 2BO2A 2VVCK 2GD4A 2VRSA 2Y38A 2FZZL 5IKRA 3KCGL 1G2LB 5I46L 3ENSA 5JW1A 4C16A 2FLGA 2K2TA 2NPRA 2WPLE 1CEJA 2P95L 1PFXL 3C9AC 3S6XA 4RS0A 1HT8A 2WPHE 2I9AA 4YZUB 1JBUL 2CJIB 3EGFA 2HOXA 2W2NE 1C5MF 1IQIL 1ATDA 1EQGA 2J94B 3LTFB 5JBBE 3SOVA 2WZPP 4BDWA 5COXA 1APQA 2P26A 1CVWL 2P16L 2BQWA 1IOEL 2XBXL 3MDLA 3KQDL 1KKEA 2G00L 3QMOA 2UWPB 4JYUL 2VWOL 3V65B 2Y82B 1NFYB 2BOKL 2XBYL 1EAIC 1GK5A 3LC3B 1UZPA 4PH9A 3LAQA 3OLUA 4A94C 2FLRL 1FAXL 2BQ6A 2EI7B 3N8XA 2KNIA 2P93L 4AQTA 4Z0LA 2Y7ZB 2VWNL 3ASIA 1IGXA 1XDTR 1IQKL 6COXA 2P3FL 3HO3A 1IOXA 2HORA 1HREA 1EPIA 3FBYA 4ZAEB 2VVVL 3IITB 2YGPA 4E1GA 1HZ8A 4RRWA 3SOBB 3ELAL 3ZYGA 5JBAE 3POYA 3HO5A 5F1AA 1WU1B 2UWLB 4Y7AB 1IQJL 1HCGB 1COUA 2WYJB 4X8SL 1YO8A 2J2UB 1HAEA 1PRHA 1UZJA 4M10A 1NFUB 1LK9A 1BF9A 3FCSB 5EGMB 4ZXYL 3ZYIB 1O5DL 3MQEA 2ADXA 1XFEA 1LMMA 1LMJA 3SW2A 1KLOA 4BDXA 1I0UA 1EPJA 2VVUL 1NFXB 1MQ5L 3K9XA 3M36L 1APOA 4LMFA 2WG4B 1EPGA 1IQML 3BPSE 2VWLL 1M1XB 3NTBA 3PGHA 4ZH8B 3HS7A 1DX5I 2UWOB 2YGOA 1FSBA 4XLWA 1LPGA 3RR3A 5KN5C 3TBDA 4RRZA 2XC0L 2Y5GL 3N8YB 4JZDL 2W2ME 1KLJL 1XKAL 5CKMA 2JKHL 2WFTA 1UZQA 3TK6B 3KRKA 2RA0L 3N8YA 1FJSL 3Q7DA 3GCXE 1SZBA 1TPGA 3GCWE 1EGFA 1TOZA 1LPKA 4D0EA 3CENL 1IGZA 1X7AL 1ATAA 1QIUA 3KQCL 2W2OE 3N8VA 1G1RA 4G1MB 2Y80B 1W8BL 2VH6B 5K0HB 2I9BA 2XC4L 2KL7A 1K37A 4GU4A 4D90A 1B9WA 1IQLL 3N8WA 4BTUA 4CUEA 4JYVL 3LN0A 2D1JB 1G1SA 1YGCL 4YT6L 4JZFL 4X8TL 3F1SB 4Y6DB 1QFKL 1IQEL 3N8WB 1KIGL 2AYLA 2P3UA 1DQBA 2DDUA 3KQEL 2J4IB 4BTIA 2BOUA 1HAFA 1P0SL 1IP0A 1NT0A 1JV2B 2MGRA 2H9EC 1V3XB 2RNLA 1HX2A 1U8CB 2P3FN 3LC5B 1FF7A 5L30L 1LPZA 2BOHA 4O1ZA 1WHEA 1L5GB 1IVOC 1DDXA 1U67A 4RRXA 5F19A 4BXSA 2BMGA 1EPHA 2OYEP 4A7IA 2VJ3A 1UZKA 1EMOA 4D0FA 3CFWA 1F0RB 5E8DA 1JL9A 5JBCE 3V64C 1G2MB 5JB8E 2WYGB 4X8VL 4M11A 4CSYA 3KL6B 2H9EL 2W2PE 4ZXXL 1YUGA 1ATBA 2PHBB 3U7UG 1Z6EL 2XC5L 1J9CL 1NPEB 1PGEA 2P94L 2Y7XB 2RHPA 3LN1A 4JZEL 2KV4A 2BT7A 3ZYJB 4ZHAB 1CX2A 1FE2A 4TGFA 1HJ7A 3Q3KB 1G1TA 4ISIL 1KSNB 2WPIE 5FDQA 1Z6CA 3BT2A 4YT7L 2W86A 3KK6A 2BZ6L 4OTYA 1PXXA 2XBWL 1NZIA 5CKQA 1HT5A 2FD6A 1K36A 2MGPA 2FLBL 4MMXB 4MMYB 2EI8B 1YUFA 4CUDA 5CKNA 4OTJA 1CCFA 2BQ7A 2YGQA 3DEMA 5L2YL 1L3YA 1IQGL 1F0SB 4XBMA 4Y71B 3N8ZA 1CCVA 4LORA 1IQNL 1N1IA 1Q4GA 3QCWA 2WFXB 1MQ6L 3TGFA 2K2SB 4RRYA 4COXA 1YUKB 1P9JA 2JJLA 5CISA 2J38B 3FFGL 2VH0B 1EMNA 3HPTA 2WPME 2P28B 3LIWB 1TLEA 2OYUP 3LTGD 4O02B 1RFNB 1LQDA 3F6UL 1ADXA 3NTGA 1IQHL 3H5CB 2WG3C 1OB1C 4Y79B 2B7DL 3QH0A 4Y76B 2M74A 2EI6B 5IKTA 3P5BL 3BT1A 2BOXA 1V1HA 1NQLB 2MHPA 1CVUA 1EZQB 2BT8A 1EBVA 1FFMA 1KLIL 4BXWA 2W2QE 3OLTA 1FAKL 1XKBA 5JVZA 5L2ZL 2J34B 3KQBL 1F7MA 2KB9A 2BSFA 1EQHA 2VWMK 4NG9L 2W3KB 3HS5A
