5EGOB

Hoxb13-meis1 heterodimer bound to methylated dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
63
structure length
63
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Homeobox protein Meis1
publication title Impact of cytosine methylation on DNA binding specificities of human transcription factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5egoB00
4IHWA 3IV5A 4BY7J 4RBOA 3S17J 4M3FA 2HOTA 3HGGA 1Q1VA 2EZHA 2RAEA 4D7NA 2LLKA 1BA5A 2R0QC 1MBFA 3WHCA 2Y9YA 3BR5A 1BL0A 2VKEA 3E7LA 4B1RA 4RDUA 4Y52J 4BXXJ 3JR9A 5E3LA 1QVUA 2NVYJ 1ETVA 4EEFG 1VNDA 2CQQA 3G1LA 3SFIA 4QIWN 5E3NA 5C3EJ 1ZKGA 1LFUP 4C3IJ 3BR2A 4LOCA 5C4XJ 1UG2A 3D1NI 1WCMJ 1E3OC 1TWHJ 5IYCJ 1MSEC 2JA5J 2LVSA 3ZOBA 4UUSB 4MFDA 2EH3A 2HXOA 3BG9A 1H8AC 4G12A 2N8GA 1X2MA 3SJMA 1APLC 2E2IJ 3HB9A 3IH4A 2CU7A 3TP3A 2MW8A 4A69C 1B72B 1WH7A 2ECBA 5FKMA 3H3VK 2QCOA 3S1RJ 2FD5A 1ENHA 3BQZA 2TCTA 1F36A 2X48A 5F08A 3RZOJ 3BR1A 2O8KA 1TWAJ 2CUEA 1RPWA 1CQTA 1VF9A 2FX0A 5F1JA 1TWFJ 4GFBA 1U9NA 4X1EA 1FJLA 5GP9A 3FK6A 3GTMJ 3G1MA 2DA4A 3GTLJ 5FKOA 3S1NJ 3FISA 3S2DJ 2HOSA 4V2GA 4FTHA 3K2AA 5FJ8J 2WB1N 3RKQA 1GDTA 2E2HJ 3MKLA 4JP0A 1EF4A 2Y9ZA 1JJ6C 1SANA 4A3LJ 1ETOA 4IHVA 2CJJA 3TP0A 1RR7A 3LSPA 1JJ8C 3JRHA 1ZR2A 2XPVA 5K7HA 1JKPC 1JTXA 1TWGJ 3HOUJ 3LOCA 5M5YJ 2HDDA 3DCFA 1JUPA 3I4NJ 3Q0UA 3A01B 1MBKA 4QTRA 1MBJA 1RKWA 1DU0A 5IP6A 2FJ1A 2OF7A 1IDYA 2EQRA 5E3MA 4QSHA 1IC8A 5HODA 3I4MJ 4I76A 2LTPA 2COBA 1Y1VJ 2MG4A 2XB0X 4UUTA 2HYJA 3HGYA 3JREA 1MBEA 1WPKA 4FE4A 3BR0A 4I6ZA 3JRCA 2XGDA 4A3BJ 4JX4A 3WHBA 4JX6A 2ECCA 1I6HJ 2TRTA 3MN2A 1JUSA 3NAUA 4DZPA 3HOYJ 1OCTC 3FIWA 2FQ4A 4M3DA 5IOYA 2CRGA 2VPRA 1HDDC 2R5ZB 4BKXA 3GTQJ 1XC5A 4XICA 2K9SA 4MIMA 2HI3A 2OPTA 2JA6J 1ETQA 1HOMA 2WV1A 1BJZA 5JLWA 5EG0A 3GTPJ 2HXIA 2GM4A 5J1RA 1IV6A 1U8BA 1FIPA 3GTJJ 4V2FA 4A3MJ 3BTCA 1R9TJ 1POGA 3FKIJ 2DA1A 2Y31A 1WGXA 4C2MJ 3O8GA 3JRFA 3HDDA 4BBSJ 2H1KA 5FLVA 2XRLA 5C4JJ 3CCYA 2VUMJ 1G2HA 3FK7A 3HOWJ 4J19A 1MH4A 2XPWA 3TW7A 1O4XA 3S1MJ 4JYKA 1IGNA 2VI6A 3B6CA 3OSGA 2VKVA 4M3BA 3BT9A 1A6IA 5M5XJ 3JRBA 2D5VA 1MSFC 2Y2ZA 1LE8B 4FCYA 1W0TA 2NS7A 5IOZA 5EYRA 1LFBA 4D7MA 3Q0VA 2DN0A 2E2JJ 1Y1WJ 4IHXA 4IHYA 3M4OJ 3A03A 4HNVA 3DEWA 4A3DJ 4MLOA 4A3GJ 1JT6A 1FEXA 1NTCA 1YRNA 3HKZN 5FKKA 5DTDA 2X9DA 4W97A 4X6AJ 2XGEA 3L1PA 2E1OA 2I10A 2ME0A 2L7FP 1WH5A 2DA5A 2EBIA 2JK3A 1XS9A 3Q0WA 1HCRA 2B63J 3TEDA 2DA3A 4C3JJ 2LD5A 3F0CA 1UHSA 1B8IA 3PO2J 1ETXA 4FISA 4DZJA 2DMUA 2K9NA 3QQAA 3C2BA 4AC0A 3NARA 5EGOA 3HBLA 5F04A 2DJNA 1QPIA 2DA7A 4BY1J 2NVTJ 2JN6A 4A3JJ 2XPUA 3S1QJ 1MBHA 4XRSA 2DMQA 1X2NA 3IH2A 1NK3P 1BW6A 2GBYA 5M3MJ 3HOXJ 1OFCX 3LSRA 3RQIA 5IP9J 2M2EA 2ID6A 1IRZA 3IH3A 1RESA 5EZGA 1QVTA 1F43A 1AKHA 1ZGWA 1A5JA 4XK4A 1XG1A 3JRAA 4FE7A 5EG0B 3B6AA 4A3EJ 4M6VA 1JKOC 2R93J 5GPCA 3S14J 2ZB9A 5E3OA 3CDLA 1FIAA 2XSDC 1H89C 1PUFA 1U78A 3PM1A 3OSFA 2YU9J 4IEJA 2M9HA 3QPLA 2LFBA 1IJWC 3M3YJ 1GV2A 2DTZA 2YUSA 4S0HB 1RKTA 1ITYA 1ZK8A 1T33A 2GLOA 1P7JA 2IAIA 3S16J 4W1UA 1JKQC 2H8RA 1GV5A 4M3EA 1W0UA 4XIDA 2HOAA 2CQXA 2DMPA 1ETWA 1U9OA 2KDZA 4M3GA 5FKNA 5EF6A 2LK2A 3GTKJ 2DMTA 3ZQHA 2LP0A 1K83J 4L5EA 5M3FJ 5EEAA 3GBGA 1TC3C 3SDGA 1ORKA 2MGQA 4AUXA 1IDZA 4XRSG 2KT0A 4DYQA 3LSGA 2DA6A 5GPAA 4CYCA 3BTLA 4DYRA 1YRNB 1ZR4A 1BW5A 4ABZA 1S7EA 2R5ZA 2R5YA 2Y30A 3CMYA 1MNMC 3TW6A 1P7IA 2JMWA 2M34A 2P81A 4Y7NJ 3GTGJ 3JRGA 3PO3J 5M5WJ 3BTIA 2M8GX 2NVXJ 3HOZJ 2JA7J 5C44J 2Y0SN 2QF7A 5F0CA 2EZIA 2PMZN 3ZQIA 4DW6A 1DU6A 2NS8A 2E19A 2IEKA 3QPSA 3O8HA 5IP7J 1Z0XA 3G1OA 1AU7A 1B8IB 3GTOJ 1OCPA 3HOVJ 4A93J 5EZHA 3HEFA 5EGOB 1JKRC 2EZKA 2JWTA 1JGGA 1WI3A 2ELKA 1HLVA 1GUUA 1NK2P 3LSJA 2AHQA 3W6VA 2AO9A 1RETA 2EZLA 2K9QA 3BR6A 1JT0A 1HF0A 2G0EA 5J3LA 1D5YA 4NDLA 5IYBJ 9ANTA 5EDNA 4C3HJ 4A3KJ 5IPAA 2XGCA 1LE8A 2X6OA 4B3AA 4UUSA 5JLXA 3LNQA 2ME6A 2LY9A 5J1YA 3VPRA 1AKHB 3BR3A 3ZQCA 3RZDJ 4A3CJ 3OIOA 4B4CA 4A3IJ 1B72A 1I50J 2JA8J 4MFEA 1MH3A 3JRDA 3MVPA 1MBGA 5K7ZA 1GT0C 3CQZJ 1PUFB 1QRYA 2L7ZA 1T56A 4BBRJ 5IYDJ 2R7ZJ 3ZQGA 3ZQFA 5J1UA 3ZQLA 1JTYA 1ETYA 2WAQN 5F27A 2DMNA 4XRMA 5FKLA 1H88C 3S2HJ 5BNGA 1UMQA 4MO7A 3K7AJ 1IUFA 2MSYA 2L0KA 5F0HA 1VI0A 3BQYA 1OJLA 3HM5A 1AHDP 2LKXA 3S15J 3BG3A 3UKGA 5K7FA 5F0FA 2O9LA 1TWCJ 4D5CA 1Z77A 4JX5A 3A01A 3BG5A 1ZTRA 2ID3A 2NOGA 2YS9A 3Q3SA 4CYCB 4D5FA 4DYCA 3H0GJ 1GVDA 2O7OA 1K61A 1ETKA 2HQ5A 2IBDA 2NVQJ 2LR8A 5FLMJ 2R92J 2R5YB 1HDPA 2M0CA 1I3QJ 2DA2A 1IG7A 3A02A 3JRIA 1FTZA 1SFOJ 2CUFA 1VFCA 2K40A 3BTJA 2JJ7A 2XB5A 4A3FJ 5DS9A 4AYBN 1ZQ3P 3OOUA 1X58A 2L7MP 1FTTA 2L9RA 2W48A 1JUMA
chains in the Genus database with same CATH superfamily
4IHWA 4LIUA 3S2WA 1H9TA 2HOEA 3QODA 1PJRA 1Q1VA 2EZHA 2RAEA 3PFYA 3CC7I 1B9MA 2GA1A 4UV8A 2VT3A 4XKVA 1F9NA 3WHCA 2ADUA 2Y9YA 5FLXZ 1F4KA 2VKEA 2VJ4A 3E7LA 4IOCF 1ON1A 1ZG5A 2DFHA 4B1RA 1YW7A 1VQ6I 4LGWA 5JHUA 2XKOA 1QVUA 3CUQA 1I6HJ 1XMAA 2GZWA 5E3NA 3PNVA 1J0RA 4KJZA 5FRNA 1ZKGA 1VQ5I 1TNTA 3G71I 1W7PD 1TWHJ 4CCNA 5IYCJ 3WTVC 3C18A 2LVSA 4RMNA 3BG9A 2KZVA 1IV8A 2ISYA 3SJMA 2EA4A 4P5OA 3IH4A 4CCKA 2IS2A 1MW7A 2MW8A 4A69C 1WJAA 2DOFA 2P7VB 3K9TA 2ZFWA 4M71A 2W7NA 2H09A 4XORA 5FKMA 2E7WA 5A2QK 4M74A 3QP6A 4BL0B 4FHTA 3SQNA 3F8MA 5LHIA 2M4KA 4RAFA 2TCTA 2X48A 5CKTA 3BR1A 3BG6A 1XD7A 4GGGA 3GZ6A 1BI1A 2H8WA 4LLNA 1QHHD 1RPWA 2D1HA 4G9YA 1OYYA 4TV7A 4E7KA 4GFBA 2IA0A 3BCBA 1U9NA 4XLNF 2ZMEA 1KYWA 4E7HA 2KISA 2DA4A 4FQGA 4HA8A 4KMUX 4PJNA 5FKOA 4B44A 4FTHA 5D4SA 4UUVA 1D0XA 2FF4A 5FROA 4KNYA 1JJ6C 2ZO4A 1YO5C 1ETOA 2JUCA 1SFUA 3WE3A 1T39A 1F5TA 1ZR2A 3KEYA 1QQIA 2XSJC 3OYEA 1KU7A 1JKPC 1JTXA 4IRGA 3C1DA 