5EGNA

Est816 as an n-acyl homoserine lactone degrading enzyme
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
PHVENDGVKIYYDSYGEGVPIVFLHPFSTNGGIWYFQTFPFAQTNHVIVIDHRGHGRSDKPATGYSIMEHADDVVAVLDALKVDRAVFVGNSIGGMIAMQLNLDHPQRVIGNLILSSGTGLGEGMPPEAGAAFQNDYIGAFGGLLEGAVSARSKRERPEILAVMKAHFSVPSNFPKHVFDAATADPNGVFAWNIKDRLSSIQAPTLVVAGEEDLVTTVANNQLLADNIPGAELRVINDVGHFYQLERPSEFNELLRGFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Est816 as an N-Acyl homoserine lactone degrading enzyme
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase
total genus 95
structure length 260
sequence length 260
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5egnA00
3KWFA 2HRQA 5JYCA 3QMMA 4EY7A 3MUNA 4AN0A 5CT4A 2OGSA 4CI9A 4J0IA 2ZJFA 5LZ5A 1BRTA 3L1IA 4KAJA 2J4FA 1BEZA 3AIOA 3PFCA 2RI6A 1CFJA 5HF8A 2DHEA 3G0DA 4NZZA 3ZLVA 5CT9A 3O0DA 2XDWA 2XMGA 5BWBA 3R0VA 3W2TA 5EGNA 1DQZA 1MNAA 1UT6A 1Y37A 1NU8A 5DYTA 5CMLA 5JIBA 3PUIA 1OXMA 2QZPA 1MX1A 1GQSA 2ECFA 1J06A 1XZLA 1E89A 3QMWA 3UUEA 5LZ2A 1ODCA 1WM1A 3ESCA 3MUOA 4X97A 3Q0TA 1SCKA 4FOLA 1XZMA 4KR0A 3STVA 3ZLUA 4UHBA 1DT3A 3K6KA 2EDCA 2Y2VA 1FFEA 4CG3A 1ZI9A 1I6WA 4E11A 1DINA 1E8DA 3BE8A 2R11A 2VAXA 3I1YA 1MU0A 3A2MA 4L72A 4H18A 4FKBA 1HPLA 2Z5GA 1ZJ5A 4M0FA 5HF6A 5JAOA 1QE3A 4HTAA 3WL8A 1BN6A 3R3WA 1XZBA 4OB8A 4UHEA 2B61A 1N1MA 1DX6A 4IH4A 3NWOA 4HVTA 2EEPA 3E3AA 2PSHA 5I7UA 1TCCA 4G5XA 5EIEA 1ZICA 3MVEA 2JGEA 3W9UA 2VSQA 4ZGBA 1J1IA 1LPMA 5AKEA 3AJAA 2PUJA 2I3DA 1QIDA 4QE3A 5LZ7A 3FYTA 2OXEA 4OYLA 2OPHA 4U2FA 3D7RA 2BJHA 1P0PA 1AQLA 1XZCA 4ETWA 2AJ8A 5K3DA 3SK0A 2C58A 2HA0A 4UHHA 4Y2RA 1R50A 1QIIA 2V98A 2DQYA 3IA2A 1GKLA 2WG1A 3M81A 3ZWQA 5DNWA 4X91A 1EB9A 2WIJA 1YR2A 3HABA 4X7BA 1JFRA 1R4ZA 1UK9A 4Y2TA 2ZYRA 1DWOA 1XRQA 4QDZA 3H17A 1DWPA 2Y6UA 2WU3A 4BCCA 5T4EA 4KE8A 5ALPA 1D07A 1CPYA 3IULA 1E5TA 1ZD2P 3R3ZA 1EI9A 2VF2A 3DOIA 2BAGA 1EDBA 1LBSA 1ZIYA 4OU5A 5ALZA 2CB9A 5HFAA 1CUZA 2PX6A 5AI9A 3I6YA 2BCEA 2E3JA 5JZ9A 3AINA 3EQ8A 3PE6A 3LLCA 5DLPA 3PI6A 5C8VA 2ZJ7A 3E4DA 1J07A 4L0CA 2AJCA 3HI4A 1R9MA 1CUXA 4K6GA 3F98A 5K5EA 1A88A 4AMYA 2IITA 4W1SA 4KJXA 1SCQA 1ETHA 1M33A 1SFRA 3RK4A 1H22A 3BXPA 3CCCA 5ALVA 2VJBA 2WJ6A 1WPRA 4WCVA 2G63A 4QZVA 3A2LA 1BS9A 2JEYA 3ESDA 4Y2VA 4H7IA 1WCYA 5ALSA 5JAHA 4OSEA 5IH7A 1GPLA 4J0CA 3F97A 1XZGA 4Q05A 2H7YA 3DDUA 1YB7A 1UZAA 2FX5A 2ES4A 1ZOIA 3C70A 1IVYA 1XZFA 3HRHA 5JZBA 4BBZA 5AOBA 1UOOA 2WUFA 1P0MA 1TIBA 4X71A 2QXTA 1QTRA 1W6RA 1G5FA 3VXKA 1QIMA 4KAFA 1CVLA 1QONA 4EB0A 2VTVA 2YASA 5FPPA 4F21A 4H77A 3HLKA 3A6ZA 3SX4A 1T2NA 4Y9SA 3HJUA 4WFKA 4BZZA 4S0XA 3U0VA 4X90A 1IUOA 2HU8A 3NUZA 2OCGA 4MQMA 1N5MA 3GZJA 2HFJA 4FHZA 1CUJA 3G9XA 4DLNA 1CUYA 3H2HA 4IQ4A 1CUFA 3H19A 1H23A 1HLGA 2UZ0A 4DNPA 4W1QA 4B84A 3C87A 4X85A 4ZREA 3GFFA 2WJ3A 2WFLA 4G4IA 1F0PA 4F0JA 2G4LA 2XLCA 3BF8A 3H18A 5K3FB 5DTJA 4J0HA 1VOTA 1X70A 5AICA 2B20A 5CBKA 3G0BA 3FCYA 3IB3A 1L7RA 4FMPA 1AMNA 3PUHA 2OQIA 3O9MA 3O4JA 2XMRA 4HZGA 2OGTA 1U8EA 3C6YA 4BC0A 1WB5A 3B12A 3ZV7A 2XMCA 2CBGA 4QDUA 2ORYA 3WMRA 1TKRA 4CCWA 5AHXA 3M3DA 5AKXA 3VVLA 4EA6A 1O6GA 4XWGA 2ZYIA 3H2JA 3I28A 4OU4A 2I78A 4WDRA 3ICWA 1JMYA 4BC1A 1XQWA 3F8SA 4DMKA 4JYMA 3ICVA 3HXKA 1WHSA 1RYYA 1WB6A 5A7GA 5I9IA 1MAHA 3ANTA 1LBTA 3AZPA 4CFSA 3G9UA 3C43A 4I19A 1JMKC 2CKMA 2YYSA 4BDSA 4BVKA 4MQLA 5C7YA 3SC2A 2WTNA 2QM0A 1P0QA 2XMQA 4QLOA 4X6YA 3C6BA 3FSGD 5AM4A 4UBIA 1G4HA 3C45A 4KE9A 1YA8A 1MNQA 4HXFB 1QOZA 5K3CA 2C5GA 3DNMA 2VJDA 2XE4A 4KAAA 3WZMA 4X3CA 3WKEA 1W76A 5JALA 2C0QA 7YASA 1JT2A 4DM7A 3WKBA 4HXGA 3WK8A 4N8SA 4INZA 2CZQA 4PW0A 4UFPA 4X92A 4UHDA 5A2GA 3WWDA 3M82A 3NGMA 3V1KA 1EK2A 4QLAA 1YAHA 2RHWA 3GELA 2QXUA 5AM2A 1LPSA 2DR0A 1XKLA 2P8SA 2BGNA 3D4LA 1XZEA 2Z3ZA 4BYMA 2ONCA 1DT5A 3WA6A 1FSSA 2WHPB 5LZ4A 4K6KA 5FRDA 1H2YA 3AILA 2OQVA 5AOCA 2RGUA 4BRSA 4OCZA 3PFBA 5AK4A 1QGED 4LKOA 2QJWA 3QPCA 2QJRA 3STXA 5JATA 3WQHA 4P08A 2AJDA 5AJHA 4PSUA 3DL7A 5LKRA 2HDWA 2X76A 5HQ3B 4KRYA 2WG0A 5DWDA 3RLIA 4B6GA 2NW6A 4C89A 3HACA 2HA2A 5CURA 4KEAA 2Y2UA 4U2DA 1F8UA 5AM5A 4EY5A 1CUEA 3OC0A 1X2EA 2XUIA 4OD0A 2D5LA 1MN6A 1N8SA 1XZHA 2XUQA 3G02A 1DTEA 3IURA 4E46A 2BUCA 4Y7DA 4X6UA 1R88A 4G8DA 5ALQA 4Q3OA 5E2IA 1ACLA 3PF9A 1R3DA 2JGLA 5JAUA 4GI1A 4AN1A 2HIHA 1H2XA 5HK8A 1VE7A 4QWWA 1LGYA 4FTWA 2WILA 3BDVA 1AC5A 3STWA 4GEGA 4J0DA 2BGRA 2QRUA 3AFIA 5C8XA 2JGIA 1CUWA 3C8DA 1CUHA 2G5TA 4RPCA 4EHBA 5HZGA 2ZSIA 5EIAA 2GZSA 1MAAA 4UHFA 4Y2YA 5IVKA 3OM8A 1EVQA 3E0XA 4DYHA 3WKDA 3MGAA 4OB7A 1UOQA 2BUAA 5ALHA 5ALRA 5AI6A 5ALLA 3ANSA 3CN9A 4A5SA 2WHRA 4JEIA 2V97A 1K6EA 5AKYA 4UUQA 2OGZA 4K2AA 5ALOA 1LZKA 4RE6A 5D7BA 1XZAA 3QVMA 5EHQA 3YASA 2J3DA 1S8OA 1VJ5A 5SYMA 4RE5A 2QKYA 2JEZA 3D2AA 1A8SA 1JI3A 2HHAA 3QITA 1IZ7A 1VXRA 1E8NA 1GGVA 5JD5A 4P93A 1CUAA 2OCLA 2FUKA 2XMZA 2PU5A 3VVMA 2PM8A 1EVEA 1G66A 4AZ3A 2WQZA 1DU4A 2WTMA 5EIHA 2XUOA 4GW3A 4LXGA 1XRNA 4F60A 2PU7A 2XMDA 2QOEA 5C81A 1TK3A 3FYUC 1CQWA 5EHXA 2AJBA 3D2CA 3S2ZA 4DSAA 5AI8A 4EBBA 2WKWA 5CTAA 3TGLA 4Q1VA 1F0NA 1CR6A 5DNVA 3TJMA 2H9YA 4KYVA 4XIIA 4PSDA 4CIAA 4XVCA 4MEAA 1W75A 1NU6A 1XFDA 2VQ6A 4UBKA 5HF9A 5BV7A 3WK7A 