chains in the Genus database with same CATH topology
2WPKE 4Z6AL 1ZAQA 1W7XL 3HS6A 1ATEA 3TH3L 5KIRA 1HRFA 1G1QA 3TZIA 2W3IB 5JB9E 1N7DA 2J95B 3TK5B 4FM5A 4BTTA 2P3TA 3U73A 3CS7L 1PTHA 1A3PA 4NGAL 5IKQA 3M37L 2PR3B 4CUFA 1CQEA 1NFWB 3GISX 4MMZB 2Y5FL 1IJQA 3CA7A 2Y5HL 2Q1JB 2Y81B 2F9BL 5IKVA 3R05A 4ISHL 2XBVL 3SOQA 1AUTL 1IQFL 2W26B 4X8UL 3NT1A 4XL1A 4Z0KB 5JVYA 1URKA 1DVAL 1MOXC 4RUTA 1F7EA 4NA9L 1DIYA 1WHFA 2PUQL 2TGFA 3IJEB 2WPJE 4Y7BB 3NJPC 3HO4A 2BO2A 2VVCK 2GD4A 2Y38A 2FZZL 5IKRA 3KCGL 1G2LB 5I46L 3ENSA 5JW1A 4C16A 2FLGA 2K2TA 2NPRA 2WPLE 1CEJA 2P95L 1PFXL 3C9AC 3S6XA 4RS0A 1HT8A 2WPHE 2I9AA 4YZUB 1JBUL 2CJIB 3EGFA 2W2NE 1C5MF 1IQIL 1ATDA 1EQGA 2J94B 3LTFB 5JBBE 3SOVA 2WZPP 4BDWA 5COXA 1APQA 2P26A 1CVWL 2P16L 2BQWA 1IOEL 2XBXL 3KQDL 3MDLA 2G00L 3QMOA 2UWPB 4JYUL 2VWOL 3V65B 2Y82B 1NFYB 2BOKL 2XBYL 1EAIC 1GK5A 3LC3B 1UZPA 4PH9A 3LAQA 3OLUA 4A94C 2FLRL 1FAXL 2BQ6A 2EI7B 3N8XA 2KNIA 2P93L 4AQTA 4Z0LA 2Y7ZB 2VWNL 3ASIA 1IGXA 1XDTR 1IQKL 6COXA 2P3FL 3HO3A 1IOXA 1HREA 1EPIA 3FBYA 4ZAEB 2VVVL 3IITB 2YGPA 4E1GA 1HZ8A 4RRWA 3SOBB 3ELAL 3ZYGA 5JBAE 3POYA 3HO5A 5F1AA 1WU1B 2UWLB 4Y7AB 1IQJL 1HCGB 1COUA 2WYJB 4X8SL 1YO8A 2J2UB 1HAEA 1PRHA 1UZJA 4M10A 1NFUB 1BF9A 3FCSB 5EGMB 4ZXYL 3ZYIB 1O5DL 3MQEA 2ADXA 1XFEA 1LMMA 1LMJA 3SW2A 1KLOA 4BDXA 1I0UA 1EPJA 2VVUL 1NFXB 1MQ5L 3K9XA 3M36L 1APOA 4LMFA 2WG4B 1EPGA 1IQML 3BPSE 2VWLL 1M1XB 3NTBA 3PGHA 4ZH8B 3HS7A 1DX5I 2UWOB 2YGOA 1FSBA 4XLWA 1LPGA 3RR3A 5KN5C 3TBDA 4RRZA 2XC0L 2Y5GL 3N8YB 4JZDL 2W2ME 1KLJL 1XKAL 5CKMA 2JKHL 2WFTA 1UZQA 3TK6B 3KRKA 2RA0L 3N8YA 1FJSL 3Q7DA 3GCXE 1SZBA 1TPGA 3GCWE 1EGFA 1TOZA 1LPKA 4D0EA 3CENL 1IGZA 1X7AL 1ATAA 3KQCL 2W2OE 3N8VA 1G1RA 4G1MB 2Y80B 1W8BL 2VH6B 5K0HB 2I9BA 2XC4L 2KL7A 1K37A 4D90A 1B9WA 1IQLL 3N8WA 4BTUA 4CUEA 4JYVL 3LN0A 2D1JB 1G1SA 1YGCL 4YT6L 4JZFL 4X8TL 3F1SB 4Y6DB 1QFKL 1IQEL 3N8WB 1KIGL 2AYLA 2P3UA 1DQBA 2DDUA 3KQEL 2J4IB 4BTIA 2BOUA 1HAFA 1P0SL 1IP0A 1NT0A 1JV2B 2MGRA 2H9EC 1V3XB 2RNLA 1HX2A 1U8CB 2P3FN 3LC5B 1FF7A 5L30L 1LPZA 2BOHA 4O1ZA 1WHEA 1L5GB 1IVOC 1DDXA 1U67A 4RRXA 5F19A 4BXSA 2BMGA 1EPHA 2OYEP 4A7IA 2VJ3A 1UZKA 1EMOA 4D0FA 3CFWA 1F0RB 5E8DA 1JL9A 5JBCE 3V64C 1G2MB 5JB8E 2WYGB 4X8VL 4M11A 4CSYA 