1D5VA 2H94A 2ZNZA 4NBQA 3DCFA 1JUPA 3I4NJ 1MBKA 2V26A 1MBJA 5IP6A 2FJ1A 4N4NB 4E70A 4P1WA 4J00A 1ZRCA 2EQRA 1O7FA 4CGZA 2A3SA 1FP2A 3EPZA 1BN5A 2XB0X 3LSTA 2BY0A 1QZEA 3HGYA 3A0BC 6PAXA 1OKRA 3S3MA 2VPLA 4C9YA 1VQKI 1JHFA 2KDOA 4I6ZA 3HRSA 2YU3A 2ECCA 3M8FA 1IAWA 4OIOF 3IRQA 5BS6A 4E7ZA 2ELJA 2MLGA 3CTAA 3PQKA 1N25A 1WJEA 4NQWB 3LL7A 1LVKA 1GLNA 1OYIA 1FBUA 2CRGA 1HDDC 4IVNA 3QP5A 1E17A 2BOLA 4BKXA 3GTQJ 2M7BA 3H5AA 3MWMA 4XICA 1EH8A 4EV0A 4MIMA 1RC9A 2OPTA 2QSHX 1ETQA 1HOMA 5JLWA 2QWWA 2DCEA 3IWZA 3NRVA 2ETHA 3HRUA 1FIPA 3MD2A 1U8BA 5E8IA 1SAXA 4A3MJ 3AL0B 1R9TJ 4KN7X 1YIJI 2VC1A 1R5GA 2R7DA 2Y31A 1T6SA 4BBSJ 1SD6A 2HPIA 4KT5C 1R00A 3GW2A 2NRAC 2BYVE 2R7QA 4Y3OA 3Q5FA 2DPDA 2X6XA 1G2HA 5GADJ 2D45A 2MH9A 5TISC 4J19A 4YRVA 4XONA 3OR1C 1HSTA 3ZRGA 1O4XA 2M3AA 3S1MJ 2JZYA 5LRRA 2BHZA 2LY2A 5FO5A 2R7SA 3PQJA 2VBZA 4AVPA 4XM3A 2XVCA 4M3BA 2WC2A 1TL8A 1E2XA 4J01A 3BT9A 2MABA 1A6QA 1A6IA 3K2ZA 3JRBA 2OD5A 1S7OA 2VLAA 4HF1A 4AWXB 1QU3A 2K9MA 1TP4A 2QENA 1K6OA 4PK4A 1ERDA 4ZDOA 3CCQI 2XF7A 1ZYRF 2KL4A 3RKYA 5D6FA 2CSOA 1FOWA 2EIMH 3ABTA 4NB5A 1JT6A 1UCRA 1YRNA 4G8XA 3HTUA 2K7LA 3VYSB 2DOEA 2JSPA 3H5RA 3OL3A 1WJCA 3SYTA 4CA0A 2MH2A 2DXIA 2OQGA 3SHFA 3I56I 4F92B 1W5TA 4BE1A 4NNJA 1HA8A 3AG3H 3OYMA 3RSNA 2EFQA 1UHWA 3J7YJ 2L7FP 4I98B 3L2QA 2EBIA 1VQNI 3KP4A 2ZXHA 2P8TA 1USTA 3E5XA 4G6TB 1HCRA 1MMDA 1I27A 4C30A 3CC2I 4OAZA 2DA3A 4FASD 4HSRA 4M9XA 3I55I 4DZJA 4AIHA 2DMUA 2Q8KA 4AC0A 4G7ZF 2QLZA 3AG1H 3DWLE 2XHKA 3LQRA 4U0YA 2NVTJ 3OS1A 2JN6A 2NAZA 4QPOA 4BYYA 2XPUA 3C3WA 3DXJF 3S1QJ 3LSKA 2GXAA 1X2NA 3IH2A 1WSUA 3PNTA 5FLXK 4BQNA 2L9SA 5DCFA 3K69A 2W82A 4OINF 4WXHA 4CUGA 2OUMA 2Q1ZB 3GZNB 2HQNA 1QVTA 3LMMA 4N4OB 2IS6A 3T5XA 4FE7A 1HW2A 1LUJB 1X4OA 3LA7A 4R8HA 2JRMA 2WAQA 1X1AA 2R93J 3S14J 2ZB9A 1SMYF 1FIAA 2XIGA 3TL4X 4XN3A 3QPLA 2ZJRF 1LEBA 5CQEA 4RB0A 1HKSA 3I53A 3M3YJ 2DTZA 2EV6A 4HDVA 1UHMA 1RKTA 5K5QA 1WFXA 3O6BB 4Q4ZF 2GLOA 1XTAA 2HDCA 1MMAA 2UV1A 3LAJA 1ZGJA 1YLFA 4HV5A 2EFPA 1W5SA 3OWTA 3H35A 4IKFA 1MDMA 5LGUA 1IN8A 1XMXA 4EM1A 4ZDPA 3DU5A 1W0UA 5EEHA 3P7NA 2DMPA 1ETWA 3ZN0A 3ZMDA 1U9OA 1YI2I 5BPIA 1IUYA 3U1DA 1XDSA 4O6JA 1K83J 4L5EA 5J47A 2HVSA 1Z3YA 5EEAA 1TC3C 3FXLA 4AUXA 1IDZA 2KT0A 1FX7A 4DQ2A 3H1CA 4IHTA 1ZAOA 2L4MA 4XLFA 3VFZA 1R5HA 3KZZA 4I0AA 4NC6A 4D1QA 2DQLA 2IPQX 4ABZA 3LFKA 2F2EA 2R5ZA 3H92A 4P55A 4LLLA 3CMYA 1MNMC 4PJMA 1LFPA 1MD0A 1P7IA 2JMWA 1K79A 5DDGA 2VL8A 2M8GX 1K6YA 2JA7J 2LMDA 2Y0SN 3HYIA 2QF7A 3KYDB 4CZZA 3V7RA 1FZPB 1QA6A 1J2XA 5F0CA 2EZIA 2KLOA 1H0MA 2BY3A 4DW6A 2Y0SA 5AIPA 2FA5A 3RPUD 1I5ZA 2LRDA 2WWYA 4JOMA 5BMZA 3GEZA 3G1OA 1P4AA 1AU7A 3CMMA 3K4MA 4XBFA 1VQ9I 2KKOA 3LA3A 3WTTC 4S04A 4M9ZA 1UELB 3NWSA 2L01A 3HG9A 4XNFA 3GFJA 3ZQQA 1GXQA 1WI3A 3MKWB 2WV0A 4FT8A 4M73A 1YE9A 1ZHFA 3C7JA 2O61A 3ELKA 4EGZA 3BR6A 4CSWA 3KLNA 3DBHB 3ASOH 1XSVA 2G0EA 3CCJI 5J3LA 1HF0A 3BPXA 5IYBJ 1P2FA 4A3KJ 4Y13A 3S3OA 5GAEJ 2VXZA 4LJZF 1LDJA 1J7KA 2X6OA 3DPTA 2IGOA 2M7AA 5HLTA 4KDPA 3IC7A 3L7WA 5HOOA 1LB2A 1OCZH 4A3CJ 1PP7U 1HW5A 4ZZDA 1B72A 4G94A 3E1SA 3FBIB 4MFEA 4AIJA 1D8KA 1YFHA 1PUFB 2L4AA 2L7ZA 2XAFA 2VBWA 4L0YB 1WJ5A 2IA2A 3WTWC 2WB1A 3HC7A 4CCJA 1ZGAA 4ENJA 4OIRF 5D8LB 2K9LA 4XRMA 2V6CA 4RB3C 1K78A 2W4SA 3KETA 2HKXA 4ZYGA 3W2WA 4G7OF 2P5VA 1N75A 5F1RA 3WE2A 1VQOI 1FNNA 1V4RA 1T0FC 1IN5A 3S15J 3K70D 4ZYDA 2L9VA 5JR3A 1DDNA 1TW3A 1R4MB 1FSHA 3AG2H 3IP4B 3BG5A 4D9JA 4LG0B 1L0OC 2NOGA 5K5OA 3K0LA 3L9FA 4CYCB 4HQMA 4D5FA 3HRMA 4XOPA 1K61A 4ZJZA 3EYYA 2HQ5A 2NVQJ 2LR8A 3B02A 5FLMJ 4PCQA 1HDPA 1I3QJ 3WGIA 1V3FA 2DA2A 3I54A 1YJ9I 2CWEA 1QPMA 1Y0NA 1VFCA 3VB2A 2K4BA 2XB5A 3BP8A 3FXRA 1VTNC 5DS9A 2ZXJA 4EVIA 5LRSA 5K1YA 4UB8C 3QWLA 4Q47A 5EJCA 3DPUA 1FTTA 1Z1DA 1UFMA 1LDKB 2B7EA 2DDBA 3S17J 2A69F 5B5EC 3CCUI 1TBXA 1S9HA 2MBFA 2RV8A 4AD9A 2M30A 2V9PA 5H20A 1MBFA 4BGDA 3BR5A 5B1AH 3OYLA 1E0EA 3E6DA 3CJNA 2RGVA 1HBXG 1EKEA 3C2GA 4BXXJ 2EK5A 3CJQB 2D1VA 4GXOA 2NVYJ 5E1ZB 5E3LA 3DKWA 2ISZA 4EEFG 2CQQA 4IQJA 4YIRX 5C3EJ 4C3IJ 3KZYA 1IZ1A 1TW2A 1E3OC 1MSEC 1U3EM 2R7XA 3GFLA 4UUSB 2EH3A 2VJJA 2VQCA 3Q9SA 1H8AC 1FOYA 4MQ9F 4EMSA 2VODA 1APLC 2E2IJ 1IW7F 4A6DA 1YX3A 4U7DA 5E1XA 4CXFA 4NUBA 1XSXA 3QU3A 3REOA 3ERED 3I58A 3ISPA 4UVAA 2PI0A 1YQAA 1VQ4I 1XGOA 1MMSA 1QO0D 4A0XA 3LSMA 5IT9K 5F08A 1UJ8A 2R3SA 1UB9A 5DD4A 1F1ZA 1S29A 2OCEA 5KK1A 3HKZA 2UXXA 4B43A 5JFRA 2OBPA 3HOSA 1TWFJ 3W6JB 4WK8F 3M8EA 4X1EA 5CLSA 2L2OA 3FK6A 3GTMJ 2IW5A 3S2DJ 3L2UA 3FISA 4IL6C 1GVJA 2WA0A 4V2GA 3K2AA 3HXLA 4A0YA 5FJ8J 2HQRA 1XGSA 2GAUA 1J5YA 1EF4A 2ZBKA 1RUOA 1SANA 2ESHA 2OZ6A 1TNSA 2GWRA 1NG7A 3TP0A 3LSPA 1OQYA 2MD5A 3JCUC 3JRHA 3JTHA 2F48A 4BUPA 3M1CA 4BQOA 4XLPF 2PFBA 5M5YJ 1YYVA 1MJ9A 1S5LC 2FU4A 3A01B 1DU0A 5HNFA 4IF4A 3MZ8A 4F3QA 3R0JA 3HJEA 2BVLA 1U5TA 4IXAA 5E3MA 4DNCA 5J8FA 5HODA 3I4MJ 2I8DA 3F8CA 4I76A 2YX4A 5J6XA 2LTPA 4UUTA 3FBNB 3FXUA 2HYJA 2CGPA 1FYKA 1XCBA 1MBEA 3DFGA 3PSIA 1WPKA 3J81Z 3RPUA 5DD8A 3JRCA 3WHBA 1CF7B 2TRTA 4X0GA 3NAUA 3HOYJ 2V1NA 2DW4A 2VASA 2PG4A 4IRIA 1Z21A 3KP3A 1MMNA 3MMYB 1MNEA 5DV5A 1R1VA 2VQGA 4M3DA 3H9QA 4LG3A 5IY5H 5IOYA 3JW4A 2L54A 2M0MA 1BBYA 1D1AA 1LVAA 4QWQA 5JHFA 4IZZA 4HRIA 1M1EB 5TGTA 3OS2A 3ABMH 2BXZA 4M6YA 4KMFA 4ETSA 2JA6J 2WV1A 2W00A 5EG0A 1REPC 1TLHB 3VYUB 3F8NA 3WG9A 1IV6A 3EETA 3GTJJ 5GAHJ 3F8BA 1ULYA 3CUQB 3FKIJ 3E5UA 2DA1A 4RGUA 4WXDA 3OYCA 5GAGJ 1WGXA 2JVGA 2HNHA 1X3WB 1XX5A 1I1GA 1X3UA 3CCYA 3GO5A 2FRHA 1MIJA 1AWCA 5D5UB 1FC3A 3HSFA 2O5RA 2Y75A 3FX3A 4HOBA 2MLKA 4PFPA 1IGNA 2VI6A 2K85A 3OSGA 2KPMA 1SFKA 5M5XJ 3GCMA 2MYSA 2DT5A 1ZG1A 2NS7A 