1YAJA 5KBYA 5AK3A 2XUHA 5C8ZA 3RKSA 1VA4A 2C0PA 4Y2XA 4BRZA 4TPKA 1XZJA 2C7BA 4H7EA 4A16A 1JJIA 1W52X 1IUNA 3HEAA 4UBMA 1XQVA 1CUCA 2HM7A 1U2EA 4RGYA 2GBFA 3KDAA 4FWBA 2J3QA 4BB0A 1EDDA 2Z3WA 2PBLA 1XRMA 1XLVA 4BAZA 1Q0RA 2OLEA 4X93A 5K3AA 3VISA 2V96A 4FLEA 5AP9A 1DWQA 1ODTC 3I2FA 2HU5A 1YSCA 4Y2QA 2C5FA 4P92A 3BJRA 1ZD4A 5CH8A 4J03A 3F96A 4E15A 2HA7A 4QEKA 4B0PA 4U2CA 3WWCA 1XRLA 1GXSA 2K2QB 3BDIA 4BE9A 1E8MA 2IX9A 2EDAA 4G9GA 2GZRA 1YS1X 3DQZA 1WB4A 2JGMA 4XX1A 3AZOA 4UBNA 2RAUA 1UKBA 2V9ZA 4EY8A 4X6XA 3EQ7A 4H7FA 4M0MA 2JBWA 1Y7HA 3DKRA 1VZ3A 3BF7A 4AO8A 2X8BA 5CT5A 3OTQA 3ZPXA 4ZRDA 3FVRA 3WJ1A 4UFNA 1QO9A 1XZKA 2VT6A 3G8YA 4K5QA 2HA4A 2DHCA 3WK6A 1GZ7A 1THTA 3I2KA 2XQIA 5AH0A 1O6FA 3WL7A 1A8UA 3I2GA 4Z49A 2JGKA 4TGLA 5F4ZA 1QIJA 2HU7A 4OPMA 4GWLA 4U2EA 1UKAA 3O95A 2QR5A 4LIPD 5A6VA 1C7JA 5ALDA 2GYWA 2OAEA 2GYVA 3I6ZA 1Y7IA 1K8QA 1QIEA 1YS2X 3IBTA 3BIWA 3WIBA 1Q84A 2CMFA 1IMJA 4KE7A 3QBJA 5FLKA 3D59A 1ZI8A 4F5ZA 2O2GA 4QNNA 3Q8WA 3F9CA 4N5IX 1X2BA 3DLTA 1QIHA 2GBIA 2GYUA 1UOPA 3WYNA 2XQJA 4MYSA 1UFOA 1TRHA 2ZYHA 3O9VA 4DNFA 3DOHA 4L3WA 1XLWA 1VE6A 2Z8XA 2XB6A 3H1BA 5ALFA 2YH2A 3GUUA 5AI0A 2C4HA 4WFIA 3M83A 4FFVA 4BZWA 1YB6A 1H2ZA 4M0EA 2QVBA 3PICA 3WL6A 2WFMA 2RHTA 3DEAA 3HC7A 4B82A 1OCEA 4KACA 1LZLA 2XT0A 5DTIA 3VKFA 1OILA 2VATA 1A7UA 3DL4A 3R40A 3WYDA 4QA9A 1YASA 3WLAA 1CEXA 3JW8A 2XUFA 5JD4A 3H2KA 3IUJA 3NOXA 3DJYA 3WK9A 2QUAA 3QZUA 2WHQA 5ALUA 3WWOA 4ARAA 1MJ5A 2FJ0A 4IH1A 3ZLTA 5DNUA 4YASA 2ACKA 3EBLA 2GBCA 4CG2A 4YPVA 2G5PA 5JADA 5AKZA 2XMBA 4WDQA 4G8CA 3P2MA 3G9TA 1CV2A 2QS9A 3ESAA 1LNSA 2Y1KA 1B6GA 3K2IA 2HL6A 3CXUA 5A62A 4ZV7A 1WOMA 1RWQA 4PQEA 5ALJA 3H2IA 4HS9A 3EIOA 2DFPA 4AB1A 4C87A 5E4YA 3FYUB 2H7XA 1FFDA 5ALNA 1JU3A 4HAIA 4BCBA 3S8YA 3JYHA 2W22A 4AMZA 4PV7A 4ARBA 2YXPX 3DYIA 5AKLA 1AX9A 3QYJA 3OG9A 4H7DA 5HF5A 5HCUA 4MXDA 2CJPA 5AI4A 3L1HA 4MJ3A 3FOBA 4N5HX 3R41A 3BL8A 3FBWA 3W9BA 3D2BA 1AURA 3QMVA 5BWCA 3G9ZA 5I8PA 2QMQA 5JANA 2OAGA 2WSLA 4CIBA 4BAUA 3N0TA 5CRIA 3VDXA 4NS4A 2WUDA 2XUGA 1BU8A 1UXOA 1HKHA 5T4FA 1CLEA 2B9VA 3K9BA 2O7VA 1ACJA 1XRPA 5E4TA 4Y2PA 3ZI7A 1GT6A 1XRRA 3F67A 5D6OA 4C4YA 2WUEA 5ISMA 5ALKA 1VLQA 1PJAA 3R3VA 3FNBA 1ZI6A 3ILSA 3RARA 3BJMA 2RONA 2VA9A 3V1NA 4GXNA 3AIKA 1DX4A 3LIPA 2WIGA 4J3JA 4W1RA 2HA3A 2PPLA 3AIMA 2PVSA 4QDXA 2XUPA 4IO0A 3L1JA 1XROA 4HXEB 3FCXA 4NMWA 4G1FA 4B81A 4AO7A 3DKKA 4DNOA 4KE6A 1J2EA 5AKHA 2ACEA 2JIDA 1EX9A 1XZDA 1CUIA 3LIIA 5HQ3A 1RP1A 4BTVA 5A7FA 2ZJ6A 4B85A 3I1IA 1UWCA 4Q3KA 4DGQA 3LCRA 4C4XA 4OB6A 1ZD3A 1KU0A 1BN7A 1BROA 4MWSA 1K63A 2CUTA 2XUJA 3D0KA 5LYYA 4ROTA 3WL5A 1PV1A 4C4ZA 4EZIA 1E66A 5HKAA 4H7JA 5AIBA 1HQDA 1MX9A 5FPQA 4BP8A 4BDTA 1CUUA 3STYA 2PL5A 3LP5A 4EY4A 3B5EA 3R3YA 4HRXA 2JF0A 1FFAA 3OURA 2GBGA 3E1GA 3EF3A 3LS2A 3QH4A 5LIPA 4GDMA 1HDEA 5AO9A 5CXUA 4B9AA 2BUBA 2HRRA 3FAKA 3KD2A 4FLMA 4LXHA 5EHNA 5JZSA 1LPBB 2XLBA 1QZ3A 1SCIA 3DYVA 1CUBA 2LIPA 3FWHA 4GBGA 4FNGA 4BTLA 3O4HA 3QM1A 1AGYA 5LZ8A 4FDMA 2ZSHA 2XUKA 1MTZA 3VJLA 4B9EA 2PSEA 2ZVDA 4ZI5A 4MWTA 3I6MA 3EQ9A 4BATA 1FJ2A 2WU4A 4PNZA 3JWEA 1UK6A 1AKNA 3UUFA 1ZGBA 1B41A 1XLUA 1JKMA 3UMJA 5LLSA 1Q83A 2B4KA 3C6ZA 5HK9A 3W05A 4QDTA 5AKKA 5DYYA 3CN7A 1LPAB 3C6XA 1BEEA 2WIFA 5AKIA 1HBJA 1IUPA 1GKKA 3C5WP 1K4YA 4PF1A 5FOQA 2FJPA 3WJ2A 3STUA 2IIVA 1KEZA 1EXWA 1BCSA 4IH9A 2R8BA 4H35A 1EHYA 3HSSA 5ALIA 4NVRA 3WKAA 1GQRA 4E14A 5IVHA 5JARA 5ALYA 4A23A 2X5XA 4AZ0A 3A2NA 1YCDA 5DJ5A 3N2ZB 5KWJA 4JYPA 5K3EA 2Y6VA 3C5VA 1CUGA 3WZLA 1EB8A 4JH0A 2QUBA 5D3KA 1JU4A 4AQDA 2O2HA 3FLEA 3T52A 4AXBA 4X94A 2BKLA 1NX9A 3QPDA 1UK8A 5K3BA 4XJVA 4B80A 1QLWA 4J0GA 3D5EA 2HA6A 5HKBA 1YA4A 4WJLA 1AZWA 3I2IA 5AIAA 3ED1A 1KU6A 2VJCA 3I2JA 3OOSA 4GHWA 4FLFA 4ZV9A 2WJ4A 5CH3A 5T4HA 1JJBA 3V9AA 4DMFA 5CW2A 3U1TA 4CG1A 1TAHA 3VJMA 4C6HA 2Z8ZA 3WA7A 2WM2A 4C88A 4J7AA 3PDCA 3FSGA 4OUKX 4Y2UA 5FV4A 1U65A 4JNCA 3W06A 5JASA 3DD5A 5HFNA 4W9RA 2WG2A 4Y2JA 4FNMA 5AKJA 2XQFA 3DS8A 1PFQA 4U2GA 3WK5A 2OG1A 3IUQA 5AKGA 1C7IA 2DQZA 4TVKA 2HFKA 3IIIA 3DCNA 4K6HA 3H04A 4BVJA 1L7QA 1QIKA 4RNCA 4DTCA 5IVIA 2HADA 4W63A 1THGA 4B0OA 1ORVA 2XI4A 4BE4A 2VJAA 1GPKA 3SWWA 5EFZA 4I4CA 3G7NA 4WFJA 5ALGA 2O2IA 3AZQA 5AM0A 3TRDA 2XUAA 5JD6A 2J4CA 3R3XA 4QDOA 2PUHA 4GECA 2XQGA 4DNQA 5CXXA 1SC9A 3FVTA 2ZYSA 2PKYX 2JGFA 5T4BA 1N5RA 5FDFA 5LP1A 3D3NA 3FLBA 5AOAA 4DMHA 1EDEA 4ZWNA 4PSCA 2AXEA 3FYUA 1QTIA 1MO2A 1CUVA 1TCAA 2ROQA 5DYWA 3V1MA 4X00A 4UBOA 1VXOA 2WIDA 3TEJA 1EA5A 4AO6A 3WWEA 4G4GA 3R3UA 3QPAA 3GBSA 3BIXA 4LHEA 2O7RA 4D9JA 4EUSA 4FFWA 1QFMA 4I3FA 4W1PA 1WHTA 3HZOA 2OCKA 5FUMA 5EI5A 1ODSA 4YX9A 4DMCA 5LZ9A 1LPNA 2H1IA 5LKAA 1ISPA 2D0DA 1QJ4A 2I3ZA 1HL7A 3WK4A 4Q34A 5EHZA 3G0GA 5CT6A 4CCYA 1EH5A 4KRXA 4LXIA 3WIOA 3H2GA 3H0CA 1EINA 5SYNA 4OYYA 1R9NA 3IUMA 2QT9A 3ESBA 1LPPA 5ALTA 5H3HA 2WHPA 4C01A 1BCRA 1MX5A 2XMSA 1L7AA 2I03A 4MYDA 1UKCA 5IKXA 5ALMA 1A8QA 4LYDA 3V1LA 3KXPA 3WI7A 3BWXA 4UBJA 4JUIA 3AUKA 4H7HA 1DQYA 5FXMA 1QIFA 4BP9A 1U4NA 4BCDA 4DIUA 1TQHA 1ORWA 1GPNA 1QO7A 1P0IA 5ESRA 2PSFA 2WIKA 4U2BA 4G9EA 3IUNA 2VT7A 4J0KA 1CUSA 1F6WA 3X3HA 1BE0A 1VA5A 2DSNA 3KWJA 3V48A 