3KL6B 2H9EL 2W2PE 4ZXXL 1YUGA 1ATBA 2PHBB 3U7UG 1Z6EL 2XC5L 1J9CL 1NPEB 1PGEA 2P94L 2Y7XB 2RHPA 3LN1A 4JZEL 2KV4A 3ZYJB 4ZHAB 1CX2A 1FE2A 4TGFA 1HJ7A 3Q3KB 1G1TA 4ISIL 1KSNB 2WPIE 5FDQA 1Z6CA 3BT2A 4YT7L 2W86A 3KK6A 2BZ6L 4OTYA 1PXXA 2XBWL 1NZIA 5CKQA 1HT5A 2FD6A 1K36A 2MGPA 2FLBL 4MMXB 4MMYB 2EI8B 1YUFA 4CUDA 5CKNA 4OTJA 1CCFA 2BQ7A 2YGQA 3DEMA 5L2YL 1L3YA 1IQGL 1F0SB 4XBMA 4Y71B 3N8ZA 1CCVA 4LORA 1IQNL 1N1IA 1Q4GA 3QCWA 2WFXB 1MQ6L 3TGFA 2K2SB 4RRYA 4COXA 1YUKB 1P9JA 5CISA 2J38B 3FFGL 2VH0B 1EMNA 3HPTA 2WPME 2P28B 3LIWB 1TLEA 2OYUP 3LTGD 4O02B 1RFNB 1LQDA 3F6UL 1ADXA 3NTGA 1IQHL 3H5CB 2WG3C 1OB1C 4Y79B 2B7DL 3QH0A 4Y76B 2M74A 2EI6B 5IKTA 3P5BL 3BT1A 2BOXA 1NQLB 2MHPA 1CVUA 1EZQB 1EBVA 1FFMA 1KLIL 4BXWA 2W2QE 3OLTA 1FAKL 1XKBA 5JVZA 5L2ZL 2J34B 3KQBL 1F7MA 2KB9A 1EQHA 2VWMK 4NG9L 2W3KB 3HS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPK E;  4Z6A L;  1ZAQ A;  1W7X L;  3HS6 A;  1ATE A;  3TH3 L;  5KIR A;  1HRF A;  1G1Q A;  3TZI A;  2W3I B;  5JB9 E;  1N7D A;  2J95 B;  3TK5 B;  4FM5 A;  4BTT A;  2P3T A;  3U73 A;  3CS7 L;  1PTH A;  1A3P A;  4NGA L;  5IKQ A;  3M37 L;  2PR3 B;  4CUF A;  1CQE A;  1NFW B;  3GIS X;  4MMZ B;  2Y5F L;  1IJQ A;  3CA7 A;  2Y5H L;  2Q1J B;  2Y81 B;  2F9B L;  5IKV A;  3R05 A;  4ISH L;  2XBV L;  3SOQ A;  1AUT L;  1IQF L;  2W26 B;  4X8U L;  3NT1 A;  4XL1 A;  4Z0K B;  5JVY A;  1URK A;  1DVA L;  1MOX C;  4RUT A;  1F7E A;  1WHF A;  1DIY A;  2PUQ L;  2TGF A;  4NA9 L;  3IJE B;  2WPJ E;  4Y7B B;  3NJP C;  3HO4 A;  2BO2 A;  2VVC K;  2GD4 A;  2Y38 A;  2FZZ L;  5IKR A;  3KCG L;  1G2L B;  5I46 L;  3ENS A;  5JW1 A;  4C16 A;  2FLG A;  2K2T A;  2NPR A;  2WPL E;  1CEJ A;  2P95 L;  1PFX L;  3C9A C;  4RS0 A;  1HT8 A;  2WPH E;  2I9A A;  4YZU B;  1JBU L;  2CJI B;  3EGF A;  2W2N E;  1C5M F;  1IQI L;  1ATD A;  1EQG A;  2J94 B;  3LTF B;  5JBB E;  3SOV A;  4BDW A;  5COX A;  1APQ A;  2P26 A;  1CVW L;  2P16 L;  2BQW A;  1IOE L;  2XBX L;  3KQD L;  3MDL A;  2G00 L;  3QMO A;  2UWP B;  4JYU L;  2VWO L;  3V65 B;  2Y82 B;  1NFY B;  2BOK L;  2XBY L;  1EAI C;  1GK5 A;  3LC3 B;  1UZP A;  4PH9 A;  3LAQ A;  3OLU A;  2FLR L;  1FAX L;  2BQ6 A;  2EI7 B;  3N8X A;  2P93 L;  4AQT A;  4Z0L A;  2Y7Z B;  2VWN L;  3ASI A;  1IGX A;  1XDT R;  1IQK L;  6COX A;  2P3F L;  3HO3 A;  1IOX A;  1HRE A;  1EPI A;  3FBY A;  4ZAE B;  2VVV L;  3IIT B;  2YGP A;  4E1G A;  1HZ8 A;  4RRW A;  3SOB B;  3ELA L;  3ZYG A;  5JBA E;  3POY A;  