5IOZA 5EYRA 2PN6A 5HLHA 2JT1A 2DN0A 3Q0VA 3JSPA 2BY1A 2CW8A 5BPDA 1T38A 4M9SA 1DP7P 2QBYA 5FD5A 1FP1D 4RA2A 3M4OJ 4XOTA 3BCAA 2XF6A 3CZ6A 2P5KA 3SZGA 3J7ZI 2ZMEB 1V54H 5HVQC 3K1MA 4L5JA 1FEXA 2WY7Q 3CLOA 2LKSA 1HC8A 5FKKA 4RGXA 2V7FA 5DTDA 5CVRA 4JBAA 4W97A 3TOBA 1QZYA 1VQ7I 1IRFA 3GFIA 4I7HA 4IX7A 2E1MC 3X2QH 4ITVA 1Z9CA 2VN2A 2JK3A 3H3UA 2X1DA 3HTSB 2G9WA 3GX4X 4C3JJ 2LD5A 1LKXA 2V6EA 3DLAA 3HOTA 2JPCA 4UB6C 2X4HA 3U21A 3C2BA 3QPTA 2KIFA 3NARA 3HBLA 1SFEA 1QPIA 5KAFC 2BY2A 4OIQF 1B1BA 3TO7A 2R7FA 1VQLI 2MFZA 3F3XA 1MBHA 2XAQA 4PJ0C 2DMQA 3QYEA 4LIVA 2COMA 2XUBA 1P9QC 4HPQA 1VQMI 2MC4A 1BW6A 4HAMA 3GUDA 5M3MJ 4PZJA 5L3BA 3R60A 3GLXA 3HPGA 5CJ9A 1XN7A 2M2EA 2CG4A 3CMEI 4KIFA 4MEYF 1SEUA 1XSDA 2EB7A 2E36A 5H6RA 2HWVA 4EATA 1A5JA 2ZJ2A 3OS0A 4YG2F 4HF0A 3JRAA 1KQ9A 2W57A 1PYVA 3QYFA 3B6AA 5L3DA 4F91B 1U78A 3PM1A 4RLQA 3ZGKA 4F55A 2W85A 2M9HA 4GRIA 3ML6A 3F22A 4N9IA 4NHJA 3OL4A 2EV0A 1TQMA 2OAZA 1GV2A 4RLFA 2VBYA 3SFZA 2FNPA 4S0HB 3GMEA 2LY1A 1Z67A 1VQ8I 3D5SC 2DFEA 2X6WA 2BZTA 3RKXA 1G59A 3S16J 3I71A 2J5PA 4MGRA 1GV5A 4LMYA 4ENNA 1JHHA 2F5EA 4RGRA 4M3EA 4LB5A 1B59A 3FMQA 4XIDA 3CESA 3ZPLA 5EF6A 2CV1A 1VQPI 1BIAA 2P6SA 2L5QA 2VOOA 5M3FJ 3O2PE 5HDNA 5DUIA 3GBGA 1O3QA 3SDGA 2LH9A 3BPVA 2IGMA 5H6QA 4ZTFA 5B3SH 3OYGA 1T2KA 2FXAA 2DA6A 3BROA 5GPAA 3BOQA 2W24A 1YRNB 1ODDA 4IOAF 1LDDA 3MKYB 4HDUA 3ERMA 1Y6IA 1SD5A 2L3DA 3S8PA 5TRDA 1RI7A 3FXQA 3MEXA 1UAAA 2M34A 3RDIA 5M5WJ 2ZXWH 3RYPA 2NVXJ 4HV6A 3HOZJ 3FWEA 3CCLI 3T8RA 5C44J 2Y69H 1IRGA 5HLGA 2CQNA 1YHQI 2F5VA 4HNTA 3V7CA 1EH6A 4IPAA 3CO6C 1R1UA 1GXPA 2IEKA 1KU2A 3GFMA 5IP7J 3J81K 1Z0XA 4IRHA 2LC2A 4XLHA 4ZYHA 1BJAA 1PP8F 3GTOJ 3T0YA 1FYLA 4HBLA 3DF8A 3I5UA 4F93B 2MA3A 3G3ZA 1FOXA 2EZKA 2JWTA 5ICFA 1MKMA 2ELKA 5TJJA 3MKZA 1D1CA 3WGGA 1NK2P 3W6VA 2LBFA 2NNNA 3VSKA 2QGUA 4XN0A 3CCSI 2R7WA 3R0AA 3SZTA 4BQAA 3DV8A 4C3HJ 2FOWA 5IPAA 3R6SA 4HNUA 4UHTA 3FZVA 2DQRA 5JLXA 3LNQA 2LY9A 5FFZA 4LB6B 2XF5A 5J1YA 1XPXA 3VPRA 4AVZA 3ZQCA 3RZDJ 3OIOA 2DLLA 4YFKF 3KZIC 1I50J 5B1BH 3ECOA 1LNWA 3A4CA 1G3TA 2OCCH 1FMVA 4Y33A 5K7ZA 4EJWA 1GT0C 3CQZJ 4MTEA 1T08B 3M8JA 4DBQA 2EA2A 4ZYAA 5IYDJ 1YJNI 3ZQGA 2LF7A 3ZQFA 2R7UA 4B3XA 3ZQLA 1TT5B 5FRMA 1ETYA 3OYNA 2WAQN 1FSEA 4BE0A 4ZC3A 5FKLA 3S2HJ 4ENKA 1B6AA 5CYVA 4QPQA 4OIPF 3FXMA 1NHAA 3ABUA 3OYIA 1MDMB 3IWFA 1IUFA 1W7PA 2L0KA 5ILUA 4XQFA 3HM5A 1XB4A 2O8XA 3M9AA 4BJTA 4BQQA 1AHDP 1JGSA 2TDXA 2V1XA 2KRHA 4M72A 3BJ6A 4I02A 3UKGA 2DU9A 2CYYA 5F0FA 3CF2A 2JQ7A 5D5VB 2JVHA 1FPQA 1TWCJ 3F23A 2BE5F 3BJOA 4D5CA 4E6KG 1Z77A 2IXSA 3SEZA 3VYTB 2JA2A 3T1BA 3HSRA 2ID3A 4FX4A 2HEOA 1A04A 4YFXF 3Q3SA 5L3EA 2K3PA 2QQAA 1ZRFA 4ESFA 3TMOA 1GVDA 4HYEA 4U88A 4UVBA 4C2UA 3E97A 2M0CA 5LBQA 3L00A 3ZMUA 1IG7A 5LFAA 2OJED 2KRFA 3P9IA 2CUFA 3W2VA 1O3TA 4IQ4A 4Z2YA 2RKHA 4XKBA 2HFHA 4BEHA 2XAHA 1OYWA 2UXNA 2BBYA 5KNLA 1ZQ3P 2E71A 2L7MP 3OOUA 2L9RA 1Q1HA 4ZH4F 1BR4A 4OMYA 3TO6A 4U87A 4RBOA 3DBRB 2FSWA 5L3CA 2ZSIB 2HOTA 3HGGA 3HZJA 1YS7A 2DTRA 2BVMA 2LG4A 3M7GA 1BA5A 1R5ID 4OAYA 4PSXA 3H36A 2R0QC 2G7HA 4GDFA 2IT0A 2XDVA 4GYGA 4RDUA 4LLGF 4BH9A 1X19A 4HG2A 3OY9A 3FKJA 3JR9A 2QKLB 1J09A 5KAIC 1VNDA 2JTVA 3H3ZA 1ZARA 3FHZA 1LFUP 4ESBA 2F5DA 2IP2A 1UG2A 2VOPA 4LK1F 2ELHA 3OYBA 2DYSH 2KP6A 3P9CA 2JA5J 2VXDA 3ZOBA 1V5FA 2HXOA 2K02A 2N8GA 1ZN2A 2XRNA 3G6EI 2CU7A 4CCMA 5H2FC 1B72B 2ECBA 3EUKL 2Z9OA 3S1RJ 4XSXF 3UR3C 5FB2A 2CUJA 2G7UA 3S3NA 3BQZA 3V42A 2ICWG 1F36A 3RZOJ 4HF2A 5K5RA 2AXTC 2O8KA 3JAMZ 1NH3A 2CW0F 1WI9A 1ZH5A 1AA7A 1ZG3A 3K4CA 1VF9A 2FX0A 1OCCH 3SDBA 1Y8QB 4RAYA 1RRJA 3JSOA 1YW9A 1FBSA 1O7LA 2P7CB 2K3FA 4HLXA 4HSTA 5GP9A 1K78B 3ONQA 5E17F 3T8TA 3GTLJ 1PUEE 2XAUA 1WZ2A 3HUGA 1USSA 5AONA 1DUXC 1P4WA 2HOSA 2K86A 2WB1N 1D3YA 3I64A 3RKQA 1GDTA 4JP0A 1FBQA 2Y9ZA 3WU1B 1FMWA 2BGCA 2Z2SB 1EJ9A 1SFXA 2STWA 2DODA 2HYGD 2A07F 4A3LJ 3ZMTA 4IHVA 2CJJA 2VE9A 2L02A 3QOEA 3RKWA 1R1TA 3B73A 1JJ8C 3E3VA 2YR2A 1OLTA 3DTEA 1TWGJ 5HNHA 3MAJA 3HOUJ 2FBKA 2HDDA 2JPBA 1I1SA 1BOAA 3Q0UA 3Q9VA 5ED4A 4BNCA 1H9GA 2QSFX 2CUZA 2OF7A 4BDYA 3TKYA 4CYDA 2LYCA 2DT6A 4RS8A 2HPMA 3DTKA 3A0HC 4HX4A 4RM2A 1IC8A 2HTSA 2MG4A 2ZC2A 4IHSA 2ZSHB 4UY8I 1DPRA 2VT2A 2FMYA 2NS0A 3DEEA 4G6QA 2KIMA 4FE4A 1HKQA 4RAZA 2XGDA 4JX4A 2IVMA 2XAJA 2LF8A 5D5WB 1U0JA 2AQEA 2E1NA 3A1YA 2GOMA 4DZPA 5DM7F 3OIQA 2LDUA 1TZLA 3FIWA 4II2A 4JQFA 1P6RA 2FBHA 2H6BA 2VC0A 2RNJA 2XKPA 3OYKA 3DU6A 3OYHA 3PFIA 1O3SA 2DT7B 1S6LA 2PMUA 1XDUA 5ICGA 1Y39A 1XC5A 2K9SA 3WU2C 3OYAA 2HTJA 1TTYA 3AFHA 3BLYA 3W6KB 3I9V2 3GTPJ 1R58A 4HEA2 1YW8A 2FMLA 2HXIA 2AXLA 5J1RA 5E8GA 3F9KA 4NC7A 2QQ8A 3BTCA 4WCGA 1POGA 2VQHA 3O8GA 3JRFA 3HDDA 2VB6A 2H1KA 1WRJA 3E6MA 4CHUA 2XRLA 5C4JJ 1KU3A 2VUMJ 3VYRB 4PJLA 2PLYA 3KPHA 1PDNC 3HOWJ 4F7ZA 3NQOA 4OOIA 2HZDA 4XRFA 3TW7A 2M87A 1JXSA 4JYKA 1P4XA 2MC3A 2HDWA 2VKVA 5J8CA 3ESWB 1YX5A 2VE8A 3CCVI 4PGHA 4EGYA 1C0WA 1LE8B 2B9SA 4FCYA 1MSFC 3UNGC 1W0TA 3I59A 3VODA 3FHNA 4E7JA 2FE3A 1U5TC 4IHXA 2R7OA 1Y1WJ 2IS1A 4IHYA 2PJRB 3DEWA 5J40A 3V4GA 1FOKA 4A3DJ 2X6YA 1QZZA 4FETA 5LHHA 4A3GJ 5ILVA 4I01A 2HGCA 2Q2EA 1NTCA 2ZCWA 4XL9A 3AG4H 3HKZN 1Z6TA 1BC7C 3OR2C 2WBMA 3TO9A 2F4MB 2X9DA 4HX7A 4AU7A 1R49A 3CCRI 4XKWA 4BAYA 4CICA 1LQ1A 1WHUA 2XGEA 3L1PA 3K4KA 1SVLA 1Z7UA 2RDPA 4E7IA 2DA5A 2V1DA 2X0LA 2F4OB 4L9VA 3KFWX 3G2BA 1KQ8A 2B63J 2IRFG 3ZN1A 4N9HA 4A12A 4B48A 4OWRB 4XMYA 1UHSA 1B8IA 2Z5UA 3QQAA 4BS9A 2WTEA 2F4IA 5FD6A 5EGOA 2BHYA 3ABKH 5E20A 2HZTA 1KQ0A 2OC6A 2QQBA 2A6HF 3MZYA 5HDGA 1HSJA 4HLYA 2DDAA 2EIKH 2VONA 2Z16A 3KE2A 4GO1A 2EILH 1EV7A 3L2RA 1BC8C 2GBYA 3BC8A 2WAFA 3HOXJ 