3KSRA 5ALEA 2W6CX 4UPDA 2CEKA 3FLAA 4MEBA 5E4JA 1XQYA 4DSZA 3WWPA 3WKCA 2HA5A 1XKTA 4QWMA 1MT3A 5ALWA 1CUDA 1LLFA 4UBLA 1LPOA 3RM3A 3W04A 1QIGA 4FBLA 4EY6A 1AUOA 3A70A 5KWIA 2WFLB 5CH5A 3G0CA 1MPXA 1XQXA 1CIJA 3G0IA 5A71A 4YK7A 5AI5A 1TCBA 5J3JA 1K5PA 2OCIA 4H7KA 1USWA 5FP0A 4B7ZA 4G8BA 1CRLA 4ZXFA 4B83A 5BOVA 5CT8A 1Q0ZA 2VAVA 1ZIXA 3KOOA 2H7CA 4FBMA 2WUGA 3T4UA 1CQZA 4CCYB 1UK7A 1W1IA 2PSDA 2DHDA 1WPXA 1E3QA 5A7HA 4V2IA 4X95A 2VEOA 1QFSA 3O4IA 4ITVA 2JGJA 4PO3X 4WY8A 4N8DA 4IHAA 3IDAA 4P9NA 5AM3A 1XZIA 4WY5A 5YASA 4G4JA 4AX4A 6YASA 5JAPA 4UHCA 1G42A 2WFZA 3H1AA 4GLBA 1FFBA 3GROA 4LYEA 5FKJA 1IZ8A 3HYSA 1VZ2A 3GA7A 2RIPA 4J0JA 1FFCA 4H0CA 4Q3LA 3I2HA 3C8HA 1ZJ4A 1ZD5A 2QTBA 4HRYA 4BVLA 2XUDA 5KREA 1C4XA 1W4LA 3O4GA 1H2WA 3OPMA 1T4MA 4O08A 2WLSA 4Q82A 2PSJA 1EK1A 3IVMA 3VJKA 4L9AA 3CCBA 1Z68A 4BAGA 4Y2SA 2AJLI 1ZGCA 3STTA 5K3FA 3PF8A 5AK6A 5AK5A 1R1DA 1VKHA 5AM1A 2Q0XA 5IVDA 5ALXA 1JJFA 5D3ZA 4N8EA 2DCMA 3B3QA 2XQKA 1SOMA 4UFOA 2BFNA
chains in the Genus database with same CATH superfamily
2IY9A 1AXRA 2YWGA 3A11A 3KWFA 4J4TA 5E1MA 1R8QA 2WMNB 4JIMA 3WSWA 3V8MA 1MQ9A 1V3QE 1G8KA 5JYCA 3FB1A 2DMRA 3Q98A 3QMMA 2P62A 5B6PA 1TZMA 1J2RA 2RKBA 4FJ2A 4IS3A 1VP9A 2MMCA 3Q85A 4WLNA 5I01A 3K70C 5FR2A 1P4AA 2RHRA 4UCFA 4Z86A 2NPOA 2NXJA 3TEMA 3ICCA 5CJJA 3NT5A 3UJCA 1DMSA 3UV6A 4CI9A 4TZTA 5B3KA 2GILA 3GN1A 1KYZA 3IMGA 1OWPA 1Z34A 3O03A 4JX8A 3RS0A 5B7PA 3KQOA 2LNDA 3IXQA 1G20A 4L75A 2BFAA 1BEZA 1XP8A 4R0NA 2FFAA 4D9HA 3DDHA 3FKSD 3OP4A 3W5AA 1U8AA 2OTCA 3BE6A 1P7PA 2DHEA 5HF8A 3G0DA 5J2UA 2YHIA 3JRXA 4TYQA 2Z4TA 1AO3A 2X0RA 3EW9A 1ZVVA 2J9RA 2PWPA 3JQ9A 4Z7QB 5HJ7A 2HEGA 3IAM1 4MPPA 4X60A 2OHOA 3HRIA 3SR4A 1E4EB 4N7RA 3CCFA 3M9WA 2YYYA 4IINA 5JE8A 3DBRA 3HDHA 1Z7BA 2RHDA 1H1LA 1HUQA 1ZM2A 4S0ZA 3LFUA 4AJJA 3WLHA 4CEHB 3IQZA 2ZGVA 1L5YA 1Y37A 4M0KA 3AU8A 4NV3A 1GUAA 2R48A 4KQGA 1CQXA 1NU8A 4IIJB 5DO9A 2IIBA 2I71A 3IPCA 4JJIA 3FOAA 5DYTA 3K9CA 2HSJA 4GGMX 4IVPA 4FCVA 5C35A 1TM2A 2X58A 1ORHA 4QXQA 5JIBA 4MROA 4JITA 4RHFA 4RTKA 2WD9A 4QU5A 3UK7A 1YRAA 1Z4LA 2VYVD 2A9PA 3PHHA 4PX5A 1MX1A 5JLJA 3EAQA 1S2OA 1WIWA 2V4ZA 3K73O 3NXSA 4NCIA 4PM4A 2IODA 3UWPA 4MQBA 4RA9A 3AEKB 1K92A 2C4NA 1QVRA 2Z8YA 1PFWA 4ESOA 3RVNA 4UEWA 3EXFB 4ZMRA 1MQAA 5EZ6B 3WGYA 5E1BA 4E3ZA 2I3BA 3F4LA 3TKAA 3P96A 1WM1A 1KZHA 1UKVY 2IQ5A 4MVWA 3MUOA 1X0VA 3GLHE 4X97A 4P33A 3PNOA 1BHJA 4I99A 1KHTA 1PKXA 1RKUA 3WWZA 2I1LA 2GN0A 2C03A 2IVFA 2W0MA 3OKAA 4Q9IA 1XZMA 1EG7A 1QHYA 4L2IB 2HT6A 4NOLA 1T9GS 4ZKEA 4KR0A 4L27A 4Q7EA 2BE7A 1LLDA 1WX1A 5BSWA 1NTOA 1V1RB 4AD8A 4KQKA 1BVRA 3CLUD 3G9QA 4LGYA 5IEBA 3RFVA 1D4ZA 2EDCA 3L06A 621PA 4B87A 5KYKA 1QP7A 1X1DA 2FVXA 3HCOA 2CK3D 1QHIA 5KNCH 4KWHA 4MDFA 4C3VA 5C9ZA 1ZI9A 5FA6A 4A8PA 1X19A 1P19A 2QLNA 3ORQA 5KO2A 4RF2A 3RUIA 1L7NA 1MU0A 3BGOS 3NHWA 5SV2A 1PW5A 2BBSA 2ZROA 4H18A 5ED4A 4ARZA 4JQZA 1F17A 1ZJ5A 5HF6A 3Q2OA 4R5MA 5JAOA 1M75A 4HTAA 3WL8A 1JV2B 1BN6A 3O7WA 4Z0TA 4R1SA 3CM0A 4DWOA 4B35A 4FC7A 1GP2A 1JW9B 3LY8A 3CTMA 4OB8A 4UU7A 1RRCA 1ZJJA 1SELA 2VOEA 2B61A 3WYCA 1ZM7A 1G8GA 3ANXA 1RJDA 2A0KA 3H1PA 3NKFA 1QHHA 1QPBA 3G88A 3CZAA 3W2IA 1YOVB 2AXQA 3C6QA 2PT6A 4NBVA 2PSHA 1H5QA 2JLSA 1E9CA 2XCQA 4F1KA 1G8FA 1Y8AA 4MW9A 5I7UA 1ZICA 3SZRA 4I3HA 3TD6A 2VBFA 1CU1A 1HDCA 5K51A 4CF6A 1AQNA 2ZM5A 3EHDA 2HRZA 3W9UA 2NADA 4MVJI 1E2GA 1YOBA 4Z8YA 1E3WA 1H1LB 4RZXA 5JXGA 2FR8C 4DRXA 1Z7WA 3QE4A 2WT4A 2VYFA 1X14A 3K1ZA 3OFND 3SHTA 4M9RA 5G41A 3OLYA 2DR3A 4X5OA 2COUA 1RYEA 1PTKA 4GP6A 2UZ1A 1RWOA 2EW2A 1HF3A 1QIDA 1OY1A 2QWXA 2R6AA 3HFGA 4G0UA 1XTBA 3QE0A 2CLOB 1BA2A 4LJYA 4U2FA 3U7EB 4B3IA 4WESA 1CRQA 4RU1A 5FAKA 1Y6GA 4WECA 3A1CA 1GADO 3MTEA 3UCEA 3DCJA 1BHO1 4BWFB 3R20A 3WB0A 1GL9B 1ZK1A 2I2FA 1EBUA 1IHYA 2DWPA 3FCCA 3K1YA 4D02A 1YL7A 4A8JA 1O6CA 3PU6A 2CHQA 1M74A 2GD6A 3PWKA 4F11A 4RD6A 2HCFA 3K0CC 3W3AH 3FOZA 1XAHA 1PFUA 2VUSA 1JA9A 4M89A 1R50A 4PTYA 3AG6A 1QIIA 3A58B 3G2QA 3HFRA 4GKBA 4EJ2A 4A0RA 5EGSA 4C2BA 1VLZA 3OCWA 1BXRA 1GKLA 4V3BA 3CX4A 4DYDA 1CKEA 4NYMQ 3WGNA 1L5HA 3ZHYA 1NM5C 3L40A 4OQDA 1CZUA 3T3MB 1GITA 5IYZB 2CNDA 1O54A 4BQRA 5CCDA 3EXIB 5KWSA 5FUXA 3VVBA 4I6GA 1NG1A 1DTWB 1WXXA 3R75A 4HDMB 3H42B 3OVMA 1I4WA 3AERB 3SJCA 3K35A 4F72A 2OFOA 4WOPA 2ZYRA 4RJ2A 4NU0A 4QDZA 1Y7LA 3RGWS 1ND5A 3JWHA 1MA0A 5ILOA 3IDQA 3EG5A 3EE6A 3GEDA 1OGJA 2O5EA 3GGJA 5F5XA 1IDOA 3OZIA 3E9YA 5EE0A 2ATCA 4COKA 1TJ4A 2G70A 2I6FA 3KD3A 4OJMX 5T4EA 3ZN2A 3LCJA 3AMVA 4KE8A 1HNXB 5ALPA 4ZTBA 2XDQA 2HX1A 5IHXA 1NW3A 3X43A 3E03A 4MI3A 1Y1RA 2ODNA 4BNHA 1QYXA 3EC2A 1IWBB 3ID6C 5I47A 4JI8B 4ILKA 3AHIA 4BFXA 1J5PA 3IV7A 2D4AA 1AQ6A 5G0WA 3L8ZA 1W8DA 2BAGA 4UDXX 5ELXA 1VJDA 2GWHA 1LBSA 1ZIYA 3BICA 4M7PA 5ALZA 2CB9A 2F3PA 2IC5A 4LJ9A 4R8KA 3JYOA 4EPWA 5B5SA 3AR2A 1K5HA 2QQEA 2AQ8A 3K5HA 1ESZA 4IQ0A 3DMGA 5AI9A 1WMBA 1BAPA 4CTKA 5DM70 1QUEA 1Q11A 3I6YA 4OBWA 4B4UA 2AW3A 2EJCA 4KQIA 3TRHA 4ZYVA 4DZRA 2ZBUA 5JZ9A 5K0FA 2D7DA 3KBBA 4I4TB 5KDDA 3VHLB 5BW5A 3THWA 2ZWIA 6Q21A 3AVTA 4WLEA 5DLPA 1MZPA 3PI6A 4I1RA 2VZ0A 1DEAA 2VK1A 3IPXA 1W36C 4L0CA 3D1JA 2AJCA 1R9MA 2JBHA 1IIBA 2FQ1A 2WSIA 