3HO5 A;  5F1A A;  1WU1 B;  2UWL B;  4Y7A B;  1IQJ L;  1HCG B;  1COU A;  2WYJ B;  4X8S L;  1YO8 A;  2J2U B;  1HAE A;  1PRH A;  1UZJ A;  4M10 A;  1NFU B;  1BF9 A;  3FCS B;  5EGM B;  4ZXY L;  3ZYI B;  1O5D L;  3MQE A;  2ADX A;  1XFE A;  1LMJ A;  3SW2 A;  1KLO A;  4BDX A;  1I0U A;  1EPJ A;  2VVU L;  1NFX B;  1MQ5 L;  3K9X A;  3M36 L;  1APO A;  4LMF A;  2WG4 B;  1EPG A;  1IQM L;  3BPS E;  2VWL L;  1M1X B;  3NTB A;  3PGH A;  4ZH8 B;  3HS7 A;  1DX5 I;  2UWO B;  2YGO A;  1FSB A;  4XLW A;  1LPG A;  3RR3 A;  5KN5 C;  3TBD A;  4RRZ A;  2XC0 L;  2Y5G L;  3N8Y B;  4JZD L;  2W2M E;  1KLJ L;  1XKA L;  5CKM A;  2JKH L;  2WFT A;  1UZQ A;  3TK6 B;  3KRK A;  2RA0 L;  3N8Y A;  1FJS L;  3Q7D A;  3GCX E;  1SZB A;  1TPG A;  3GCW E;  1EGF A;  1TOZ A;  1LPK A;  4D0E A;  3CEN L;  1IGZ A;  1X7A L;  1ATA A;  3KQC L;  2W2O E;  3N8V A;  1G1R A;  4G1M B;  2Y80 B;  1W8B L;  2VH6 B;  5K0H B;  2I9B A;  2XC4 L;  2KL7 A;  1K37 A;  4D90 A;  1B9W A;  1IQL L;  3N8W A;  4BTU A;  4CUE A;  4JYV L;  3LN0 A;  2D1J B;  1G1S A;  1YGC L;  4YT6 L;  4JZF L;  4X8T L;  3F1S B;  4Y6D B;  1QFK L;  1IQE L;  3N8W B;  1KIG L;  2AYL A;  2P3U A;  1DQB A;  2DDU A;  3KQE L;  2J4I B;  4BTI A;  2BOU A;  1HAF A;  1P0S L;  1IP0 A;  1NT0 A;  1JV2 B;  2MGR A;  1V3X B;  2RNL A;  1HX2 A;  1U8C B;  2P3F N;  3LC5 B;  1FF7 A;  5L30 L;  1LPZ A;  2BOH A;  4O1Z A;  1WHE A;  1L5G B;  1IVO C;  1DDX A;  1U67 A;  4RRX A;  5F19 A;  4BXS A;  2BMG A;  1EPH A;  2OYE P;  4A7I A;  2VJ3 A;  1UZK A;  1EMO A;  4D0F A;  3CFW A;  1F0R B;  5E8D A;  1JL9 A;  5JBC E;  3V64 C;  1G2M B;  5JB8 E;  2WYG B;  4X8V L;  4M11 A;  4CSY A;  3KL6 B;  2H9E L;  2W2P E;  4ZXX L;  1YUG A;  1ATB A;  2PHB B;  3U7U G;  1Z6E L;  2XC5 L;  1J9C L;  1NPE B;  1PGE A;  2P94 L;  2Y7X B;  2RHP A;  3LN1 A;  4JZE L;  2KV4 A;  3ZYJ B;  4ZHA B;  1CX2 A;  1FE2 A;  4TGF A;  1HJ7 A;  3Q3K B;  1G1T A;  4ISI L;  1KSN B;  2WPI E;  5FDQ A;  1Z6C A;  3BT2 A;  4YT7 L;  2W86 A;  3KK6 A;  2BZ6 L;  4OTY A;  1PXX A;  2XBW L;  1NZI A;  5CKQ A;  1HT5 A;  2FD6 A;  1K36 A;  2MGP A;  2FLB L;  4MMX B;  4MMY B;  2EI8 B;  1YUF A;  4CUD A;  5CKN A;  4OTJ A;  1CCF A;  2BQ7 A;  3DEM A;  5L2Y L;  1L3Y A;  1IQG L;  1F0S B;  4XBM A;  4Y71 B;  3N8Z A;  1CCV A;  4LOR A;  1IQN L;  1N1I A;  1Q4G A;  3QCW A;  2WFX B;  1MQ6 L;  3TGF A;  2K2S B;  4RRY A;  4COX A;  1YUK B;  1P9J A;  5CIS A;  2J38 B;  3FFG L;  2VH0 B;  1EMN A;  3HPT A;  2WPM E;  