3LSRA 3I4PA 3RQIA 4EJVA 5IP9J 2EINH 4XR6A 1DQUA 4GYIA 2CS3A 1RESA 4A5NA 5EZGA 5KHDA 3LQQA 3RQ4A 1Y0UA 1AKHA 2OQRA 1ZGWA 1RIOH 3BDDA 1YS6A 4HW0A 4BHBA 4R79A 2BW3A 3BG7A 3LSHA 4HX8A 4AIDA 2O3FA 5EG0B 4LITA 4DJAA 3TDUC 4XLAA 1D8JA 2XSDC 4G6DA 3IKTA 1G3WA 1SC7A 5D8KB 3GVAA 5E79C 1A35A 1KU9A 2PQ8A 4YIIA 4II3A 3CCEI 4ZTJA 5ERIA 2WADA 2OV7A 3K70C 3GWZA 1ITYA 1ZK8A 2X1CA 1T33A 3G4SI 3EYIA 4A0ZA 4B47A 3JAMK 2HU9A 3FXOA 4MTDA 4E7LA 4BDZA 1XCVA 3R61A 3BJAA 3ROUA 1CGPA 1IN4A 2HOAA 2CQXA 3EQLF 3IAS2 4O3MA 3K10A 2KDZA 4M3GA 5FKNA 2LK2A 3GTKJ 3IKVA 3ZQHA 1SD7A 2VIXA 2UZKA 2F5CA 5DCMA 2VJ5A 1RR8C 3HHHA 2PMHA 3RCOA 4KIGA 5ILSA 2QBYB 2KRCA 1CF7A 3N05A 1I6XA 2HR3A 5LLQA 1D0ZA 2DI3A 4S05A 4MQVA 3TQNA 1V5EA 3K4JA 4EM2A 4DYRA 3HL2A 3FMRA 2FOKA 4AYBA 2Y30A 2R5YA 1YTYA 2P81A 4Y7NJ 3PO3J 3K4LA 2X1EA 2CMPA 4L5IA 1IF1A 1IN6A 2GXGA 3GXOA 2E34A 1S7AA 5CVVA 3IAM2 3U9GA 1OISA 3H9GA 3ZQIA 2NS8A 3L2VA 4Y17A 2ESNA 3RI4A 2RREA 1OCPA 5E18F 2V4JC 4A93J 5EZHA 3F6VA 3HEFA 1MNDA 1UZCA 1G3YA 1Z7LA 3D5RC 2FEZA 5BOXA 4O5VA 1R6RA 2VKHA 4I0BA 1JGGA 2QUFA 3K4BA 2M1BA 3L2CA 2EZLA 1BR2A 2K9QA 3PIOF 2KIQA 4XSZF 3FXKA 1JT0A 2XV4S 4NDLA 5EDNA 1S3JA 2E35A 3DEUA 3KIOA 4KT6A 1K4SA 2XGCA 3W3CA 2AS5F 4Y15A 1DPUA 3CP2A 3WG7H 4H0EA 1I39A 3I0TA 1Z05A 2ME6A 1OR7C 1AOYA 1STZA 4P96A 3KCCA 1Y8RB 2DAOA 4B09A 5LGTA 4RB2C 4A3IJ 4L0ZB 2ZNYA 3H9JA 3K1PA 1J75A 1MBGA 4JK1X 3N97A 1T56A 4BBRJ 3MQ0A 2A61A 2CV0A 2E1MB 2DBBA 2ZKZA 4U0VA 2H6CA 3CC4I 2R7VA 3E6CC 1H88C 1UMQA 2JUGA 4ZDLA 1W36D 3CCMI 3K7AJ 2MSYA 3OYDA 2E7XA 3BQYA 3OYFA 1QNTA 1SVOA 3PL8A 1KONA 2LKXA 3AL0C 1MGTA 1MZBA 2M45A 1BI0A 3RYRA 3BG3A 2EV5A 1MJBA 4LK0F 2YX7A 4PSWA 1ZELA 4JX5A 4G7HF 1ZTRA 1WQ2A 1R22A 3PNYA 1TQIA 5LD2C 5DYMA 3F72A 3H0GJ 4CO8A 1BOBA 3VOEA 3QRFF 2CV2A 2IBDA 1OR7A 4YIFA 2EWNA 2ZJPF 2R92J 3MZHA 3FM5A 2X51A 2K27A 2FQ3A 1YG2A 3QYBA 3P9KA 2VJIA 2ACJA 3IRRA 3JRIA 4RAGA 1FTZA 3KP7A 2E60A 3ZCOA 2K40A 1IXCA 2O03A 2YPRA 4A3FJ 2KMUA 3LA2A 1SD4A 4NQWA 3LWFA 2W48A 2DYRH 3BZ6A 5LEKA 1HXDA 4I09A 3IV5A 4BY7J 3VSLA 1SAUA 3HPHA 4BHCA 3AKZA 4M3FA 4I99C 4D7NA 2FNAA 2LLKA 3PSFA 2JRTA 2VKDA 5FGMA 5HLIA 1BL0A 4EM0B 4U7BA 2LBFB 2M5WA 3E6BA 4Y52J 4IO9F 5DEQA 1ETVA 2GQQA 3OMYA 3J80Z 3G1LA 3SFIA 4QIWN 4KIBA 2DOAA 2W1OA 2PJPA 3BR2A 2A5YB 4C2TA 4LOCA 5C4XJ 3D1NI 1WCMJ 2JSCA 3VEPA 2CH0A 2Z3YA 4MFDA 4CZCA 4G12A 1X2MA 5D5XB 1MJAA 3HB9A 1WJBA 3TP3A 2RN7A 2X85A 1U2WA 1YOVB 1A36A 1WH7A 2DPUA 2YSRA 3H3VK 2QCOA 1IXSB 2EFNA 2FD5A 2XAGA 1ENHA 4HQEA 1KGSA 3D0SA 5J4YA 1T8IA 1X1CA 1TWAJ 3WODF 4ANJA 2CUEA 3PJRA 1CQTA 5AIQA 3I3LA 3QPHA 5F1JA 2P0WA 3VDXA 5JVGF 3WTUC 3RPQA 1FJLA 2O6GE 1RUNA 3G1MA 2NOJB 3S1NJ 3ZXSA 2QSGX 2E2HJ 2DFFA 3MKLA 1W7PB 4CCOA 2EJRA 2I5UA 4E4HA 2RC4A 1RR7A 3SEQA 1BM9A 2XPVA 5K7HA 1S8NA 2EFOA 3E0JB 1R23A 3LOCA 4Y4RA 3GZ5A 3V8KA 1X4PA 5D6EA 3PUFA 1B9NA 3CUOA 3WU0A 2DK8A 4QTRA 1BI3A 1RKWA 1O57A 1SMTA 1IDYA 2LKPA 1QHGA 3SXYA 3F8FA 4A6EA 4UNOA 4AM3A 2DO7A 3KYCB 1T95A 3K1NA 3QU6A 5HS8A 2F5FA 4QSHA 4MNUA 3CO7C 2K5CA 1V5GA 2COBA 1Y1VJ 4OU0A 5DUKA 3ZMVA 2E5ZA 2HS5A 3RTRA 2GOXB 2CFXA 4F52A 4ON0A 3JREA 3ZMZA 4KFCA 3J7AY 3FM3A 2Y0MA 4BJ5C 3BR0A 3M07A 4A3BJ 4JX6A 3K6GA 3GF2A 3MN2A 3LSIA 1W36C 1JUSA 4BEHB 4DBRA 1OCTC 2FQ4A 4EJOA 1HKTA 1IN7A 2A68F 1E3PA 4L18B 4UVCA 2VPRA 3IUOA 2IA1A 2R5ZB 4L9TA 1TQPA 3MFKA 1IXRC 4N0BA 4D0PA 3CDIA 1N78A 2R7TA 2HI3A 1GHCA 2HKOA 2KQRA 2L7KA 1BJZA 2CFOA 1IO2A 3WTZA 1WVRA 2CW7A 2XC7A 2GM4A 1VZ0A 3DTIA 3EDPA 4K2EA 4V2FA 4KICA 2OU2A 5LEJA 4EJTA 4C2MJ 2OZUA 5L3GA 3U1KA 1BR1A 2RQPA 5FLVA 1G6NA 4DIQA 2STTA 3FK7A 1MH4A 2XPWA 3QAHA 4B8XA 2P4WA 3NWTA 2QVOA 1ZREA 4WF2A 3B6CA 4ZZLA 2LSOA 5CQGA 5CVUA 2EIJH 1BI2A 2HQAA 4Q48A 3E5QA 2ZFUA 1R71A 2D5VA 2V9VA 2Y2ZA 5ICCA 1FLIA 2VBXA 2E2JJ 1LFBA 4D7MA 3DKXA 2MD0A 2CO5A 5HS9A 3A03A 5FFXA 1B4AA 4HNVA 4A5MA 4MLOA 3SZPA 3H5NA 3RIRA 3D5LA 2BV6A 5E1WA 2GIVA 4PDKA 3HUGB 2Z99A 5CPRB 1DP3A 3ECHA 1D0YA 3G73A 3KX2A 4UV9A 2KJBA 1RZ4A 4GCVA 3CJRB 3H0DA 2KJCA 2HVRA 3OYJA 4X6AJ 4EJUA 4H4KC 2PBIA 2BXYA 2E1OA 2I10A 2ME0A 5D4RA 1WH5A 4ASNA 1N77A 1XS9A 3CP8A 2J5OA 3Q0WA 1YITI 1WKMA 2O0YA 1JE8A 3TEDA 3CLQA 5DM6F 3KP6A 1FY7A 4OMZA 3F0CA 5IT3A 1FT9A 1S72I 3PO2J 1ETXA 4FISA 1WJFA 2K9NA 1UG0A 4U0WA 1E3HA 2GIZA 5LGNA 3CMAI 3BY6A 5F04A 2DJNA 4L9NA 4YFNF 2DA7A 2NNYA 1EH7A 4BY1J 4CDGA 1LEAA 3AAFA 4A3JJ 3A2KA 2IGKA 1KYZA 4XRSA 5LHGA 5KVRA 5IT9Z 5GTHC 2A5WA 4RM3A 4EQQA 1NK3P 2EFWA 2OTLI 3FMSA 2ZJQF 3IHUA 1OFCX 4BHPA 3J7AO 4AIKA 3LFUA 3BZKA 2LREA 2DJIA 2ID6A 4KITB 1IRZA 3IH3A 2DFIA 2XASA 1F43A 1ONVA 3O3KA 2PX9A 4DOZA 1I3AA 1WJDA 3J80K 1OCRH 2W25A 4XLEA 4XK4A 1W1WE 1XG1A 4LD5A 3HRTA 3EUAA 5L3FA 2A05A 3ASNH 4A3EJ 4M6VA 1JKOC 5GPCA 2H1LA 1A31A 1X1DA 4RGSA 5E3OA 3CDLA 4E7SA 1H89C 3BZCA 1PUFA 4I2OA 3OSFA 2YU9J 3LAPA 3KEQA 4IEJA 2KHMA 1KA8A 3W2AA 2LFBA 3EUHC 4FX0A 4ENMA 1IJWC 5HS7A 3ZQ7A 4YELA 2RVCA 2YUSA 2Z1DA 1OCOH 2QA4I 1HW1A 2VQLA 3KYLA 5A2QZ 5GTIC 1P7JA 1DGWY 2IAIA 2P6TA 3S93A 2IGNA 3K4NA 3M1EA 2EPFA 3FXJA 4W1UA 3DPLC 1D1BA 2NVUB 1JKQC 2H8RA 2QEXI 2B0LA 1JI8A 2P5LC 4P9FA 2QQ9A 3V8LA 2NXNB 4LFUA 1HQCA 4KISA 1K7AA 3CJTB 4WWCA 2DMTA 1RNLA 2W84A 2LP0A 3RJPA 3V8JA 3KLOA 2Z33A 4WXCA 3I59B 1G4DA 1G3SA 4BXUA 4HZFA 2Y48A 2IS4A 3JTGA 1ORKA 2MGQA 1R7JA 4XRSG 4DYQA 2C6YA 1XGMA 4LG0A 3TDZC 4Q5SF 4Z6YA 3LSGA 3GYHX 3DLLF 4CYCA 3DP7A 3BTLA 3CF5F 4KN4X 2Q2EB 5ICEA 5F6FA 4KYWA 2HYFA 1ZR4A 2E1CA 1BW5A 1S7EA 1YIOA 2ZXIA 2FUG2 1DGRM 3OOPA 1J9IA 1X3ZB 2KIUA 1R4NB 3TW6A 3GTGJ 3JRGA 3VWBA 4P9UA 3BTIA 1G8XA 3S32A 1W4MA 3DKYA 3KEOA 1U6GA 2OTJI 4BACA 1SVMA 1X1BA 4R1HA 2BEOA 5CVJA 1XMKA 