5FOVA 2WABA 4PNPA 3O31A 4ZARA 3ZLBA 3TTYA 2B1RA 4BX2A 3Q3EA 2IPXA 3TZQA 1V48A 2O2XA 1GO2A 3KVOA 5BN3A 1DSSG 3L9XA 3DXXA 4K87A 2JLWA 2REXB 4K9RA 4A6EA 3QX3A 1JEDA 3A8TA 1YZTA 3BMQA 4GIBA 4LY3A 1KFEB 4L5YA 4Q9JA 3GP3A 2IUEA 5ULLA 3ONDA 2HJRA 1JJVA 5IWCA 2P3QA 4FSDA 4LSGA 2FWRA 3C85A 3DBHA 2R79A 2HRDA 2HK7A 1SCJA 3W6NA 1U4OA 2NO7A 3QTLA 4F8EA 2G63A 1QX4A 3SBXA 3VSDA 2JEYA 1P18A 3OCVA 1XMOB 4GOOD 4H7IA 5ALSA 5JAHA 1K7CA 1OR8A 3UATA 4QKQA 4J0CA 5FJJA 1LQTA 5LP6A 1G2PA 2G1KA 1EAYA 1FW8A 1LCIA 2H7YA 1FU7A 4RJTA 1T2FA 5FF9A 3F1LA 2FX5A 1J9GA 1G2OA 3N7AA 2P91A 3HKBA 4QX6A 2V7PA 4Z0HO 2FSSA 2HN9A 1P2GA 3MEQA 2ORWA 5EY5B 1RHQA 3PHJA 1NW5A 1XZFA 4DN6A 5JZBA 2EYQA 3ZK9A 4JCCA 1FLNA 1VMIA 4BQIA 4Q15A 1G5PA 1XXHB 3RBZA 5DNDA 4ETIA 5E2BA 3TFWA 2ZOSA 2WUFA 4ZEXA 4X71A 1A2QA 4NONA 2CGEA 1XA4A 3QVSA 2J5RA 5M29A 1Z9BA 3OIVA 4AJ4A 3I73A 4HV4A 1GNLA 2QJOA 4NI5A 4DG8A 4F46A 3OMWA 4K9PA 3BJEA 4KAFA 4O25A 1CVLA 3O3NB 4K88A 4TWBA 3SF8A 3F73A 4G56A 5KZMB 5FTJA 4GVXA 3LX6A 5F5NA 2F48A 3CNHA 3O75A 3PK0A 1QRAA 2Q3BA 3I39X 4QYXA 3SIRA 1FQJA 4HLCA 2Z9DA 4RD1A 5DF1A 3WL4A 4BFZA 1T2NA 1B43A 3TN7A 3EWSA 3ZY4A 4EHLA 4PG6A 3WMEA 3KVVA 2JAUA 1ID1A 4YALA 1RRFA 1U4SA 4V0RA 3RRMA 5KYYA 1RAAA 1SC6A 1QQ7A 3M4JA 4TQGA 4WXYB 4PN3A 2JI9A 2EL9A 1NI4B 3PFGA 4JU8A 4PAOA 1PYDA 3RV3A 1YU9A 2Y99A 2OZKA 5GZ6A 3RBXA 2JRLA 1EPUA 2A0XA 2DLNA 1GRQA 1N9GB 3ZZ1A 1RHUA 1NMXA 3TFQA 3G0HA 1N5MA 1KNXA 5KSOA 2YV2A 5A9TA 2YYZA 2XKAA 4HZIA 4OQLA 1GEGA 1B93A 3G9XA 3R7WB 4DLNA 3LPMA 5JI3E 4Y67A 1E3TA 1UF9A 3ZWDA 4G07A 1CUFA 1SOVA 1UPUA 2RHOA 1AY0A 3I9LA 3Q7RA 4G84A 1UKYA 4PGFA 3LHSA 5J5VA 4CHGA 2RGWA 1Z15A 2QR3A 3IUYA 2AG8A 2FFHA 4G89A 3AONB 2BR5A 2WFLA 5FD8A 5C3UA 4M0PA 1F0PA 3N0RA 2G3YA 4BMXA 1U9IA 3BF8A 1ISHA 2FUEA 2RBEA 1F3LA 2VCYA 3H18A 3L0SA 3KKPA 3LUJA 1JI0A 3KJIA 1WR8A 3TZLA 5K3FB 4MMXB 5I9NA 4NARA 4C0WA 1SEVA 4B31A 1B15A 3K09A 1G21E 2ZDHA 5AICA 2B20A 2H63A 2W2LD 2WF7A 3EXHC 4IEIA 4E5VA 4ZKDA 5CBKA 1KTIA 4ZC8A 1L7RA 1GDDA 2HNAA 2WDPA 5G3ZA 5GWXA 5K0ZA 1F0YA 2BGGA 3INNA 2NQ2C 2XMRA 1LK5A 4EK9A 5I7VA 3MD0A 2V5AA 1B8VA 3CNBA 1P17A 3V2UA 4DNXA 5AUOB 1ULHA 2Q0QA 3ORFA 2YXNA 3K53A 4RA9B 3B3GA 3AX6A 5KTSA 3B12A 5B64A 1NPYA 2DFTA 4MJXA 4QHSA 5SY9A 1XDBA 1XLTC 9MHTA 2KYRA 3U9SA 1U7PA 3P71T 3WMRA 2ORIA 3RROA 1ISIA 1UP6A 5LFAA 5DTEA 2VI5A 3DEZA 3PGA1 3GCZA 5IN5A 4CCWA 4OG2A 2OXTA 4XGKA 2HJVA 3UJ7A 4HDNB 2MCFA 3SYMA 3U4HA 4K9DA 1ZK2A 3QE3A 4WLVA 1NMZA 3JR3A 2DE0X 4O5AA 2UUBB 2J08A 4XB1A 4PYLA 2QRLA 2YVQA 3I28A 4JELA 1UFKA 2PTHA 5I8WA 2G88A 1NGSA 2BZ0A 1KEPA 2I2XB 2XHEA 3ZZTA 3KBOA 4EKYA 2GGSA 1NF8A 3E3LA 4PLWA 2OC4A 2ON6A 4M0UA 2XYHA 3HPQA 1LJ8A 2C95A 4BC1A 2XW6A 2FWAA 3ICVA 5I9BA 2BMDA 1WHSA 3K94A 4D9GA 5DDIP 2JJ8A 3KRTA 4FYHA 3SSAA 1X3LA 2ZRDA 3AB7A 3E2PA 3RAPR 1YDHA 3MJTA 3U7RA 1GPH1 1JQDA 5T5QA 1F5NA 2XGGA 2XOKD 3M6AA 4BDSA 1F51E 4QPPA 4YV0A 1SWVA 1MAUA 1XEXB 4JLJA 4MQLA 3ZJUA 1C3OB 4ZRMA 2JFXA 2WZDA 4JODA 4MKRA 4XGNA 4LS3A 1ZH6A 4ZCRA 4D9NA 3RYTC 3CW9A 4DMMA 4OFBA 5FO1A 2QZZA 3KUCA 3LXMA 5FH9A 1G4HA 3KU1A 4JUAA 4RIFA 3TX2A 3CVUA 2O06A 4GU5A 1W46A 1FBNA 1LD3A 3A37A 1YA8A 4F3RA 3KQYA 3MXOA 4HGPA 4JA0A 4NMHA 4O0LA 3A1VA 5D1HA 3LUHA 4G2NA 1I4LD 4RW0A 3OJFA 2YWDA 4RKEA 3ZDAA 2F4VB 5BNTA 2IYVA 4GMHA 1RCUA 3IGFA 1DPFA 3WKEA 1CYEA 4KAXA 4Q48A 3V9PA 1TF7A 4HVLA 4BBJA 4WN9B 3HVUA 1D6MA 3WGGA 3G2OA 4BFTA 2AZMA 2OD7A 2W2TA 3WKBA 4M0CA 5JOQA 1V47A 2A7QA 3NTQA 4BNLA 3RIYA 3DAPA 2OVBA 4QEZA 3WK8A 2ONKA 4ITRC 1UM9A 2VEDA 1QU3A 2CZQA 1UADA 2O0KA 3GH1A 1RQNA 3G79A 3D5QA 3K9LA 1WDLA 3LECA 3MQ2A 1Y3BE 3LWBA 2VXBA 2GEUA 2OOKA 1NN0A 3DL2A 3KSUA 1M1NA 5A2GA 1VB5A 4MV3A 3TAHA 3M82A 3WADA 4EQ6B 2QN7A 3D64A 3D6VA 5EZ5A 3WC4A 3NIDB 3PYXA 4UM8B 1RXIA 1VG0B 3QWFA 3ILVA 2BHTA 4N5NA 1Z0SA 1A04A 1EXMA 5FWYA 4BFUA 4WNIA 1YAHA 4UMVA 2W6ID 4LFCB 1V8DA 1HRDA 2GX6A 4MGYR 4QJ4A 4CDMA 4XUEA 3C5EA 4A03A 5K0TA 1KOGA 2VK4A 4HQFA 1U80A 4HWGA 2BBWA 4OHYA 4J3NA 4Y1GA 3GELA 1JHYA 4CKEA 1I3KA 3BXXA 4A15A 4ZOQI 1LPSA 4BB5A 1Y89A 2AVDA 1B8UA 3A4TA 1S4QA 2BGNA 3TO5A 4GD3Q 3D4LA 3GF4A 4KVFA 3VU8A 5MF6A 1U0BB 3F6BX 4KSCA 1OMOA 1SU7A 5DGHA 1R0LA 3V2GA 4V0LA 1BKYA 1DT5A 3WA6A 5I5EA 2XWQA 1FA9A 5GVSA 4FX2A 2O3RA 3RDPA 4FIZA 2XZTA 1Q44A 2HXGA 3G1UA 3OCUA 1YR1A 4N54A 5AOCA 5B1EA 1KDZA 1CHNA 3BQMB 1MJGM 3TI9A 2ZUWA 3HFSA 4FGUA 4OP1A 5B1HA 5B4TA 3BSSA 1Q1QA 3LK7A 2RHBA 3LBAA 4BRSA 2PIDA 3MJCA 3NKVA 4CYMA 5CFQA 5T67A 4YAEA 4BIMA 4LPKA 1UBFA 4RNDB 2H06A 1EEHA 5ERXA 5JRZA 5JPCA 4YXFA 2O8BB 2SCUA 4ZT7A 5LOVA 4XIJA 2HHJA 3QKTA 5KQGA 3U7QB 5JFGA 2C88A 2C8VA 2QX4A 2VBCA 3NNNA 4HY3A 4L4SA 5JNSA 3RLFA 2RSLA 1UPTA 3QVVA 4MWDA 3RQSA 1PJ4A 1SR8A 2QL6A 1LDEA 2R751 3RWOA 1SXHA 3WQHA 2EFGA 4UKDA 1P80A 4LA4A 3L93A 2HDHA 5AW9A 4WX2B 1NLZA 5GTDA 2F8SA 2WIAA 4GT1A 2BRUA 4UNNA 3KOYA 5CNIA 1N4DA 5CA1B 5HQ3B 1OFUX 3GDFA 4CFYA 3CVYA 2XUZA 5DWDA 1Z8NA 3BUSA 3OZRA 4GLOA 3V00A 2GVNA 3F3KA 1Q7GA 4U1RA 3O1LA 2QAGA 2NW6A 2FWJA 2NTNA 3TW8A 4B6GA 5JHHB 4WJKB 2AFHB 3VI4B 2FDXA 3PR3A 1LDMA 4W99A 1ONOA 4O8ZA 2B34A 4FFBA 1G6OA 4YB8A 3AXSA 5EN4A 3BSYA 4RZ2A 4CQLA 3DAFA 4IV5A 1RJ9A 3VX4A 5CIWA 1IBCA 2PX2A 