2P28 B;  3LIW B;  1TLE A;  2OYU P;  3LTG D;  4O02 B;  1RFN B;  1LQD A;  3F6U L;  1ADX A;  3NTG A;  1IQH L;  3H5C B;  2WG3 C;  1OB1 C;  4Y79 B;  2B7D L;  3QH0 A;  4Y76 B;  2M74 A;  2EI6 B;  5IKT A;  3P5B L;  3BT1 A;  2BOX A;  1NQL B;  2MHP A;  1CVU A;  1EZQ B;  1EBV A;  1FFM A;  1KLI L;  4BXW A;  2W2Q E;  3OLT A;  1FAK L;  1XKB A;  5JVZ A;  5L2Z L;  2J34 B;  3KQB L;  1F7M A;  2KB9 A;  1EQH A;  2VWM K;  4NG9 L;  2W3K B;  3HS5 A; 
#chains in the Genus database with same CATH topology
 2WPK E;  4Z6A L;  1ZAQ A;  1W7X L;  3HS6 A;  1ATE A;  3TH3 L;  5KIR A;  1HRF A;  1G1Q A;  3TZI A;  2W3I B;  5JB9 E;  1N7D A;  2J95 B;  3TK5 B;  4FM5 A;  4BTT A;  2P3T A;  3U73 A;  4GU3 A;  3CS7 L;  1PTH A;  1A3P A;  4NGA L;  5IKQ A;  3M37 L;  2PR3 B;  4CUF A;  1CQE A;  1NFW B;  3GIS X;  4MMZ B;  2Y5F L;  1IJQ A;  3CA7 A;  2Y5H L;  2Q1J B;  2Y81 B;  2F9B L;  5IKV A;  3R05 A;  4ISH L;  2XBV L;  3SOQ A;  1AUT L;  1IQF L;  2W26 B;  4X8U L;  3NT1 A;  4XL1 A;  4Z0K B;  5JVY A;  1URK A;  1DVA L;  1MOX C;  4RUT A;  1F7E A;  1WHF A;  1DIY A;  2PUQ L;  2TGF A;  4NA9 L;  3IJE B;  2WPJ E;  4Y7B B;  1V1I A;  3NJP C;  3HO4 A;  2BO2 A;  2VVC K;  2GD4 A;  2VRS A;  2Y38 A;  2FZZ L;  5IKR A;  3KCG L;  1G2L B;  5I46 L;  3ENS A;  5JW1 A;  4C16 A;  2FLG A;  2K2T A;  2NPR A;  2WPL E;  1CEJ A;  2P95 L;  1PFX L;  3C9A C;  3S6X A;  4RS0 A;  1HT8 A;  2WPH E;  2I9A A;  4YZU B;  1JBU L;  2CJI B;  3EGF A;  2HOX A;  2W2N E;  1C5M F;  1IQI L;  1ATD A;  1EQG A;  2J94 B;  3LTF B;  5JBB E;  3SOV A;  2WZP P;  4BDW A;  5COX A;  1APQ A;  2P26 A;  1CVW L;  2P16 L;  2BQW A;  1IOE L;  2XBX L;  3MDL A;  3KQD L;  1KKE A;  2G00 L;  3QMO A;  2UWP B;  4JYU L;  2VWO L;  3V65 B;  2Y82 B;  1NFY B;  2BOK L;  2XBY L;  1EAI C;  1GK5 A;  3LC3 B;  1UZP A;  4PH9 A;  3LAQ A;  3OLU A;  4A94 C;  2FLR L;  1FAX L;  2BQ6 A;  2EI7 B;  3N8X A;  2KNI A;  2P93 L;  4AQT A;  4Z0L A;  2Y7Z B;  2VWN L;  3ASI A;  1IGX A;  1XDT R;  1IQK L;  6COX A;  2P3F L;  3HO3 A;  1IOX A;  2HOR A;  1HRE A;  1EPI A;  3FBY A;  4ZAE B;  2VVV L;  3IIT B;  2YGP A;  4E1G A;  1HZ8 A;  4RRW A;  3SOB B;  3ELA L;  3ZYG A;  5JBA E;  3POY A;  3HO5 A;  5F1A A;  1WU1 B;  2UWL B;  4Y7A B;  1IQJ L;  1HCG B;  1COU A;  2WYJ B;  4X8S L;  1YO8 A;  2J2U B;  1HAE A;  1PRH A;  1UZJ A;  4M10 A;  1NFU B;  1LK9 A;  1BF9 A;  3FCS B;  5EGM B;  4ZXY L;  3ZYI B;  1O5D L;  3MQE A;  2ADX A;  1XFE A;  1LMM A;  1LMJ A;  3SW2 A;  1KLO