2F6CA 5JI6A 4ZYEA 3IL2A 2PMZN 3EUHA 3TGNA 1DU6A 2CQ7A 1T0FA 2OA4A 2E19A 3QPSA 3O8HA 4A2UA 1KZHA 3COAC 3FDYA 1B8IB 1XGNA 2PMZA 4BJ6C 4XKCA 1EA3A 1Z91A 3HOVJ 3QOPA 2KFDA 3TOAA 2M4GA 3WTYC 5EGOB 4CH7A 3ABLH 1JKRC 1O3RA 2NYXA 4V19K 3KP2A 1QBJA 2UWMA 1OPCA 1HLVA 1GUUA 1L3LA 3LSJA 2AHQA 1BIBA 2AO9A 3P5JA 1RETA 1LPQA 4WX9A 2QZ8A 5B66C 2WAEA 1D5YA 9ANTA 3TBIA 5KCMA 3V7SA 3U2RA 2XROA 2CQKA 1J59A 2A6TA 1ACIA 1LE8A 2L9NA 1U5TB 3DBLB 4IJAA 5F64A 1V55H 4B3AA 4UUSA 1ON2A 2PJRA 5JVTA 3L2WA 1AKHB 4NC8A 3KP5A 2V9KA 3BR3A 2Q0OA 4B4CA 1Y56A 2BW3B 2R4GA 1QGPA 3ZP5A 4KUMA 3C2HA 3NEUA 2JA8J 3OV8A 1MH3A 3JRDA 3MVPA 1PVEA 3MCZA 4UXNA 3CD6I 4PGGA 1U8RA 1LJ9A 2RQQA 1QRYA 4YEJA 1Z6RA 3HHGA 2R7ZJ 5EEGA 1IRXA 1K4TA 5J1UA 5CVIA 1JTYA 4PUSA 2GXBA 2K4JA 3HSEA 4MHGA 3L09A 5F27A 2QYOA 4QLCU 2DMNA 1P92A 3R4KA 2E5NA 5BNGA 3PIPF 4L9JA 4MO7A 2QKMB 1ZLKA 1T98A 3F21A 1W5CC 1VI0A 3HIFA 3OIPA 4BU2A 5F0HA 1FYMA 1OJLA 1ZLJA 4BXFA 1FWZA 2PEXA 1OMIA 3CUQC 3WGHA 1NG6A 1WWXA 2V79A 3N4MA 3WTXC 2H27A 5K7FA 1YJWI 2O9LA 1ZRDA 5DCMB 3CDHA 2FBIA 4CCLA 4RB1A 3ZMSA 4KA4A 3A01A 5J4VA 2XGXA 2A6EF 2D2WA 3FF5A 2YS9A 3WTSC 2LNBA 2IJLA 2DK5A 4BE2A 1MMGA 2RNGA 3ULQB 4MEXF 4DYCA 5BQTA 2M8EA 3BWGA 2O7OA 3ZR8X 1ETKA 1X1PA 2R7RA 4M6XA 4PJJA 3DQVC 2GA2A 2R5YB 3PUBA 4ESJA 4PFOA 2AQFA 2UUZA 3A02A 2LOOA 4XLCA 1TT0A 2QM3A 3GLLA 2HVQA 2WY8Q 1SFOJ 1Z3XA 2V1UA 3BTJA 2JJ7A 5HDKA 4DGWB 4AYBN 1X58A 2ZMEC 3F6OA 1JUMA 1R36A 2KZGA
chains in the Genus database with same CATH topology
4IHWA 3IV5A 4BY7J 4RBOA 3S17J 4M3FA 2HOTA 3HGGA 1Q1VA 2EZHA 2RAEA 4D7NA 2LLKA 1BA5A 2R0QC 1MBFA 3WHCA 2Y9YA 3BR5A 1BL0A 2VKEA 3E7LA 4B1RA 4RDUA 4Y52J 4BXXJ 3JR9A 5E3LA 1QVUA 2NVYJ 1ETVA 4EEFG 1VNDA 2CQQA 3G1LA 3SFIA 4QIWN 5E3NA 5C3EJ 1ZKGA 1LFUP 4C3IJ 3BR2A 4LOCA 5C4XJ 1UG2A 3D1NI 1WCMJ 1E3OC 1TWHJ 5IYCJ 1MSEC 2JA5J 2LVSA 3ZOBA 4UUSB 4MFDA 2EH3A 2HXOA 3BG9A 1H8AC 4G12A 2N8GA 1X2MA 3SJMA 1APLC 2E2IJ 3HB9A 3IH4A 2CU7A 3TP3A 2MW8A 4A69C 1B72B 1WH7A 2ECBA 5FKMA 3H3VK 2QCOA 3S1RJ 2FD5A 1ENHA 3BQZA 2TCTA 1F36A 2X48A 5F08A 3RZOJ 3BR1A 2O8KA 1TWAJ 2CUEA 1RPWA 1CQTA 1VF9A 2FX0A 5F1JA 1TWFJ 4GFBA 1U9NA 4X1EA 1FJLA 5GP9A 3FK6A 3GTMJ 3G1MA 2DA4A 3GTLJ 5FKOA 3S1NJ 3FISA 3S2DJ 2HOSA 4V2GA 4FTHA 3K2AA 5FJ8J 2WB1N 3RKQA 1GDTA 2E2HJ 3MKLA 4JP0A 1EF4A 2Y9ZA 1JJ6C 1SANA 4A3LJ 1ETOA 4IHVA 2CJJA 3TP0A 1RR7A 3LSPA 1JJ8C 3JRHA 1ZR2A 2XPVA 5K7HA 1JKPC 1JTXA 1TWGJ 3HOUJ 3LOCA 5M5YJ 2HDDA 3DCFA 1JUPA 3I4NJ 3Q0UA 3A01B 1MBKA 4QTRA 1MBJA 1RKWA 1DU0A 5IP6A 2FJ1A 2OF7A 1IDYA 2EQRA 5E3MA 4QSHA 1IC8A 5HODA 3I4MJ 4I76A 2LTPA 2COBA 1Y1VJ 2MG4A 2XB0X 4UUTA 2HYJA 3HGYA 3JREA 1MBEA 1WPKA 4FE4A 3BR0A 4I6ZA 3JRCA 2XGDA 4A3BJ 4JX4A 3WHBA 4JX6A 2ECCA 1I6HJ 2TRTA 3MN2A 1JUSA 3NAUA 4DZPA 3HOYJ 1OCTC 3FIWA 2FQ4A 4M3DA 5IOYA 2CRGA 2VPRA 1HDDC 2R5ZB 4BKXA 3GTQJ 1XC5A 4XICA 2K9SA 4MIMA 2HI3A 2OPTA 2JA6J 1ETQA 1HOMA 2WV1A 1BJZA 5JLWA 5EG0A 3GTPJ 2HXIA 2GM4A 5J1RA 1IV6A 1U8BA 1FIPA 3GTJJ 4V2FA 4A3MJ 3BTCA 1R9TJ 1POGA 3FKIJ 2DA1A 2Y31A 1WGXA 4C2MJ 3O8GA 3JRFA 3HDDA 4BBSJ 2H1KA 5FLVA 2XRLA 5C4JJ 3CCYA 2VUMJ 1G2HA 3FK7A 3HOWJ 4J19A 1MH4A 2XPWA 3TW7A 1O4XA 3S1MJ 4JYKA 1IGNA 2VI6A 3B6CA 3OSGA 2VKVA 4M3BA 3BT9A 1A6IA 5M5XJ 3JRBA 2D5VA 1MSFC 2Y2ZA 1LE8B 4FCYA 1W0TA 2NS7A 5IOZA 5EYRA 1LFBA 4D7MA 3Q0VA 2DN0A 2E2JJ 1Y1WJ 4IHXA 4IHYA 3M4OJ 3A03A 4HNVA 3DEWA 4A3DJ 4MLOA 4A3GJ 1JT6A 1FEXA 1NTCA 1YRNA 3HKZN 5FKKA 5DTDA 2X9DA 4W97A 4X6AJ 2XGEA 3L1PA 2E1OA 2I10A 2ME0A 2L7FP 1WH5A 2DA5A 2EBIA 2JK3A 1XS9A 3Q0WA 1HCRA 2B63J 3TEDA 2DA3A 4C3JJ 2LD5A 3F0CA 1UHSA 1B8IA 3PO2J 1ETXA 4FISA 4DZJA 2DMUA 2K9NA 3QQAA 3C2BA 4AC0A 3NARA 5EGOA 3HBLA 5F04A 2DJNA 1QPIA 2DA7A 4BY1J 2NVTJ 2JN6A 4A3JJ 2XPUA 3S1QJ 1MBHA 4XRSA 2DMQA 1X2NA 3IH2A 1NK3P 1BW6A 2GBYA 5M3MJ 3HOXJ 1OFCX 3LSRA 3RQIA 5IP9J 2M2EA 2ID6A 1IRZA 3IH3A 1RESA 5EZGA 1QVTA 1F43A 1AKHA 1ZGWA 1A5JA 4XK4A 1XG1A 3JRAA 4FE7A 5EG0B 3B6AA 4A3EJ 4M6VA 1JKOC 2R93J 5GPCA 3S14J 2ZB9A 5E3OA 3CDLA 1FIAA 2XSDC 1H89C 1PUFA 1U78A 3PM1A 3OSFA 2YU9J 4IEJA 2M9HA 3QPLA 2LFBA 1IJWC 3M3YJ 1GV2A 2DTZA 2YUSA 4S0HB 1RKTA 1ITYA 1ZK8A 1T33A 2GLOA 1P7JA 2IAIA 3S16J 4W1UA 1JKQC 2H8RA 1GV5A 4M3EA 1W0UA 4XIDA 2HOAA 2CQXA 2DMPA 1ETWA 1U9OA 2KDZA 4M3GA 5FKNA 5EF6A 2LK2A 3GTKJ 2DMTA 3ZQHA 2LP0A 1K83J 4L5EA 5M3FJ 5EEAA 3GBGA 1TC3C 3SDGA 1ORKA 2MGQA 4AUXA 1IDZA 4XRSG 2KT0A 4DYQA 3LSGA 2DA6A 5GPAA 4CYCA 3BTLA 4DYRA 1YRNB 1ZR4A 1BW5A 4ABZA 1S7EA 2R5ZA 2R5YA 2Y30A 3CMYA 1MNMC 3TW6A 1P7IA 2JMWA 2M34A 2P81A 4Y7NJ 3GTGJ 3JRGA 3PO3J 5M5WJ 3BTIA 2M8GX 2NVXJ 3HOZJ 2JA7J 5C44J 2Y0SN 2QF7A 5F0CA 2EZIA 2PMZN 3ZQIA 4DW6A 1DU6A 2NS8A 2E19A 2IEKA 3QPSA 3O8HA 5IP7J 1Z0XA 3G1OA 1AU7A 1B8IB 3GTOJ 1OCPA 3HOVJ 4A93J 5EZHA 3HEFA 5EGOB 1JKRC 2EZKA 2JWTA 1JGGA 1WI3A 2ELKA 1HLVA 1GUUA 1NK2P 3LSJA 2AHQA 3W6VA 2AO9A 1RETA 2EZLA 2K9QA 3BR6A 1JT0A 1HF0A 2G0EA 5J3LA 1D5YA 4NDLA 5IYBJ 9ANTA 5EDNA 4C3HJ 4A3KJ 5IPAA 2XGCA 1LE8A 2X6OA 4B3AA 4UUSA 5JLXA 3LNQA 2ME6A 2LY9A 5J1YA 3VPRA 1AKHB 3BR3A 3ZQCA 3RZDJ 4A3CJ 3OIOA 4B4CA 4A3IJ 1B72A 1I50J 2JA8J 4MFEA 1MH3A 3JRDA 3MVPA 1MBGA 5K7ZA 1GT0C 3CQZJ 1PUFB 1QRYA 2L7ZA 1T56A 4BBRJ 5IYDJ 2R7ZJ 3ZQGA 3ZQFA 5J1UA 3ZQLA 1JTYA 1ETYA 2WAQN 5F27A 2DMNA 4XRMA 5FKLA 1H88C 3S2HJ 5BNGA 1UMQA 4MO7A 3K7AJ 1IUFA 2MSYA 2L0KA 5F0HA 1VI0A 3BQYA 1OJLA 3HM5A 1AHDP 2LKXA 3S15J 3BG3A 3UKGA 5K7FA 5F0FA 2O9LA 1TWCJ 4D5CA 1Z77A 4JX5A 3A01A 3BG5A 1ZTRA 2ID3A 2NOGA 2YS9A 3Q3SA 4CYCB 4D5FA 4DYCA 3H0GJ 1GVDA 2O7OA 1K61A 1ETKA 2HQ5A 2IBDA 2NVQJ 2LR8A 5FLMJ 2R92J 2R5YB 1HDPA 2M0CA 1I3QJ 2DA2A 1IG7A 3A02A 3JRIA 1FTZA 1SFOJ 2CUFA 1VFCA 