5E3IA 4F2HA 4KHPB 4WXRA 2JS7A 2JLVA 5AM5A 4K2HA 1CUEA 1O4WA 4RY2A 5HGXA 2D8AA 5KHLB 1Z47A 1XALA 3T3PB 1X2EA 4J2OA 3JZFA 1R12A 1Y98A 4IHJB 3ZWPA 3U3OA 4PCAA 1SHKA 1XZHA 4UTZA 4MRMB 5KYYB 1N3BA 3IURA 3RJMA 5L3RA 5LQUA 2GJAA 2BUCA 4E46A 4C04A 2K87A 4OK5A 3F5QA 2JIZD 2ZT6A 3LXXA 4MKFA 1MB2A 2I8LA 3ULKA 2BFCA 1RZUA 2FW8A 4QYTA 1V1RA 3ST7A 3AVWA 1REQA 1MDBA 3C41J 1U1GA 2OV3A 1Y3IA 1MG5A 4AICA 4KJZA 4GI1A 2QRHA 4AN1A 2FTKE 1YZHA 2HMVA 2PXXA 1H2XA 5HK8A 2HUNA 1K8ZB 2I0FA 4OGGA 4V0QA 5HMLA 3R8FA 1VE7A 5BN1A 1LGYA 1DFGA 4FTWA 1R0CA 4WNYA 3ZCSA 3ETJA 3ZU5A 1N2BA 5CFLA 2UUAB 3STWA 3W7AA 3M2PA 4GEGA 4J0DA 2C5BA 3UTDA 2L69A 3A6LA 5IJ0A 2QRUA 1SVWA 3NHPA 3L8YA 3GEMA 4YJ3B 3VNVA 1CUWA 2A57A 4HNHA 3UYLA 4IGIA 5T7BA 1CUHA 2DFKB 1GZ6A 4YP9A 4G01B 4NY1A 1P4HA 1H6CA 1EMDA 2FEAA 1NURA 2FR8A 5KOYA 1H4QA 3FPHA 4L1KA 4OAPA 1ZY2A 2CBZA 1PL8A 1NR7A 3QKUA 2TMYA 2ZYVX 4KQWA 2Q99A 2W2MA 4IIJA 1MAAA 2EGGA 4UHFA 4YS6A 5IUKC 4PZAA 4K9KA 2CCJA 1KEEA 2JD2A 3E0XA 2X2PA 4DYHA 2LVBA 5L95A 2R00A 3WKDA 3ZIAD 3DFUA 1E3IA 4OB7A 1MOQA 4E13A 2QN9A 2EKPA 1INLA 1PJRA 3T5TA 4CNBA 4R0MA 5ALRA 2IQIA 4WL0A 3OEHA 3ZWWA 1EWQA 1XD8A 2FLKA 4I66A 2PLAA 1GTJ1 3GUZA 3C1TA 1UQRA 2HBRA 3E2IA 5ALOA 1LZKA 5JJKA 1JFFA 4YJGA 1GIAA 3YASA 5EZYA 3KAJA 4A1OA 1DHRA 1HSOA 1S8OA 1JSXA 2V0CA 4JVSB 2QKYA 4MKGA 1PV2A 4RE5A 5DMXA 2BFEB 2QTAA 2W2VA 2B0CA 1YXMA 4JJ8A 4BFYA 1A7KA 3NRBA 2CNWA 4ZDWA 3ZDZB 5KQPA 2WKQA 1RYZA 2QIOA 1XQ6A 2N46A 3HJRA 3UGTA 2AG5A 2Y3IA 3X2EA 3CW8X 1JI3A 1FSZA 1SXJC 2JJ1D 2HV8A 3HDGA 1FFSA 2HHAA 3LHFA 3N8GA 1UEXC 5D00A 3I4LA 1ZBQA 4JOBA 1JR4A 1ZH4A 2VYCA 2R1VA 2GNAA 4LF9B 1VXRA 1E7YA 1YKFA 4JYCA 2XTMA 1E8NA 5CX1B 1OB5A 1HYGA 1Y5LA 1UMCA 5JD5A 1IYZA 4EDHA 1CUAA 3CX6A 1EWYA 2QJFA 4MVXA 2XMZA 2PU5A 3GJ0A 1LS1A 1VSQA 4QBKA 1YJCA 1EVEA 1G66A 1EIWA 2VVTA 2IOQA 5DIFA 1S3IA 3TIIA 1R6DA 4W5HA 3VR2D 3PBKA 1FNDA 3VR0A 1Z25A 2BSAA 1BE1A 1VE1A 3CUEF 4ON9A 2NG1A 3V1YA 1E4OA 2HK8A 1XRNA 3F2VA 4JB2A 4FCWA 1XI2A 1QGAA 4YCNA 3D1VA 3TQSA 4RTJA 1SXQA 1L5HB 1PKEA 3G8CA 3AHHA 3N28A 2CDAA 1O95D 2XMDA 3N53A 4KZKA 4QD3A 4QICA 4WQMA 4WZBA 3R8CA 3ZD7A 2VYNA 2DBYA 3GL9A 2A35A 4OX9Y 1V2HE 4LCBA 5REQB 1UWKA 2YIDA 3MWGA 1GU0A 3T7EA 3ZWYA 3HYTA 4GXTA 5EZQA 2ET6A 2PKXA 2DOKA 3BZWA 3ZXSA 4DXDA 4JT8A 6CHYA 1HOXA 1KAMA 2PUVA 4WSOA 1W30A 2C5LA 1QRUA 2OORC 1V7CA 5EWLB 3ZUGA 8ABPA 2NSDA 3L0PA 1NULA 3H6HA 4J7XA 5HBRA 3DZKA 2IV2X 3TGLA 5FFFA 5DFAA 2QXYA 5LN1A 3K0FA 3RC2A 5K20A 5KVSA 5JAMA 1UAGA 4G5FA 3SHOA 3KKOA 3UJHA 2GFQA 5KNBH 3U56A 1EJBA 5D85A 4BKUA 3IERA 3BILA 1W75A 2B4TO 4JDPA 3AY7A 1B76A 2F4NA 3GD7A 4LZWA 4MEAA 3HCBA 4RPGA 3H2YA 5DSZA 4ZI7F 1EUDA 4KPUA 3MAJA 5BSMA 3RT1A 4E5PA 2P6UA 4UBKA 1K8RA 1E20A 2VQ3A 3DUFB 4FHDA 4JBXA 5IF3A 5HF9A 4DA0A 3WK7A 2WTXA 5HQTA 3KALA 1K7YA 3NG1A 2JFWA 5MGNA 3ZHZA 1JDNA 2ZTMA 5KBYA 1QHNA 2X6QA 3X1JA 3FHTA 4TTTS 2XUHA 2ZU6A 3IXMA 2ZAGA 1BFKA 2Z1NA 3V5NA 1M7HA 1PS8A 3T5AA 3K6SA 1KMMA 2AZXA 1GV1A 2FRDC 3CEPB 4Y2XA 2GA9A 5JYBA 1Z5WA 4BRZA 5AR1A 5AJZA 4LFAB 1BWSA 3GJXC 4FINA 1IN7A 1DOHA 4LCJA 1GQYA 2GDJA 4A16A 4AJHA 4F1WA 2E0IA 1EWRA 1W52X 1IXYA 2VPZA 2VJNA 4WHMA 1NQWA 2Z2XA 3KJXA 3HEAA 1V1MB 2TRSB 1T9KA 3GLIB 4MUHA 4AJ2A 4Q1AA 2FMTA 1MKYA 1U2EA 1OXTA 3B1ZA 1P7ZA 3PPWA 2PVCA 3PLNA 1JT9A 1CRZA 1G9SA 1MB0A 2JBAB 3CIOA 4FWBA 1UZLA 2XYVA 3FF4A 2D2EA 4Q1DA 3VMMA 2Z6QA 5CFOA 3PDIA 1SU4A 1Z3CA 3RFTA 2KM1A 1WBJB 4AY2A 1KI7A 2ZI9A 5L45A 3JAKA 2H8KA 4W5WA 2MTBA 1Q0RA 8GPBA 1QK3A 1XCOA 1BJTA 2ZSJA 4RVDA 2FQQA 1E9RA 1T5BA 3AFHA 4L3OA 5K3AA 4NATA 1JKFA 3VISA 3ZZMA 4XCQA 3UK6A 2HMSA 5B12A 4FLEA 2IOFA 1P2SA 3K09C 3IOYA 3BHNA 2I1QA 1FJGB 4LJ4A 5TXGA 2J5XA 2J9FB 2IEGA 2ESRA 2HU5A 2V7WA 2ERYA 4XE5A 2C29D 3UB2A 1T8PA 1AM4D 4P92A 2XJ4A 3GZ4A 3LQ1A 3N0VA 3TM4A 3F96A 4L5IA 1U02A 3ETCA 5JMOA 3MBIA 4E15A 4F96A 4RTOA 4BVAA 2HA7A 3EOZA 2YWEA 2ZRCA 4LXQA 2IH5A 3Q3IA 4G86A 1TNDA 4U2CA 1DMRA 3O8QA 5T8KC 1THMA 4LMPA 2PH5A 1AKTA 4HPWA 4L0QA 1W35A 3EH1A 5A6SB 1VKZA 4AVYA 7AT1A 3NASA 1NV9A 5CITA 1D0VA 3RIEA 4BBAA 2AMLA 2MU1A 1F6BA 1XHEA 2V7QA 2IUYA 2VC2B 3OZFA 2EDAA 5K6AC 2A4MA 1WKVA 2GZRA 1YS1X 1ZUIA 1Z0JA 5DHUA 3INYA 1HFEL 2RC5A 2ZBFA 3CZPA 3ISJA 4JWTA 2JGMA 1PR9A 3G2LA 1Q0PA 16PKA 4KUHA 3ZH9B 5HRUA 3QVJA 1K5GA 1P7WA 1JEYB 1OXBB 4A3SA 1XB2A 3HY4A 4AY5A 4DREA 4P0QB 3H87A 4LDRA 5DI3B 3HCEA 3U3KA 1PP4A 1YDFA 4GXRA 1W88A 3GUYA 2V9ZA 2A1UA 3AM4A 2P4EA 3B1XA 2P90A 2D1SA 2R9VA 4EY8A 3HXQA 4Y1RB 2Y67A 5IDWA 2BONA 2I2DA 4C43A 3EVCA 4BN4A 4B3BA 2VO1A 4EZEA 5LJIA 3H13A 1IXSB 5B1DA 1JYSA 1ZC4A 4MCAA 4OXQA 1VL1A 3BF7A 5KJCA 3JQGA 4B3GA 2CYAA 3GGPA 3QELB 1F8YA 1Z39A 4EG4A 2C84A 4EEKA 2VF7A 3KHKA 2WDZA 4A7PA 3OTQA 1NUHA 3T1VA 4BFCA 2Y1FA 3ZPXA 1TOAA 3IAM6 4KP7A 5HMMA 4R8SA 4GSKA 1HFWA 1RJWA 3LG2A 4I6JA 4ZAZA 4ER7A 1EHCA 1QO9A 1XZKA 4LMRA 2VT6A 3T38A 1JHPA 1T4CB 3W8EA 2AA3A 2FWPA 2H4ZA 3PX7A 1ZHHA 3RC9A 3E81A 1V4BA 2ZJ4A 2HEIA 2Z9CA 4PYJA 2WWFA 3I2KA 5AXBA 1CJBA 3OHSX 4C0QC 4OXYA 3AT1A 4HAYA 1KJNA 3KQKA 1UCFA 1KI2A 4IQFA 4Q12A 1CZKA 1O6FA 1CJKC 2ENUA 3BL6A 1SBCA 2O23A 3DE3X 3H9GA 3NX4A 3WRWA 1UBNA 4HC4A 5KKNB 4BMPB 3W5CA 4I5DA 2EKQA 4GKVA 1A8UA 