A;  4BDX A;  1I0U A;  1EPJ A;  2VVU L;  1NFX B;  1MQ5 L;  3K9X A;  3M36 L;  1APO A;  4LMF A;  2WG4 B;  1EPG A;  1IQM L;  3BPS E;  2VWL L;  1M1X B;  3NTB A;  3PGH A;  4ZH8 B;  3HS7 A;  1DX5 I;  2UWO B;  2YGO A;  1FSB A;  4XLW A;  1LPG A;  3RR3 A;  5KN5 C;  3TBD A;  4RRZ A;  2XC0 L;  2Y5G L;  3N8Y B;  4JZD L;  2W2M E;  1KLJ L;  1XKA L;  5CKM A;  2JKH L;  2WFT A;  1UZQ A;  3TK6 B;  3KRK A;  2RA0 L;  3N8Y A;  1FJS L;  3Q7D A;  3GCX E;  1SZB A;  1TPG A;  3GCW E;  1EGF A;  1TOZ A;  1LPK A;  4D0E A;  3CEN L;  1IGZ A;  1X7A L;  1ATA A;  1QIU A;  3KQC L;  2W2O E;  3N8V A;  1G1R A;  4G1M B;  2Y80 B;  1W8B L;  2VH6 B;  5K0H B;  2I9B A;  2XC4 L;  2KL7 A;  1K37 A;  4GU4 A;  4D90 A;  1B9W A;  1IQL L;  3N8W A;  4BTU A;  4CUE A;  4JYV L;  3LN0 A;  2D1J B;  1G1S A;  1YGC L;  4YT6 L;  4JZF L;  4X8T L;  3F1S B;  4Y6D B;  1QFK L;  1IQE L;  3N8W B;  1KIG L;  2AYL A;  2P3U A;  1DQB A;  2DDU A;  3KQE L;  2J4I B;  4BTI A;  2BOU A;  1HAF A;  1P0S L;  1IP0 A;  1NT0 A;  1JV2 B;  2MGR A;  2H9E C;  1V3X B;  2RNL A;  1HX2 A;  1U8C B;  2P3F N;  3LC5 B;  1FF7 A;  5L30 L;  1LPZ A;  2BOH A;  4O1Z A;  1WHE A;  1L5G B;  1IVO C;  1DDX A;  1U67 A;  4RRX A;  5F19 A;  4BXS A;  2BMG A;  1EPH A;  2OYE P;  4A7I A;  2VJ3 A;  1UZK A;  1EMO A;  4D0F A;  3CFW A;  1F0R B;  5E8D A;  1JL9 A;  5JBC E;  3V64 C;  1G2M B;  5JB8 E;  2WYG B;  4X8V L;  4M11 A;  4CSY A;  3KL6 B;  2H9E L;  2W2P E;  4ZXX L;  1YUG A;  1ATB A;  2PHB B;  3U7U G;  1Z6E L;  2XC5 L;  1J9C L;  1NPE B;  1PGE A;  2P94 L;  2Y7X B;  2RHP A;  3LN1 A;  4JZE L;  2KV4 A;  2BT7 A;  3ZYJ B;  4ZHA B;  1CX2 A;  1FE2 A;  4TGF A;  1HJ7 A;  3Q3K B;  1G1T A;  4ISI L;  1KSN B;  2WPI E;  5FDQ A;  1Z6C A;  3BT2 A;  4YT7 L;  2W86 A;  3KK6 A;  2BZ6 L;  4OTY A;  1PXX A;  2XBW L;  1NZI A;  5CKQ A;  1HT5 A;  2FD6 A;  1K36 A;  2MGP A;  2FLB L;  4MMX B;  4MMY B;  2EI8 B;  1YUF A;  4CUD A;  5CKN A;  4OTJ A;  1CCF A;  2BQ7 A;  2YGQ A;  3DEM A;  5L2Y L;  1L3Y A;  1IQG L;  1F0S B;  4XBM A;  4Y71 B;  3N8Z A;  1CCV A;  4LOR A;  1IQN L;  1N1I A;  1Q4G A;  3QCW A;  2WFX B;  1MQ6 L;  3TGF A;  2K2S B;  4RRY A;  4COX A;  1YUK B;  1P9J A;  2JJL A;  5CIS A;  2J38 B;  3FFG L;  2VH0 B;  1EMN A;  3HPT A;  2WPM E;  2P28 B;  3LIW B;  1TLE A;  2OYU P;  3LTG D;  4O02 B;  1RFN B;  1LQD A;  3F6U L;  1ADX A;  3NTG A;  1IQH L;  3H5C B;  2WG3 C;  1OB1 C;  4Y79 B;  2B7D L;  3QH0 A;  4Y76 B;  2M74 A;  2EI6 B;  5IKT A;  3P5B L;  3BT1 A;  2BOX A;  1V1H A;  1NQL B;  2MHP A;  1CVU A;  1EZQ B;  2BT8 A;  1EBV A;  1FFM A;  1KLI L;  4BXW A;  2W2Q E;  3OLT A;  1FAK L;  1XKB A;  5JVZ A;  5L2Z L;  2J34 B;  3KQB L;  1F7M A;  2KB9 A;  2BSF A;  1EQH A;  2VWM K;  4NG9 L;  2W3K B;  3HS5 A; 