2K40A 3BTJA 2JJ7A 2XB5A 4A3FJ 5DS9A 4AYBN 1ZQ3P 3OOUA 1X58A 2L7MP 1FTTA 2L9RA 2W48A 1JUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHW A;  3IV5 A;  4BY7 J;  4RBO A;  3S17 J;  4M3F A;  2HOT A;  3HGG A;  1Q1V A;  2EZH A;  2RAE A;  4D7N A;  2LLK A;  1BA5 A;  2R0Q C;  1MBF A;  3WHC A;  2Y9Y A;  3BR5 A;  1BL0 A;  2VKE A;  3E7L A;  4B1R A;  4RDU A;  4Y52 J;  4BXX J;  3JR9 A;  5E3L A;  1QVU A;  2NVY J;  1ETV A;  4EEF G;  1VND A;  2CQQ A;  3G1L A;  3SFI A;  4QIW N;  5E3N A;  5C3E J;  1ZKG A;  1LFU P;  4C3I J;  3BR2 A;  4LOC A;  5C4X J;  1UG2 A;  3D1N I;  1WCM J;  1E3O C;  1TWH J;  5IYC J;  1MSE C;  2JA5 J;  2LVS A;  3ZOB A;  4UUS B;  4MFD A;  2EH3 A;  2HXO A;  3BG9 A;  1H8A C;  4G12 A;  2N8G A;  1X2M A;  3SJM A;  1APL C;  2E2I J;  3HB9 A;  3IH4 A;  2CU7 A;  3TP3 A;  2MW8 A;  4A69 C;  1B72 B;  1WH7 A;  2ECB A;  5FKM A;  3H3V K;  2QCO A;  3S1R J;  2FD5 A;  1ENH A;  3BQZ A;  2TCT A;  1F36 A;  2X48 A;  5F08 A;  3RZO J;  3BR1 A;  2O8K A;  1TWA J;  2CUE A;  1RPW A;  1CQT A;  1VF9 A;  2FX0 A;  5F1J A;  1TWF J;  4GFB A;  1U9N A;  4X1E A;  1FJL A;  5GP9 A;  3FK6 A;  3GTM J;  3G1M A;  2DA4 A;  3GTL J;  5FKO A;  3S1N J;  3FIS A;  3S2D J;  2HOS A;  4V2G A;  4FTH A;  3K2A A;  5FJ8 J;  2WB1 N;  3RKQ A;  1GDT A;  2E2H J;  3MKL A;  4JP0 A;  1EF4 A;  2Y9Z A;  1JJ6 C;  1SAN A;  4A3L J;  1ETO A;  4IHV A;  2CJJ A;  3TP0 A;  1RR7 A;  3LSP A;  1JJ8 C;  3JRH A;  1ZR2 A;  2XPV A;  5K7H A;  1JKP C;  1JTX A;  1TWG J;  3HOU J;  3LOC A;  5M5Y J;  2HDD A;  3DCF A;  1JUP A;  3I4N J;  3Q0U A;  3A01 B;  1MBK A;  4QTR A;  1MBJ A;  1RKW A;  1DU0 A;  5IP6 A;  2FJ1 A;  2OF7 A;  1IDY A;  2EQR A;  5E3M A;  4QSH A;  1IC8 A;  5HOD A;  3I4M J;  4I76 A;  2LTP A;  2COB A;  1Y1V J;  2MG4 A;  2XB0 X;  4UUT A;  2HYJ A;  3HGY A;  3JRE A;  1MBE A;  1WPK A;  4FE4 A;  3BR0 A;  4I6Z A;  3JRC A;  2XGD A;  4A3B J;  4JX4 A;  3WHB A;  4JX6 A;  2ECC A;  1I6H J;  2TRT A;  3MN2 A;  1JUS A;  3NAU A;  4DZP A;  3HOY J;  1OCT C;  3FIW A;  2FQ4 A;  4M3D A;  5IOY A;  2CRG A;  2VPR A;  1HDD C;  2R5Z B;  4BKX A;  3GTQ J;  1XC5 A;  4XIC A;  2K9S A;  4MIM A;  2HI3 A;  2OPT A;  2JA6 J;  1ETQ A;  1HOM A;  2WV1 A;  1BJZ A;  5JLW A;  5EG0 A;  3GTP J;  2HXI A;  2GM4 A;  5J1R A;  1IV6 A;  1U8B A;  1FIP A;  3GTJ J;  4V2F A;  4A3M J;  3BTC A;  1R9T J;  1POG A;  3FKI J;  2DA1 A;  2Y31 A;  1WGX A;  4C2M J;  3O8G A;  3JRF A;  3HDD A;  4BBS J;  2H1K A;  5FLV A;  2XRL A;  5C4J J;  3CCY A;  2VUM J;  1G2H A;  3FK7 A;  3HOW J;  4J19 A;  1MH4 A;  2XPW A;  3TW7 A;  1O4X A;  3S1M J;  4JYK A;  1IGN A;  2VI6 A;  3B6C A;  3OSG A;  2VKV A;  4M3B A;  3BT9 A;  1A6I A;  5M5X J;  3JRB A;  2D5V A;  1MSF C;  2Y2Z A;  1LE8 B;  4FCY A;  1W0T A;  2NS7 A;  5IOZ A;  5EYR A;  1LFB A;  4D7M A;  3Q0V A;  2DN0 A;  2E2J J;  1Y1W J;  4IHX A;  4IHY A;  3M4O J;  3A03 A;  4HNV A;  3DEW A;  4A3D J;  4MLO A;  4A3G J;  1JT6 A;  1FEX A;  1NTC A;  1YRN A;  3HKZ N;  5FKK A;  5DTD A;  2X9D A;  4W97 A;  4X6A J;  2XGE A;  3L1P A;  2E1O A;  2I10 A;  2ME0 A;  2L7F P;  1WH5 A;  2DA5 A;  2EBI A;  2JK3 A;  1XS9 A;  3Q0W A;  1HCR A;  2B63 J;  3TED A;  2DA3 A;  4C3J J;  2LD5 A;  3F0C A;  1UHS A;  1B8I A;  3PO2 J;  1ETX A;  4FIS A;  4DZJ A;  2DMU A;  2K9N A;  3QQA A;  3C2B A;  4AC0 A;  3NAR A;  5EGO A;  3HBL A;  5F04 A;  2DJN A;  1QPI A;  2DA7 A;  4BY1 J;  2NVT J;  2JN6 A;  4A3J J;  2XPU A;  3S1Q J;  1MBH A;  4XRS A;  2DMQ A;  1X2N A;  3IH2 A;  1NK3 P;  1BW6 A;  2GBY A;  5M3M J;  3HOX J;  1OFC X;  3LSR A;  3RQI A;  5IP9 J;  2M2E A;  2ID6 A;  1IRZ A;  3IH3 A;  1RES A;  5EZG A;  1QVT A;  1F43 A;  1AKH A;  1ZGW A;  1A5J A;  4XK4 A;  1XG1 A;  3JRA A;  4FE7 A;  5EG0 B;  3B6A A;  4A3E J;  4M6V A;  1JKO C;  2R93 J;  5GPC A;  3S14 J;  2ZB9 A;  5E3O A;  3CDL A;  1FIA A;  2XSD C;  1H89 C;  1PUF A;  1U78 A;  3PM1 A;  3OSF A;  2YU9 J;  4IEJ A;  2M9H A;  3QPL A;  2LFB A;  1IJW C;  3M3Y J;  1GV2 A;  2DTZ A;  2YUS A;  4S0H B;  1RKT A;  1ITY A;  1ZK8 A;  1T33 A;  2GLO A;  1P7J A;  2IAI A;  3S16 J;  4W1U A;  1JKQ C;  2H8R A;  1GV5 A;  4M3E A;  1W0U A;  4XID A;  2HOA A;  2CQX A;  2DMP A;  1ETW A;  1U9O A;  2KDZ A;  4M3G A;  5FKN A;  5EF6 A;  2LK2 A;  3GTK J;  2DMT A;  3ZQH A;  2LP0 A;  1K83 J;  4L5E A;  5M3F J;  5EEA A;  3GBG A;  1TC3 C;  3SDG A;  1ORK A;  2MGQ A;  4AUX A;  1IDZ A;  4XRS G;  2KT0 A;  4DYQ A;  3LSG A;  2DA6 A;  5GPA A;  4CYC A;  3BTL A;  4DYR A;  1YRN B;  1ZR4 A;  1BW5 A;  4ABZ A;  1S7E A;  2R5Z A;  2R5Y A;  2Y30 A;  3CMY A;  1MNM C;  3TW6 A;  1P7I A;  2JMW A;  2M34 A;  2P81 A;  4Y7N J;  3GTG J;  3JRG A;  3PO3 J;  5M5W J;  3BTI A;  2M8G X;  2NVX J;  3HOZ J;  2JA7 J;  5C44 J;  2Y0S N;  2QF7 A;  5F0C A;  2EZI A;  2PMZ N;  3ZQI A;  4DW6 A;  1DU6 A;  2NS8 A;  2E19 A;  2IEK A;  3QPS A;  3O8H A;  5IP7 J;  1Z0X A;  3G1O A;  1AU7 A;  1B8I B;  3GTO J;  1OCP A;  3HOV J;  4A93 J;  5EZH A;  3HEF A;  5EGO B;  1JKR C;  2EZK A;  2JWT A;  1JGG A;  1WI3 A;  2ELK A;  1HLV A;  1GUU A;  1NK2 P;  3LSJ A;  2AHQ A;  3W6V A;  2AO9 A;  1RET A;  2EZL A;  2K9Q A;  3BR6 A;  1JT0 A;  1HF0 A;  2G0E A;  5J3L A;  1D5Y A;  4NDL A;  5IYB J;  9ANT A;  5EDN A;  4C3H J;  4A3K J;  5IPA A;  2XGC A;  1LE8 A;  2X6O A;  4B3A A;  4UUS A;  5JLX A;  3LNQ A;  2ME6 A;  2LY9 A;  5J1Y A;  3VPR A;  1AKH B;  3BR3 A;  3ZQC A;  3RZD J;  4A3C J;  3OIO A;  4B4C A;  4A3I J;  1B72 A;  1I50 J;  2JA8 J;  4MFE A;  1MH3 A;  3JRD A;  3MVP A;  1MBG A;  5K7Z A;  1GT0 C;  3CQZ J;  1PUF B;  1QRY A;  2L7Z A;  1T56 A;  4BBR J;  5IYD J;  2R7Z J;  3ZQG A;  3ZQF A;  5J1U A;  3ZQL A;  1JTY A;  1ETY A;  2WAQ N;  5F27 A;  2DMN A;  4XRM A;  5FKL A;  1H88 C;  3S2H J;  5BNG A;  1UMQ A;  4MO7 A;  3K7A J;  1IUF A;  2MSY A;  2L0K A;  5F0H A;  1VI0 A;  3BQY A;  1OJL A;  3HM5 A;  1AHD P;  2LKX A;  3S15 J;  3BG3 A;  3UKG A;  5K7F A;  5F0F A;  2O9L A;  1TWC J;  4D5C A;  1Z77 A;  4JX5 A;  3A01 A;  3BG5 A;  1ZTR A;  2ID3 A;  2NOG A;  2YS9 A;  3Q3S A;  4CYC B;  4D5F A;  4DYC A;  3H0G J;  1GVD A;  2O7O A;  1K61 A;  1ETK A;  2HQ5 A;  2IBD A;  2NVQ J;  2LR8 A;  5FLM J;  2R92 J;  2R5Y B;  1HDP A;  2M0C A;  1I3Q J;  2DA2 A;  1IG7 A;  3A02 A;  3JRI A;  1FTZ A;  1SFO J;  2CUF A;  1VFC A;  2K40 A;  3BTJ A;  2JJ7 A;  2XB5 A;  4A3F J;  5DS9 A;  4AYB N;  1ZQ3 P;  3OOU A;  1X58 A;  2L7M P;  1FTT A;  2L9R A;  2W48 A;  1JUM A; 