3A06A 1LBEA 1XL1A 2FSVA 3KUDA 3TJZA 4HLQB 5A3JA 2H2WA 1MH1A 3KB1A 3REGA 5B6JA 3NIBA 3LW7A 5G0UA 1VJRA 5TGZA 2JLYA 4BPBA 5KMGB 5KB3A 1TRKA 4GWLA 3AUAA 3E82A 3EVDA 1BWQA 2P9GA 3ED5A 4LIPD 2HLDA 1DJMA 4FM9A 3WDLA 1T3ZA 4NYIQ 4U0JA 3U61B 2GYWA 2OAEA 2R1VB 1KYXA 2GYVA 3MTBA 3H8VA 4YRCA 2ZBRA 5DBIA 4L2IA 4IUCS 4N0DA 3TVYA 4J2HA 2OLKA 3Q9SA 1NG9A 1SCAA 2RJ3A 3I01M 3WIBA 2NSYA 4LV6A 1L5VA 5JJ5A 3IEIA 2HQOA 1BMQA 3OD1A 4FYJA 1IMJA 2I6XA 1E5XA 4I4IA 2KPOA 2CXQA 2VHXA 3GAZA 1Z37A 2JIPA 4O4IB 4CU2A 3PEUA 3B6EA 5TGTA 5FV4A 5ADWA 1JR6A 1WXIA 1T9ZA 5DBHX 3UG7A 2PGDA 5IJAA 1TVKB 3L3BA 1M0WA 5JMWA 5CBPA 4GFDA 2QN2A 2O2GA 4L28A 1NMQA 3Q8WA 1ABBA 4XPIB 4TRMA 1AHIA 3FWNA 4EMUA 4DIBA 4AZSA 5JCOC 4HS4A 5FI3A 3Q2KA 4F8YA 3FKJA 2G6BA 3ILXA 2E4ZA 4O3FA 3EDRA 4Y9TA 3JASA 1K66A 5CB8A 5E8JA 4LMAA 2XQJA 4MYSA 2VDVE 5HBGA 5DVZA 1ZISA 2NTVA 1HZZA 1U2SA 1XEXA 4KX5A 5J63A 2O2YA 3UANA 1R5JA 4DNFA 1GYQA 1PZXA 2P9YA 3FZNA 3IHWA 3L7OA 3OKPA 4KPUB 4OP3A 3AW9A 4X20B 2HKIA 3E3NA 3H8WA 4YMIA 1IEQA 1KYQA 4TLEA 4LNUA 5IM4A 4B6RA 1R10A 2Q49A 1AKYA 3NIGB 2HF7A 1N0HA 2QU8A 3H1BA 1GQ2A 4JR0A 3VTAA 1GZSA 2BGIA 4ZYZA 4ZEMA 2SECE 2Z98A 3ZQJA 4CLOB 5DM0A 5E7IA 5ALFA 1UUFA 2DQ4A 4LK3A 1D1QA 1G20B 3EDQA 4EW3A 3AI2A 4D3FA 5KYUB 2R6HA 2VKTA 4TXMA 1VSBA 3OAAD 3PPIA 5KOHA 3GJRA 1HQYE 1ELOA 3ZDYB 2WJYA 1LA2A 3L4BA 3FPBA 1C1XB 4YRRA 2AKAB 1GNQA 3D8SA 5LQJA 4R1TA 1HV8A 4BZWA 5CDFE 4M0EA 5IXSA 3DFZA 3PICA 3OUTA 2XSZD 1L4BA 4W5JA 2EZUA 1BVUA 1MBZA 2E4YA 2QGZA 5JG7A 3GLIA 8ADHA 2H7VA 1XWIA 3P4XA 1TAQA 3VNUA 4IIJF 3ZYZA 3O21A 1OH7A 1ES9A 1PFGA 2C3OA 4PG5A 1WSDA 2DEUA 3O8OB 2N42A 3QVUA 5LQKA 1REQB 3CT6A 2ZBEA 1IK4A 1UBRS 2ZT5A 3GUVA 1OLSA 4UUPA 5JBQA 1T1SA 1WXDA 1ZNZA 3ASVA 4KO8A 3H9JA 4BX0A 4E88A 1N2OA 1LU9A 2FEKA 1RWMA 3R0JA 3W4JA 3JWJA 2P68A 1XVVA 1TA0A 2VUIB 4MRMA 4XVRA 1AGNA 1E2IA 3BGVA 3JQGB 4LAFA 3IR5A 4D42A 4PWYA 4Q1EA 3DLHA 5U4XA 2R8XA 2JLCA 2YDYA 4RY0A 1YO6A 2W4IA 2XVXA 3WLAA 2XUFA 2OHXA 5A5DA 2P65A 3DJYA 4EHIA 4Y1RA 4LWPA 1Q1NA 2HF2A 2H1CA 1ZD8A 1CIPA 4IOLA 3SN6A 3C0KA 4K86A 1VRVA 2B5VA 3EW7A 3QZUA 2BKAA 1NBEA 2ZM6B 4CQLB 3FZGA 3PI7A 5HG0A 1MJ5A 3OIFA 2VRBA 1U6JA 2FJ0A 3U1VA 2DLDA 2Z2YA 1AQUA 5D87A 3Q9LA 5JNVA 4UTXA 1DC6A 1AKWA 4PWZA 4YPVA 3SEQA 2G5PA 3CEMA 3FYDA 1UOEA 4KH0A 2OBFA 1ZEMA 4P34A 2VYND 5KYXB 2EL7A 3GP8A 3KKKA 3M1IA 4FS8A 4MUJA 1RQ2A 5FEMA 5REQA 3F4BA 1PBTA 4I50B 4O4LF 1G5HA 2F1RA 3IELA 4FMDF 5BSTA 1MXHA 3EIQA 3TMAA 3AR5A 3WQSB 1ZR2A 1C81A 3EA0A 4A2CA 4B7UA 3U4AA 1KQOA 1QF9A 3VSBA 1PNTA 2EKDA 1GCIA 1LNSA 1VKNA 5K1ZA 4ARVA 1THZA 5K4GA 5LOVB 1KMHA 4EENA 3E6AA 4KQFA 1SD1A 3JRNA 4GNKA 1OT3A 4ZV7A 5I7WA 3UMGA 1WF3A 4OKNA 3ABOB 1ILEA 4CM8B 3P97A 3RF7A 3EIOA 3ZDRA 5KTPA 1LDBA 5FTLA 3K31A 4MITA 3QRWA 3NHUA 3PXUA 4UJ5A 3IC5A 5BYBA 2JCXA 3TIVA 4BGUA 4AKIA 2LDBA 1ZA1A 2WQ7A 1L4YA 4L85A 4QYIA 5ALNA 1URPA 4BKPA 1ECLA 4GP7A 5LUAA 1Q19A 5ER9A 1XR3A 4GPTA 1BXGA 1FMLA 4ODIA 4UPEA 4UEJA 3VGPA 2H17A 4O1IA 4DY4A 2NV2B 1DE0A 5B53A 2PD6A 2I7XA 1P74A 3HMQA 1IOLA 2REOA 3ABSB 3ITNA 4AMZA 4JI4B 1OZ0A 2ZRHA 1GY8A 2OZVA 4JJGA 4AZWA 4EHNA 3RU9A 3P9QA 4XI9A 2IHUA 3T15A 4C06A 3IBSA 3A4LA 3SJZA 3TZ6A 1Z12A 4PS1A 1CT9A 1RAIA 3DOUA 1T1RA 1GFSA 1HM5A 3E7PA 3HBFA 1T9BA 4BO7A 4DV1B 3OG9A 5GP1A 2BP7B 1C8VB 1JP7A 2D00A 4RV5A 4YCSA 3OPXA 2EFDB 2X0IA 4A8TA 1A9QA 1NR1A 1TZKA 4KQCA 3N5CA 4FZRA 3RTDA 3G1WA 2GN8A 2R8YA 3GU3A 4ND3A 3W9BA 4RJKA 1I6KA 4OL0A 3QOYA 5HKOA 4G37A 5EZSA 3M6VA 1TTHA 3G9ZA 3TL6A 5I8PA 3C74A 1N0VC 3EXAA 4RFSA 1ZCJA 3FBTA 4OF4A 2ZB7A 4PBRA 4CIBA 3RYFA 1R00A 4EIWA 2EGHA 4Q4JB 4AU1A 1M76A 1JVSA 2X42A 3NP7A 2ZR0A 4OQ4A 1I3MA 4BFLA 3R9XA 1I4OA 3RSSA 5EP2A 3NU1A 2I3GA 1Z5NA 4NBKA 2PRJA 4EKNB 3BFVA 3T41A 5KPDA 2GHIA 4ZEOA 1ABFA 4NS4A 5M34A 1AGPA 3VUFA 5TPWB 2J30A 4E31A 1TM3E 2XUGA 1OLXB 3DO8A 2B1IA 4RXMA 4D7AA 2HJWA 4Z4QA 2F8TA 1XWFA 5T4FA 2A7XA 1RC0A 1KK3A 3OD5A 5I3ZA 2LPMA 2B9VA 3L7YA 4G0QA 1GARA 3U13A 1RLJA 5EMKA 4C5AA 1Z2PX 1SB9A 3HP4A 1KEUA 1NJ2A 2FB9A 1E0JA 1ODIA 3M3HA 4X41A 3GOHA 3O2JA 1XA3A 3OJXA 4W5RA 1G63A 4ISBA 1DAFA 4KITB 2FVYA 1ECJA 5ITSA 1UINA 2IE0A 4M76B 2Q4DA 3BGIA 3EZLA 4XQ0A 4WN3A 4Y2PA 3BMNB 1VBKA 3ZI7A 2C2ZA 2FPIB 2JI6A 5JCJD 4LRXA 3VH3A 1GT6A 1XRRA 4KMOA 3TW6A 3KE8A 3C7DB 2XE8A 5CK4A 3ZS9A 4C4YA 1TUGA 1R5NA 3ZCTA 3KPUA 2OCDA 1WE2A 2ZR8A 1POWA 1VLQA 4N48A 1PJAA 1FU4A 2J33A 3RARA 2HPVA 5JPIA 1XNRB 1ECFA 2ONYA 4W8HA 2FUNB 4N5MA 3OQJA 1Q14A 2RONA 2VA9A 1KZ6A 2JAOA 2DLCX 3Q1KA 3BM5A 3AIKA 4BN5A 1J6UA 3AIIA 1EGMB 5CCXA 2GHRA 4ND8B 3F9IA 1ZN9A 4PLVA 3OQNA 4RZ3A 2G17A 4TS3A 1CDEA 1GZDA 5FAXA 3RU7A 2JIOA 2XUPA 4IO0A 1NXOA 1U0NA 1KIMA 1NDQA 2UV8A 2ASEA 1J5XA 3ZGOA 2NUBA 3ZGVA 5BRAA 3AEUB 4NMWA 3UHOA 1K75A 2VDWA 3IKVA 4YJHB 5IBCA 1ATZA 3D3QA 3ETLA 4URFA 4ER6A 3HY6A 1HY3A 5EMNA 4XDZA 4AO7A 3L0CA 4DV3B 3AI7A 4BL5A 1TVEA 4TUYA 4LOHA 1MC4A 5E3HA 2EARA 2XAAA 5LU9A 2H4FA 2V3CC 1FMCA 1NL3A 2FR1A 5KAPA 3CX8A 5CHEA 1NXSA 3ZZ0A 2VAWA 1JEQA 5TQVA 4J9UE 3LZCA 4B3CA 4TVSA 2NU6A 4LMBA 3WLIA 3I1IA 3DF9A 3THRA 4Q3KA 2FPOA 4MGEA 1OB2A 1LVUA 3VZDA 2X7HA 4PONA 1C4KA 4N1AA 1UXJA 2H4XA 3KB8A 4OB6A 4QNRA 2WK1A 1QGOA 4UNPA 3TH5A 