#chains in the Genus database with same CATH homology
 2WPK E;  4Z6A L;  1ZAQ A;  1W7X L;  3HS6 A;  1ATE A;  3TH3 L;  5KIR A;  1HRF A;  1G1Q A;  3TZI A;  2W3I B;  5JB9 E;  1N7D A;  2J95 B;  3TK5 B;  4FM5 A;  4BTT A;  2P3T A;  3U73 A;  3CS7 L;  1PTH A;  1A3P A;  4NGA L;  5IKQ A;  3M37 L;  2PR3 B;  4CUF A;  1CQE A;  1NFW B;  3GIS X;  4MMZ B;  2Y5F L;  1IJQ A;  3CA7 A;  2Y5H L;  2Q1J B;  2Y81 B;  2F9B L;  5IKV A;  3R05 A;  4ISH L;  2XBV L;  3SOQ A;  1AUT L;  1IQF L;  2W26 B;  4X8U L;  3NT1 A;  4XL1 A;  4Z0K B;  5JVY A;  1URK A;  1DVA L;  1MOX C;  4RUT A;  1F7E A;  4NA9 L;  1DIY A;  1WHF A;  2PUQ L;  2TGF A;  3IJE B;  2WPJ E;  4Y7B B;  3NJP C;  3HO4 A;  2BO2 A;  2VVC K;  2GD4 A;  2Y38 A;  2FZZ L;  5IKR A;  3KCG L;  1G2L B;  5I46 L;  3ENS A;  5JW1 A;  4C16 A;  2FLG A;  2K2T A;  2NPR A;  2WPL E;  1CEJ A;  2P95 L;  1PFX L;  3C9A C;  3S6X A;  4RS0 A;  1HT8 A;  2WPH E;  2I9A A;  4YZU B;  1JBU L;  2CJI B;  3EGF A;  2W2N E;  1C5M F;  1IQI L;  1ATD A;  1EQG A;  2J94 B;  3LTF B;  5JBB E;  3SOV A;  2WZP P;  4BDW A;  5COX A;  1APQ A;  2P26 A;  1CVW L;  2P16 L;  2BQW A;  1IOE L;  2XBX L;  3KQD L;  3MDL A;  2G00 L;  3QMO A;  2UWP B;  4JYU L;  2VWO L;  3V65 B;  2Y82 B;  1NFY B;  2BOK L;  2XBY L;  1EAI C;  1GK5 A;  3LC3 B;  1UZP A;  4PH9 A;  3LAQ A;  3OLU A;  4A94 C;  2FLR L;  1FAX L;  2BQ6 A;  2EI7 B;  3N8X A;  2KNI A;  2P93 L;  4AQT A;  4Z0L A;  2Y7Z B;  2VWN L;  3ASI A;  1IGX A;  1XDT R;  1IQK L;  6COX A;  2P3F L;  3HO3 A;  1IOX A;  1HRE A;  1EPI A;  3FBY A;  4ZAE B;  2VVV L;  3IIT B;  2YGP A;  4E1G A;  1HZ8 A;  4RRW A;  3SOB B;  3ELA L;  3ZYG A;  5JBA E;  3POY A;  3HO5 A;  5F1A A;  1WU1 B;  2UWL B;  4Y7A B;  1IQJ L;  1HCG B;  1COU A;  2WYJ B;  4X8S L;  1YO8 A;  2J2U B;  1HAE A;  1PRH A;  1UZJ A;  4M10 A;  1NFU B;  1BF9 A;  3FCS B;  5EGM B;  4ZXY L;  3ZYI B;  1O5D L;  3MQE A;  2ADX A;  1XFE A;  1LMM A;  1LMJ A;  3SW2 A;  1KLO A;  4BDX A;  1I0U A;  1EPJ A;  2VVU L;  1NFX B;  1MQ5 L;  3K9X A;  3M36 L;  1APO A;  4LMF A;  2WG4 B;  1EPG A;  1IQM L;  3BPS E;  2VWL L;  1M1X B;  3NTB A;  3PGH A;  4ZH8 B;  3HS7 A;  1DX5 I;  2UWO B;  2YGO A;  1FSB A;  4XLW A;  1LPG A;  