#chains in the Genus database with same CATH topology
 4IHW A;  4LIU A;  3S2W A;  1H9T A;  2HOE A;  3QOD A;  1PJR A;  1Q1V A;  2EZH A;  2RAE A;  3PFY A;  3CC7 I;  1B9M A;  2GA1 A;  4UV8 A;  2VT3 A;  4XKV A;  1F9N A;  3WHC A;  2ADU A;  2Y9Y A;  5FLX Z;  1F4K A;  2VKE A;  2VJ4 A;  3E7L A;  4IOC F;  1ON1 A;  1ZG5 A;  2DFH A;  4B1R A;  1YW7 A;  1VQ6 I;  4LGW A;  5JHU A;  2XKO A;  1QVU A;  3CUQ A;  1I6H J;  1XMA A;  2GZW A;  5E3N A;  3PNV A;  1J0R A;  4KJZ A;  5FRN A;  1ZKG A;  1VQ5 I;  1TNT A;  3G71 I;  1W7P D;  1TWH J;  4CCN A;  5IYC J;  3WTV C;  3C18 A;  2LVS A;  4RMN A;  3BG9 A;  2KZV A;  1IV8 A;  2ISY A;  3SJM A;  2EA4 A;  4P5O A;  3IH4 A;  4CCK A;  2IS2 A;  1MW7 A;  2MW8 A;  4A69 C;  1WJA A;  2DOF A;  2P7V B;  3K9T A;  2ZFW A;  4M71 A;  2W7N A;  2H09 A;  4XOR A;  5FKM A;  2E7W A;  5A2Q K;  4M74 A;  3QP6 A;  4BL0 B;  4FHT A;  3SQN A;  3F8M A;  5LHI A;  2M4K A;  4RAF A;  2TCT A;  2X48 A;  5CKT A;  3BR1 A;  3BG6 A;  1XD7 A;  4GGG A;  3GZ6 A;  1BI1 A;  2H8W A;  4LLN A;  1QHH D;  1RPW A;  2D1H A;  4G9Y A;  1OYY A;  4TV7 A;  4E7K A;  4GFB A;  2IA0 A;  3BCB A;  1U9N A;  4XLN F;  2ZME A;  1KYW A;  4E7H A;  2KIS A;  2DA4 A;  4FQG A;  4HA8 A;  4KMU X;  4PJN A;  5FKO A;  4B44 A;  4FTH A;  5D4S A;  4UUV A;  1D0X A;  2FF4 A;  5FRO A;  4KNY A;  1JJ6 C;  2ZO4 A;  1YO5 C;  1ETO A;  2JUC A;  1SFU A;  3WE3 A;  1T39 A;  1F5T A;  1ZR2 A;  3KEY A;  1QQI A;  2XSJ C;  3OYE A;  1KU7 A;  1JKP C;  1JTX A;  4IRG A;  3C1D A;  1D5V A;  2H94 A;  2ZNZ A;  4NBQ A;  3DCF A;  1JUP A;  3I4N J;  1MBK A;  2V26 A;  1MBJ A;  5IP6 A;  2FJ1 A;  4N4N B;  4E70 A;  4P1W A;  4J00 A;  1ZRC A;  2EQR A;  1O7F A;  4CGZ A;  2A3S A;  1FP2 A;  3EPZ A;  1BN5 A;  2XB0 X;  3LST A;  2BY0 A;  1QZE A;  3HGY A;  3A0B C;  6PAX A;  1OKR A;  3S3M A;  2VPL A;  4C9Y A;  1VQK I;  1JHF A;  2KDO A;  4I6Z A;  3HRS A;  2YU3 A;  2ECC A;  3M8F A;  1IAW A;  4OIO F;  3IRQ A;  5BS6 A;  4E7Z A;  2ELJ A;  2MLG A;  3CTA A;  3PQK A;  1N25 A;  1WJE A;  4NQW B;  3LL7 A;  1LVK A;  1GLN A;  1OYI A;  1FBU A;  2CRG A;  1HDD C;  4IVN A;  3QP5 A;  1E17 A;  2BOL A;  4BKX A;  3GTQ J;  2M7B A;  3H5A A;  3MWM A;  4XIC A;  1EH8 A;  4EV0 A;  4MIM A;  1RC9 A;  2OPT A;  2QSH X;  1ETQ A;  1HOM A;  5JLW A;  2QWW A;  2DCE A;  3IWZ A;  3NRV A;  2ETH A;  3HRU A;  1FIP A;  3MD2 A;  1U8B A;  5E8I A;  1SAX A;  4A3M J;  3AL0 B;  1R9T J;  4KN7 X;  1YIJ I;  2VC1 A;  1R5G A;  2R7D A;  2Y31 A;  1T6S A;  4BBS J;  1SD6 A;  2HPI A;  4KT5 C;  1R00 A;  3GW2 A;  2NRA C;  2BYV E;  2R7Q A;  4Y3O A;  3Q5F A;  2DPD A;  2X6X A;  1G2H A;  5GAD J;  2D45 A;  2MH9 A;  5TIS C;  4J19 A;  4YRV A;  4XON A;  3OR1 C;  1HST A;  3ZRG A;  1O4X A;  2M3A A;  3S1M J;  2JZY A;  5LRR A;  2BHZ A;  2LY2 A;  5FO5 A;  2R7S A;  3PQJ A;  2VBZ A;  4AVP A;  4XM3 A;  2XVC A;  4M3B A;  2WC2 A;  1TL8 A;  1E2X A;  4J01 A;  3BT9 A;  2MAB A;  1A6Q A;  1A6I A;  3K2Z A;  3JRB A;  2OD5 A;  1S7O A;  2VLA A;  4HF1 A;  4AWX B;  1QU3 A;  2K9M A;  1TP4 A;  2QEN A;  1K6O A;  4PK4 A;  1ERD A;  4ZDO A;  3CCQ I;  2XF7 A;  1ZYR F;  2KL4 A;  3RKY A;  5D6F A;  2CSO A;  1FOW A;  2EIM H;  3ABT A;  4NB5 A;  1JT6 A;  1UCR A;  1YRN A;  4G8X A;  3HTU A;  2K7L A;  3VYS B;  2DOE A;  2JSP A;  3H5R A;  3OL3 A;  1WJC A;  3SYT A;  4CA0 A;  2MH2 A;  2DXI A;  2OQG A;  3SHF A;  3I56 I;  4F92 B;  1W5T A;  4BE1 A;  4NNJ A;  1HA8 A;  3AG3 H;  3OYM A;  3RSN A;  2EFQ A;  1UHW A;  3J7Y J;  2L7F P;  4I98 B;  3L2Q A;  2EBI A;  1VQN I;  3KP4 A;  2ZXH A;  2P8T A;  1UST A;  3E5X A;  4G6T B;  1HCR A;  1MMD A;  1I27 A;  4C30 A;  3CC2 I;  4OAZ A;  2DA3 A;  4FAS D;  4HSR A;  4M9X A;  3I55 I;  4DZJ A;  4AIH A;  2DMU A;  2Q8K A;  4AC0 A;  4G7Z F;  2QLZ A;  3AG1 H;  3DWL E;  2XHK A;  3LQR A;  4U0Y A;  2NVT J;  3OS1 A;  2JN6 A;  2NAZ A;  4QPO A;  4BYY A;  2XPU A;  3C3W A;  3DXJ F;  3S1Q J;  3LSK A;  2GXA A;  1X2N A;  3IH2 A;  1WSU A;  3PNT A;  5FLX K;  4BQN A;  2L9S A;  5DCF A;  3K69 A;  2W82 A;  4OIN F;  4WXH A;  4CUG A;  2OUM A;  2Q1Z B;  3GZN B;  2HQN A;  1QVT A;  3LMM A;  4N4O B;  2IS6 A;  3T5X A;  4FE7 A;  1HW2 A;  1LUJ B;  1X4O A;  3LA7 A;  4R8H A;  2JRM A;  2WAQ A;  1X1A A;  2R93 J;  3S14 J;  2ZB9 A;  1SMY F;  1FIA A;  2XIG A;  3TL4 X;  4XN3 A;  3QPL A;  2ZJR F;  1LEB A;  5CQE A;  4RB0 A;  1HKS A;  3I53 A;  3M3Y J;  2DTZ A;  2EV6 A;  4HDV A;  1UHM A;  1RKT A;  5K5Q A;  1WFX A;  3O6B B;  4Q4Z F;  2GLO A;  1XTA A;  2HDC A;  1MMA A;  2UV1 A;  3LAJ A;  1ZGJ A;  1YLF A;  4HV5 A;  2EFP A;  1W5S A;  3OWT A;  3H35 A;  4IKF A;  1MDM A;  5LGU A;  1IN8 A;  1XMX A;  4EM1 A;  4ZDP A;  3DU5 A;  1W0U A;  5EEH A;  3P7N A;  2DMP A;  1ETW A;  3ZN0 A;  3ZMD A;  1U9O A;  1YI2 I;  5BPI A;  1IUY A;  3U1D A;  1XDS A;  4O6J