4QPJC 4DQVA 3JQPA 3ND7A 1KU0A 3DV9A 4A73A 5ITWA 5KJ6A 3P9PA 3QQ5A 1ORRA 5I9LA 4FK8A 1FNBA 3UMVA 1QYVA 2SCUB 4CZ2A 4MWSA 2Q2VA 4AUKA 1D1PA 3UH0A 1RWPA 4LXUA 2WNIA 2OUKA 5F78A 2ZI3A 4DF3A 3O90A 2CUTA 2Q6LA 2QL9A 1YGPA 2RGDA 3SDZA 2ATXA 2C4VA 4MJ7A 3C3KA 4RVNA 1PV1A 3PPYA 5A3SA 1E66A 5F1PA 3WL5A 4C4ZA 4EZIA 5HKAA 5KTOA 1UFQA 1Y7PA 1TKAA 3HCPA 3MWKA 1OLUA 5AVVA 2P35A 2FCAA 2PUGA 3COPA 3DZFA 3QELA 1DC5A 1V16B 2QQFA 3BMCB 3RUDA 2I7CA 5IULC 1ODJA 5KQRA 4NOMA 1CUUA 2XB4A 2V6GA 3STYA 4TKMA 2O54A 1P4JA 1KWKA 3LP5A 3KYCB 4KOAA 4CM4A 1OKKA 2IT1A 2PWZA 3OQHA 3HNRA 1NWCA 2FOXA 3DM9B 2ZRPA 3F49S 2HZ7A 4HRXA 4UEQA 3OJWA 1YDMA 4B75A 2AD1A 1I6MA 2Q1UA 3BAZA 3E1GA 4KB5A 4N5DA 1U8TA 3LX4A 3ZUPA 3EF3A 3EPRA 2GLTA 1G8AA 4HATA 2J7PD 4DCVA 1J25A 2JDIA 2NUAA 3HNOA 3F5SA 4JC4A 3OLZA 1PBNA 3KM0A 4K28A 3SIXA 2WUWE 4MKHA 5H7XA 5HSGA 3ESYA 3SVTA 3TLEA 2G9NA 5I7RA 4ZDKA 2ISCA 1HNNA 3U37A 3MF4A 4UMDA 3TSCA 3W9YA 4EQ6A 1L5LA 5AQEA 1PSWA 4KQ6A 2IYOA 1FP4A 6REQA 2WJWA 2X19A 1GXSB 2HWKA 2UYQA 4DQUA 1IY9A 2BHSA 2QUKA 3FOCA 4QEDA 4KPEC 5JZSA 3U44B 3DVAB 5T64A 1XE3A 2UZ4A 1LPBB 3MAAC 2DUNA 2NOAA 2B8TA 5AW6A 1FXUA 1UBTS 5IUNC 2XRZA 2IHBA 3OZVA 5GJCA 1TB4A 1V8FA 1Z75A 5MFZA 1CUBA 1CF4A 3QKWA 2CN1A 4HD8A 2CBXA 3ZEIA 2WB4A 1V8ZA 1RJ9B 3VVCA 2D06A 3KQMA 4QU0A 4WZ6A 4MMZB 4EJFA 1QGDA 3NHLA 5DP1A 3RVMA 1BG6A 4CR8A 2IYEA 4MWZA 1WVIA 3BB1A 4FNGA 3SFVA 4DLUA 3KNZA 4J91A 1B8OA 4FDMA 5GZ3A 2GKOA 1VCOA 2ACVA 4QUIA 3T1TA 1OI4A 3GRUA 4GRDA 2GI4A 3P26A 1H94A 3VJLA 4B9EA 1Y5IA 1Q20A 4RF3A 5FFMA 4EGQA 1U2GC 1V9CA 3QLUC 5ECWA 3BKXA 4TN5A 2GPNA 5FL7A 3EGDB 3JX9A 3OZCA 2YCLA 4Q3NA 2SICE 1SU8A 2O7QA 4WBXC 3EOBI 1C1DA 5IHPA 4JT2A 4YJ3A 2JJ2A 3KP1A 3PQ4A 1PX0A 1JSLA 1Y82A 5TPZD 2HO4A 2O2ZA 5JWHA 1XZQA 3GJYA 3LXUX 3EQ9A 2QPLA 1G60A 1RQRA 1XZPA 3EY4A 4MH0R 3V55A 3VZBA 1OYWA 5K0LA 1G1AA 1CW2B 5CNMA 1K89A 5J5AA 3RUAA 1C4WA 2GAAA 1NE2A 5IARA 2IZOA 3PD1A 1ZGBA 1FLDA 4MX8A 1Z6YA 2FG5A 1RWVA 1B2LA 3RC7A 3VC2A 3H86A 1B41A 1XLUA 4D8WA 4CQNA 2R68A 3QTBA 4UAUA 2Q2OA 2Y4OA 3RTCA 1C9EA 5HUJA 1JKMA 3UMJA 1TYZA 5LLSA 2ZE8A 4RDXA 1E2QA 1O2DA 2B4KA 4JSYA 2J3MA 3LP8A 2CT8A 2CDBA 4GKJB 3QVKA 1S3GA 5TF4A 1GHTA 1JDPA 4ALLA 1NYTA 1XGKA 1WP9A 2JI8A 5LMCA 1SRQA 1TMGE 1GPDG 3MYYA 1U7WA 4IF6A 2EZ9A 3ZQKA 4YAKA 4F4IA 1G1MA 2DH5A 2R25B 4MVYA 1HEYA 1E1LA 5AKIA 2XF2A 5DYIA 1C7EA 3LI2A 3C5WP 3EYAA 4LQCA 4RK4A 4BKMA 4CCAA 1QQ5A 5ES4B 1WXWA 2FN8A 3LBYA 3OE5A 3P0FA 4MR7B 2D0IA 1DADA 4QU8A 4ZT5A 5JH7A 1X7WB 3R6TA 1SHJA 1II0A 1NY5A 1QQTA 2NQ8A 5KWEA 1KEZA 2NSJA 3K70B 4LBYA 2OG2A 1EXWA 5KSWB 1BCSA 3KSZO 2CLSA 2J07A 3D54D 1VIVA 5BVHB 4YCLA 4H35A 2AHOA 1EHYA 1DARA 3WP1B 4TUYF 3ASZA 4I55F 5GPBA 3KC2A 5BSHA 1O89A 2D2XA 1Z4OA 3DM5A 4NVRA 5ALIA 4JJ4A 2C99A 1YD7A 2SKCA 3TQQA 3AEYA 3OQ6A 2H2DA 4XDYA 2O8EB 1GQRA 1A8IA 4TL6A 3K1AB 2BFOA 4E14A 2XDQB 3HO8A 4UU1A 4OYHA 5IVHA 2NTJA 3K5IA 4P2BA 2GAJA 4D0GA 4IUBS 2LIVA 3LHKA 1CZOA 2JLAA 4MARA 5DJ5A 3KETA 3HM9A 4MS3A 4D4IA 5B37A 3MFQA 1I0ZA 1EAMA 2YMPA 2OE2A 1XAGA 3G5MA 4LYJA 5KWJA 1LC0A 1X39A 2AD5A 4Q18A 4AZ3B 1XMQB 4YMLA 5K3EA 1FU8A 4EG0A 2XXAA 4Z3KA 2JGRA 4Y98A 3QPVA 3GCXA 3KEOA 5ICSA 1J2JA 4ZT6A 3KHTA 2BF7A 3WZLA 3DTVA 1TGVA 5HA5A 1ATIA 4AZ0B 1TEVA 3L8HA 3ESRA 1OA0A 3PNBA 5IZ4A 4AMBA 2WIBA 2AQKA 2FE1A 2L19A 1XCBA 2FN3A 2JD1A 1ZWKA 4OSPA 1Y48E 5FOXA 2O2HA 5JDCC 4EARA 1P9NA 5BOSA 1W4BA 3T52A 4O3MA 2FWMX 1ZUWA 2FRXA 5TMBA 3R74A 5GZ1A 1NX9A 1UXHA 3QPDA 3ZY5A 1BYUA 1Q1BA 3R4CA 1N5DA 5KINB 3BBLA 4XJVA 2I6QA 2IP2A 3RB8A 5JNTA 3C16C 3A6FA 1NONA 1Q5PA 2TMGA 2WI8A 1XMPA 1ZAKA 3KLOA 4RQAA 1ORIA 4TMKA 3RTEA 4EG7A 4BNXA 3GG9A 3TTSA 3L8FA 1OJLA 4I50F 4O4LB 4WNAB 5U9CA 1GD1O 3PKIA 2IPNA 2MR6A 3A1FA 4OLHA 4B6FA 4G0NA 5JNWA 3AKCA 4R1OA 1WHSB 3PFWO 1JHVA 4WZAE 3NC1C 2CLMB 4DHEA 4TWRA 3Q9UA 4WBSA 3VJRA 2PRZA 4LI3X 1KK1A 1LLCA 1Q21A 5GJVC 3JV7A 4DR2B 4JJEA 4IVRA 1BOOA 2XWBF 5A02A 1X42A 5EKDA 2AXNA 3RSCA 2R5FA 3CH7A 4IICA 4DBVO 4S1WA 2CYBA 1H1TA 5JW6A 3IS3A 4IFBA 2ADOA 4JQSA 1NIJA 3T3IA 3FVWA 1TIPA 2H1LA 2HQBA 4RXTA 3AR7A 3ZGZA 2MYNA 1SMKA 1KBOA 1UPXA 4Z0PA 1SBHA 4O02B 4EPYA 1A9YA 4NBRA 4WOBA 4M1WA 5CW2A 4CG1A 4F2GA 4O2AF 1D1TA 2PS9A 2E18A 3VJMA 3HB9A 4PS0A 3W5IA 1O03A 3A0UA 4KRFA 4OQPA 3L1KA 2DH6A 2WM2A 3M6FA 2E4AA 4O33A 5EJIA 4C0LA 1J9EA 4CXMA 3MPUA 3KFXA 2XITA 3RJ9A 4YYZA 1Z08A 4PANA 3G1TA 1O57A 4Q39A 1GGKA 4QO8A 1U65A 2BI4A 2B4YA 2P3SA 1HDGO 2VPQA 4RLHA 5FNZA 5TEVA 2FQWA 1L7VC 1UQUA 1XVTA 2WNSA 2V4UA 3DDZX 3O8DA 4M53A 4Y2JA 1O97D 2XQFA 1V11A 5JQGF 4KN8A 1PFQA 2HWXA 4JR1A 2OHVA 4Q4AA 2AKEA 5HQJA 4GPAA 3ZGXA 1NF2A 2ZBGA 2W6OA 3K5WA 1Z22A 3K2QA 4FOOA 2X0DA 4PQYA 4EF5A 4EO9A 1AUQA 5AKGA 2PUDA 4TLLB 3L0YA 3MA0A 3VC1A 2AZTA 2DQZA 3G2NA 4TVKA 4Y2HA 4DR6B 1VHJA 2GR9A 2EFJA 2X3FA 1WD7A 1WU7A 3U17A 4DCCA 3HDTA 2M32A 4K6HA 3OQOA 2PKWA 3AR8A 4BVJA 3GFSA 4E22A 1JAYA 4EW6A 1L7QA 3OWOA 1JEJA 2GPJA 3ADPA 1RI4A 4KW7A 4OHWA 4B3JA 1T4GA 4B79A 3C15C 3PRJA 4WKOA 3W5SA 2PO7A 2H4YA 3ROXA 1L4HA 3BFXA 1JJAA 4KC0A 3BD8A 4W63A 5B1SA 4HQOA 1THGA 2PUCA 1SAYA 3OPYB 2XI4A 3E22B 5K8CA 4R2IA 1NX6A 1XTKA 4D8VA 5JNLA 1GPKA 4N0QA 3SWWA 4MWOA 3IYLW 3ZD6A 