3RR3 A;  5KN5 C;  3TBD A;  4RRZ A;  2XC0 L;  2Y5G L;  3N8Y B;  4JZD L;  2W2M E;  1KLJ L;  1XKA L;  5CKM A;  2JKH L;  2WFT A;  1UZQ A;  3TK6 B;  3KRK A;  2RA0 L;  3N8Y A;  1FJS L;  3Q7D A;  3GCX E;  1SZB A;  1TPG A;  3GCW E;  1EGF A;  1TOZ A;  1LPK A;  4D0E A;  3CEN L;  1IGZ A;  1X7A L;  1ATA A;  3KQC L;  2W2O E;  3N8V A;  1G1R A;  4G1M B;  2Y80 B;  1W8B L;  2VH6 B;  5K0H B;  2I9B A;  2XC4 L;  2KL7 A;  1K37 A;  4D90 A;  1B9W A;  1IQL L;  3N8W A;  4BTU A;  4CUE A;  4JYV L;  3LN0 A;  2D1J B;  1G1S A;  1YGC L;  4YT6 L;  4JZF L;  4X8T L;  3F1S B;  4Y6D B;  1QFK L;  1IQE L;  3N8W B;  1KIG L;  2AYL A;  2P3U A;  1DQB A;  2DDU A;  3KQE L;  2J4I B;  4BTI A;  2BOU A;  1HAF A;  1P0S L;  1IP0 A;  1NT0 A;  1JV2 B;  2MGR A;  2H9E C;  1V3X B;  2RNL A;  1HX2 A;  1U8C B;  2P3F N;  3LC5 B;  1FF7 A;  5L30 L;  1LPZ A;  2BOH A;  4O1Z A;  1WHE A;  1L5G B;  1IVO C;  1DDX A;  1U67 A;  4RRX A;  5F19 A;  4BXS A;  2BMG A;  1EPH A;  2OYE P;  4A7I A;  2VJ3 A;  1UZK A;  1EMO A;  4D0F A;  3CFW A;  1F0R B;  5E8D A;  1JL9 A;  5JBC E;  3V64 C;  1G2M B;  5JB8 E;  2WYG B;  4X8V L;  4M11 A;  4CSY A;  3KL6 B;  2H9E L;  2W2P E;  4ZXX L;  1YUG A;  1ATB A;  2PHB B;  3U7U G;  1Z6E L;  2XC5 L;  1J9C L;  1NPE B;  1PGE A;  2P94 L;  2Y7X B;  2RHP A;  3LN1 A;  4JZE L;  2KV4 A;  3ZYJ B;  4ZHA B;  1CX2 A;  1FE2 A;  4TGF A;  1HJ7 A;  3Q3K B;  1G1T A;  4ISI L;  1KSN B;  2WPI E;  5FDQ A;  1Z6C A;  3BT2 A;  4YT7 L;  2W86 A;  3KK6 A;  2BZ6 L;  4OTY A;  1PXX A;  2XBW L;  1NZI A;  5CKQ A;  1HT5 A;  2FD6 A;  1K36 A;  2MGP A;  2FLB L;  4MMX B;  4MMY B;  2EI8 B;  1YUF A;  4CUD A;  5CKN A;  4OTJ A;  1CCF A;  2BQ7 A;  2YGQ A;  3DEM A;  5L2Y L;  1L3Y A;  1IQG L;  1F0S B;  4XBM A;  4Y71 B;  3N8Z A;  1CCV A;  4LOR A;  1IQN L;  1N1I A;  1Q4G A;  3QCW A;  2WFX B;  1MQ6 L;  3TGF A;  2K2S B;  4RRY A;  4COX A;  1YUK B;  1P9J A;  5CIS A;  2J38 B;  3FFG L;  2VH0 B;  1EMN A;  3HPT A;  2WPM E;  2P28 B;  3LIW B;  1TLE A;  2OYU P;  3LTG D;  4O02 B;  1RFN B;  1LQD A;  3F6U L;  1ADX A;  3NTG A;  1IQH L;  3H5C B;  2WG3 C;  1OB1 C;  4Y79 B;  2B7D L;  3QH0 A;  4Y76 B;  2M74 A;  2EI6 B;  5IKT A;  3P5B L;  3BT1 A;  2BOX A;  1NQL B;  2MHP A;  1CVU A;  1EZQ B;  1EBV A;  1FFM A;  1KLI L;  4BXW A;  2W2Q E;  3OLT A;  1FAK L;  1XKB A;  5JVZ A;  5L2Z L;  2J34 B;  3KQB L;  1F7M A;  2KB9 A;  1EQH A;  2VWM K;  4NG9 L;  2W3K B;  3HS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...