1RRKA 1DXYA 1WXHA 1EVZA 1EWKA 2YYAA 1KJIA 1OT5A 3A26A 3TRFA 5KCZA 1FDVA 2H0QA 1L5ZA 2H1SA 3VGJA 3D3WB 2VPPA 2YW2A 3G7NA 4DC1A 4HTFB 3CB2A 3EMKA 3GCGA 4BVFA 1JSRA 2XUAA 2R7AA 3JD1A 1ZOPA 5JD6A 4ACBA 4GR5A 3AVUA 2EZ8A 1AK1A 1KKMA 4C6RA 2E4VA 2E89A 4HFJA 4YAGA 4KPYA 4NC9A 1O9BA 1BD3A 4G4SO 4GECA 4P53A 1OX6A 1DKOA 3WRXC 4EFDA 2Z8YM 5KTKA 2JLUA 3K6SB 2NXNA 4DEYA 3MTQA 3MCWA 3ZY6A 2W7TA 2YWCA 2CMKA 3N59A 4QHTA 2JJ1A 1QGYA 4HMQA 5F98A 2QYHA 3MCAA 4GZLA 1NVXQ 1BGXT 2JVIA 4REMA 2IFTA 2FETA 1VPWA 1KMNA 1OHHD 3W3AA 3LV8A 1FFXA 3DMDA 2E2WA 3PUVA 4N6GA 1WZ2A 1WMDA 121PA 5FDFA 3NTUA 3FLBA 3EYWA 2A1UB 3BVPA 4KXXA 4DPMA 5DBGA 1RBQA 2QRVB 4NH0A 5AK0A 2BGWA 3ZDBA 1DEXA 2QYOA 1F9AA 1JNXX 1JDBC 2V6IA 4MUEA 5C8YA 3RR2A 1OASA 1YQGA 2F00A 2FZWA 2C1XA 4EDFA 5IBRA 2H9IA 1P1FA 2PUTA 1QTIA 3FYUA 1MO2A 4S3MA 2IZ1A 2Q4BA 4P84A 4BNDB 3GDOA 2C2OA 1ZS9A 4RKWA 3V1MA 3RTBA 4TT8A 4PLZA 1A4UA 1JIXA 1OI7A 4INOA 1E2MA 2G1UA 1RI1A 1VXOA 2WIDA 3O8BA 3PE4A 5U4QA 4KOEC 2PMWB 1XPRA 3CNEA 1JKJA 2WWXA 1A9ZA 1FMJA 4FR2A 3UJAA 1LX7A 1PJBA 3QU7A 2IBMA 4WZBB 2QDXA 1WLYA 4I4LA 2ID4A 4KWIA 1DEOA 4KDEA 3SAJA 1OC4A 3ORSA 1L4LA 1Y9ZA 1W2WB 2AEFA 1E2FA 1LY1A 2EGUA 4LHEA 4EKIA 1D0SA 2O7RA 3L7DA 2Z1DA 1QH8B 2RG7A 3JYQA 4D9JA 5KYUA 2J0QA 3NDJA 3QXJA 1CJCA 3NTVA 4I3FA 1FDIA 2C7VA 4C4TA 2XNDA 1R6AA 2O8DA 3BTSA 5K8UA 1GR1A 3HN2A 4IJVA 3R7FA 4Z9BA 3UGJA 1SVKA 4ZFNA 2BM1A 3HYNA 3OFNA 1M73E 1YI8A 4NYIR 3ENZA 2B0JA 1P2UA 2HGZA 3FNGA 4NAUA 4RCYA 2W11A 2D0DA 4F6RA 5DRYA 2FOIA 1LI7A 2FZGA 3UWKA 2IH4A 5TF0A 3CE9A 4I9NA 1X9GA 2XVMA 4RK1A 1B1AA 1Y3DE 5HJ2A 4BGVA 4Q34A 3VDMA 1Z4QA 1OGIA 3T1HB 3BHJA 3GC6A 3GA0A 1QVZA 4WCFC 1CYDA 5TQ0B 4PZ0A 3CRQA 1KJ9A 2RK6A 2BH9A 2GCOB 3PKJA 5DT2A 5FL7D 4KQEA 1Z35A 4XPIA 4G41A 2Q5CA 2A58A 3BL5A 3KJGA 2O48X 4ND8A 1XMVA 2P5UA 3L9WA 3DWFA 3KTDA 4PRKA 1V37A 2G07A 1P61B 1VIMA 2ZUBA 3N2GB 3CQ9A 2FPGB 4QARA 3KJNA 3WIOA 3UT5A 5A5FA 3H0CA 3KJHA 1EINA 3P4UA 1DL5A 4FW9A 1OZFA 4EHFA 1RXSA 3WSTA 2DXIA 4JLBA 3LOPA 4RVGA 5I51A 2FN7A 3OFJA 3G5LA 4EJSC 3IUMA 3RRNA 3GEPA 3GLFB 3EARA 3BE4A 3NLLA 3ESBA 4N3CA 1WSAA 1M6VB 3FDXA 3OZWA 1R8JA 1K1EA 4RH1A 4XARA 5ALTA 2W70A 3TLYA 3ZG6A 2WHPA 2ZANA 1FDTA 4B3RB 4NQZA 3WXBA 4NPCA 5FQOA 4RL4A 4C01A 1Z5OA 4F5DA 3HB4X 1D09A 1JR2A 1MX5A 3MTJA 2C3UA 2XMSA 3IP1A 2NLOA 2X6TA 3RE1A 5IK2A 4MWGA 1CEQA 1MUUA 5IBPA 3I30X 3OTGA 5EP3A 2I5PO 3C7KA 4J90A 4F3YA 4EUFA 2XTNA 1U5BB 4RACA 1IEWA 1YR8A 3AFOA 3WI7A 4F86A 4D3ZA 5JJIA 3K0FB 4JUIA 4YWHA 5AW3A 2GMWA 3PHIA 3BRWA 3T1QA 4HNSA 5I9TA 1NMYA 1F1BA 4BCDA 3FCUB 4RVSA 3RVQA 1OYYA 2QMUA 2VHVA 2EZ4A 4YQFA 1U9JA 3C8UA 2HBZA 1R0RE 2OBNA 1TQHA 3HP1A 5EJ8A 1QO7A 2W6NA 1GA1A 3HZRA 1JDZA 1X7DA 5ERGB 1U9IC 1GTL1 2JH9A 2P5SA 4KL8S 1LW7A 1OBCA 2C2BA 2I1VB 4KIGA 4G9EA 4TL7A 5DE3A 2VT7A 4R71A 2PUEA 1F6WA 3SQXA 2PZFA 3NRCA 5BV1A 1YL5A 4DLKA 1WNFA 1VA5A 3R6DA 3KQSA 2JJ2D 1KSGA 3TKYA 3LVBA 4DJDC 3L1UA 4B8ZA 3UV3A 2DZDA 3PYMA 2GEKA 2I66A 5J2TB 1N6NA 1QLHA 2YHAA 4H3VA 1DS6A 1WXGA 1CS4C 2WF6A 3IR6A 4ZHQF 3EQ6A 5FR1A 1P8JA 1MW8X 2G06A 4ILEA 2A3NA 1XTJA 4MEBA 5HZHA 1KAOA 5IJZA 2IUSA 2WSSD 2HRCA 2ZVQX 3CISA 3WAKA 1OH6A 2V6JA 2YN2A 3MG9A 3PDWA 3MJHA 5IM5A 4HADA 1AMUA 1XQYA 4EL5A 3E15A 4UW9A 2ZSUA 4Y0VA 3WWPA 1MIOA 5K8TA 2E5LB 4GDFA 3KQLA 3TW4A 1R0ZA 1XKTA 2GT1A 1GTMA 2J6HA 3CRRA 4C30A 1QVAA 3RV4A 5ICEA 1P8AA 3V80A 4JP5A 2F55A 1CUDA 1RBZA 4KXFB 1LLFA 4MA0A 4OTZA 4IQ8A 3RC3A 1WUHS 3D9QX 5JT1A 1XTUA 1G16A 2VHWA 3LDUA 4IILA 1QIGA 1JFVA 4BN0A 3RU3A 5JY1A 5K0BA 4JVLA 3AEQB 2NU7B 1GZ4A 4IKOA 2ONJA 3SPXA 1J2YA 4RPIA 4EY6A 3NATA 5EUQB 1SUIA 2Z1MA 2WFLB 4XUDA 1MABA 3LOUA 1X7WA 4R2MA 1AV7A 2VZ8A 3TZBA 1XQXA 5HZMA 2O8DB 4BV8A 3DLAA 1J1UA 2ABWA 3DMRA 4UM7A 4EFMA 1NASA 2IS1A 4G2TA 2P8JA 4G5QA 1AMOA 1K5PA 4HX5A 2OCIA 3D3WA 3OEED 3PLRA 4AJ9A 4L5BA 3GGGA 4GLLA 1J24A 1CRLA 1H6AA 2V7QD 5F9FA 3HCRA 5KC9A 4LVNA 2NQTA 3D4PA 4PLCA 1FLVA 2MWMA 1SC4A 1V8BA 3QKSA 3TD2A 1TMKA 3B6KA 5TVGA 3RF6A 2CW5A 2OKGA 2PG3A 3VV3A 1H2BA 3I5YA 3LD9A 4HWPA 2R8EA 4KG7A 2FPKA 1ZIXA 3L04A 5K2OA 5AXDA 2H7CA 1PD1A 4P4LA 1XK7A 5LYJA 3AWDA 1NRIA 3QUTA 2YC2C 2ICAA 3GPBA 4CCYB 2WOJA 3TLKA 4I5EA 3V8QA 2FPIA 2F3TA 4LUCA 5ADVA 3D2LA 3V1TC 1GZVA 2PSDA 4HDOB 1KP9A 1ZOSA 2B4QA 1J9ZA 2OCYC 2PH3A 4ALIA 2PL1A 3KVRA 4TSRA 4AC9A 5AJTA 5A7HA 1EGHA 4X95A 1O5IA 1IMOA 4RQUA 4UCXA 2B99A 4NNJA 3R4VA 4NJMB 1QFSA 1X1TA 1YL6A 3EVZA 2HREA 1TAGA 2XYGA 1AGXA 2BEKA 1RDFA 2BMVA 5DEIA 4IHAA 2VDUE 3CXRA 3CGGA 3VO9A 1Q7RA 4P9NA 3A1EA 5B7GA 3ER6A 3R7NA 2J67A 1AN0A 1MJFA 2GO1A 4L9RA 4PQGA 6YASA 4FOSA 4QVIA 1ZO8A 1JLMA 2DJIA 4OHZA 4FWTA 3BCRA 1MAVA 1UC4B 1VHDA 4DDHA 4CM9D 4HK4A 3V8BA 3PQ7A 1GQQA 2XA2A 5G53C 4G0VA 2IEZA 2R87A 4BQPA 5CEJA 2JVJA 2ZJZA 2Z30A 2DULA 3B60A 4AYXA 1E5LA 4X9XA 2QAIA 1BDHA 4U7GA 5G0SA 5FKJA 4LF7B 4BQSA 1WF6A 2UUOA 3EWAA 2FSVC 3KZ1E 1FDSA 4I08A 4IHJA 4TWAA 3WZMA 1XUOA 1IG0A 3GA7A 2YMQA 3H16A 3TQCA 4XR9A 1ZLYA 4J9VA 5LP6B 1HI9A 1KZYC 2W2XA 4I7EA 2PKRA 4ZJYA 1EUDB 3AHEA 2Q8PA 3M6XA 1OAKA 4B4WA 2XNCA 2W6MA 3L4KA 4GX0A 2C98A 1ESMA 1WMEA 5AW2A 3CF2A 1KJQA 1WDTA 3JR7A 3V3TA 2XUDA 1PZHA 3AF4A 3KZNA 1C4XA 5KREA 1H05A 2ZR9A