A;  1K83 J;  4L5E A;  5J47 A;  2HVS A;  1Z3Y A;  5EEA A;  1TC3 C;  3FXL A;  4AUX A;  1IDZ A;  2KT0 A;  1FX7 A;  4DQ2 A;  3H1C A;  4IHT A;  1ZAO A;  2L4M A;  4XLF A;  3VFZ A;  1R5H A;  3KZZ A;  4I0A A;  4NC6 A;  4D1Q A;  2DQL A;  2IPQ X;  4ABZ A;  3LFK A;  2F2E A;  2R5Z A;  3H92 A;  4P55 A;  4LLL A;  3CMY A;  1MNM C;  4PJM A;  1LFP A;  1MD0 A;  1P7I A;  2JMW A;  1K79 A;  5DDG A;  2VL8 A;  2M8G X;  1K6Y A;  2JA7 J;  2LMD A;  2Y0S N;  3HYI A;  2QF7 A;  3KYD B;  4CZZ A;  3V7R A;  1FZP B;  1QA6 A;  1J2X A;  5F0C A;  2EZI A;  2KLO A;  1H0M A;  2BY3 A;  4DW6 A;  2Y0S A;  5AIP A;  2FA5 A;  3RPU D;  1I5Z A;  2LRD A;  2WWY A;  4JOM A;  5BMZ A;  3GEZ A;  3G1O A;  1P4A A;  1AU7 A;  3CMM A;  3K4M A;  4XBF A;  1VQ9 I;  2KKO A;  3LA3 A;  3WTT C;  4S04 A;  4M9Z A;  1UEL B;  3NWS A;  2L01 A;  3HG9 A;  4XNF A;  3GFJ A;  3ZQQ A;  1GXQ A;  1WI3 A;  3MKW B;  2WV0 A;  4FT8 A;  4M73 A;  1YE9 A;  1ZHF A;  3C7J A;  2O61 A;  3ELK A;  4EGZ A;  3BR6 A;  4CSW A;  3KLN A;  3DBH B;  3ASO H;  1XSV A;  2G0E A;  3CCJ I;  5J3L A;  1HF0 A;  3BPX A;  5IYB J;  1P2F A;  4A3K J;  4Y13 A;  3S3O A;  5GAE J;  2VXZ A;  4LJZ F;  1LDJ A;  1J7K A;  2X6O A;  3DPT A;  2IGO A;  2M7A A;  5HLT A;  4KDP A;  3IC7 A;  3L7W A;  5HOO A;  1LB2 A;  1OCZ H;  4A3C J;  1PP7 U;  1HW5 A;  4ZZD A;  1B72 A;  4G94 A;  3E1S A;  3FBI B;  4MFE A;  4AIJ A;  1D8K A;  1YFH A;  1PUF B;  2L4A A;  2L7Z A;  2XAF A;  2VBW A;  4L0Y B;  1WJ5 A;  2IA2 A;  3WTW C;  2WB1 A;  3HC7 A;  4CCJ A;  1ZGA A;  4ENJ A;  4OIR F;  5D8L B;  2K9L A;  4XRM A;  2V6C A;  4RB3 C;  1K78 A;  2W4S A;  3KET A;  2HKX A;  4ZYG A;  3W2W A;  4G7O F;  2P5V A;  1N75 A;  5F1R A;  3WE2 A;  1VQO I;  1FNN A;  1V4R A;  1T0F C;  1IN5 A;  3S15 J;  3K70 D;  4ZYD A;  2L9V A;  5JR3 A;  1DDN A;  1TW3 A;  1R4M B;  1FSH A;  3AG2 H;  3IP4 B;  3BG5 A;  4D9J A;  4LG0 B;  1L0O C;  2NOG A;  5K5O A;  3K0L A;  3L9F A;  4CYC B;  4HQM A;  4D5F A;  3HRM A;  4XOP A;  1K61 A;  4ZJZ A;  3EYY A;  2HQ5 A;  2NVQ J;  2LR8 A;  3B02 A;  5FLM J;  4PCQ A;  1HDP A;  1I3Q J;  3WGI A;  1V3F A;  2DA2 A;  3I54 A;  1YJ9 I;  2CWE A;  1QPM A;  1Y0N A;  1VFC A;  3VB2 A;  2K4B A;  2XB5 A;  3BP8 A;  3FXR A;  1VTN C;  5DS9 A;  2ZXJ A;  4EVI A;  5LRS A;  5K1Y A;  4UB8 C;  3QWL A;  4Q47 A;  5EJC A;  3DPU A;  1FTT A;  1Z1D A;  1UFM A;  1LDK B;  2B7E A;  2DDB A;  3S17 J;  2A69 F;  5B5E C;  3CCU I;  1TBX A;  1S9H A;  2MBF A;  2RV8 A;  4AD9 A;  2M30 A;  2V9P A;  5H20 A;  1MBF A;  4BGD A;  3BR5 A;  5B1A H;  3OYL A;  1E0E A;  3E6D A;  3CJN A;  2RGV A;  1HBX G;  1EKE A;  3C2G A;  4BXX J;  2EK5 A;  3CJQ B;  2D1V A;  4GXO A;  2NVY J;  5E1Z B;  5E3L A;  3DKW A;  2ISZ A;  4EEF G;  2CQQ A;  4IQJ A;  4YIR X;  5C3E J;  4C3I J;  3KZY A;  1IZ1 A;  1TW2 A;  1E3O C;  1MSE C;  1U3E M;  2R7X A;  3GFL A;  4UUS B;  2EH3 A;  2VJJ A;  2VQC A;  3Q9S A;  1H8A C;  1FOY A;  4MQ9 F;  4EMS A;  2VOD A;  1APL C;  2E2I J;  1IW7 F;  4A6D A;  1YX3 A;  4U7D A;  5E1X A;  4CXF A;  4NUB A;  1XSX A;  3QU3 A;  3REO A;  3ERE D;  3I58 A;  3ISP A;  4UVA A;  2PI0 A;  1YQA A;  1VQ4 I;  1XGO A;  1MMS A;  1QO0 D;  4A0X A;  3LSM A;  5IT9 K;  5F08 A;  1UJ8 A;  2R3S A;  1UB9 A;  5DD4 A;  1F1Z A;  1S29 A;  2OCE A;  5KK1 A;  3HKZ A;  2UXX A;  4B43 A;  5JFR A;  2OBP A;  3HOS A;  1TWF J;  3W6J B;  4WK8 F;  3M8E A;  4X1E A;  5CLS A;  2L2O A;  3FK6 A;  3GTM J;  2IW5 A;  3S2D J;  3L2U A;  3FIS A;  4IL6 C;  1GVJ A;  2WA0 A;  4V2G A;  3K2A A;  3HXL A;  4A0Y A;  5FJ8 J;  2HQR A;  1XGS A;  2GAU A;  1J5Y A;  1EF4 A;  2ZBK A;  1RUO A;  1SAN A;  2ESH A;  2OZ6 A;  1TNS A;  2GWR A;  1NG7 A;  3TP0 A;  3LSP A;  1OQY A;  2MD5 A;  3JCU C;  3JRH A;  3JTH A;  2F48 A;  4BUP A;  3M1C A;  4BQO A;  4XLP F;  2PFB A;  5M5Y J;  1YYV A;  1MJ9 A;  1S5L C;  2FU4 A;  3A01 B;  1DU0 A;  5HNF A;  4IF4 A;  3MZ8 A;  4F3Q A;  3R0J A;  3HJE A;  2BVL A;  1U5T A;  4IXA A;  5E3M A;  4DNC A;  5J8F A;  5HOD A;  3I4M J;  2I8D A;  3F8C A;  4I76 A;  2YX4 A;  5J6X A;  2LTP A;  4UUT A;  3FBN B;  3FXU A;  2HYJ A;  2CGP A;  1FYK A;  1XCB A;  1MBE A;  3DFG A;  3PSI A;  1WPK A;  3J81 Z;  3RPU A;  5DD8 A;  3JRC A;  3WHB A;  1CF7 B;  2TRT A;  4X0G A;  3NAU A;  3HOY J;  2V1N A;  2DW4 A;  2VAS A;  2PG4 A;  4IRI A;  1Z21 A;  3KP3 A;  1MMN A;  3MMY B;  1MNE A;  5DV5 A;  1R1V A;  2VQG A;  4M3D A;  3H9Q A;  4LG3 A;  5IY5 H;  5IOY A;  3JW4 A;  2L54 A;  2M0M A;  1BBY A;  1D1A A;  1LVA A;  4QWQ A;  5JHF A;  4IZZ A;  4HRI A;  1M1E B;  5TGT A;  3OS2 A;  3ABM H;  2BXZ A;  4M6Y A;  4KMF A;  4ETS A;  2JA6 J;  2WV1 A;  2W00 A;  5EG0 A;  1REP C;  1TLH B;  3VYU B;  3F8N A;  3WG9 A;  1IV6 A;  3EET A;  3GTJ J;  5GAH J;  3F8B A;  1ULY A;  3CUQ B;  3FKI J;  3E5U A;  2DA1 A;  4RGU A;  4WXD A;  3OYC A;  5GAG J;  1WGX A;  2JVG A;  2HNH A;  1X3W B;  1XX5 A;  1I1G A;  1X3U A;  3CCY A;  3GO5 A;  2FRH A;  1MIJ A;  1AWC A;  5D5U B;  1FC3 A;  3HSF A;  2O5R A;  2Y75 A;  3FX3 A;  4HOB A;  2MLK A;  4PFP A;  1IGN A;  2VI6 A;  2K85 A;  3OSG A;  2KPM A;  1SFK A;  5M5X J;  3GCM A;  2MYS A;  2DT5 A;  1ZG1 A;  2NS7 A;  5IOZ A;  5EYR A;  2PN6 A;  5HLH A;  2JT1 A;  2DN0 A;  3Q0V A;  3JSP A;  2BY1 A;  2CW8 A;  5BPD A;  1T38 A;  4M9S A;  1DP7 P;  2QBY A;  5FD5 A;  1FP1 D;  4RA2 A;  3M4O J;  4XOT A;  3BCA A;  2XF6 A;  3CZ6 A;  2P5K A;  3SZG A;  3J7Z I;  2ZME B;  1V54 H;  5HVQ C;  3K1M A;  4L5J A;  1FEX A;  2WY7 Q;  3CLO A;  2LKS A;  1HC8 A;  5FKK A;  4RGX A;  2V7F A;  5DTD A;  5CVR A;  4JBA A;  4W97 A;  3TOB A;  1QZY A;  1VQ7 I;  1IRF A;  3GFI A;  4I7H A;  4IX7 A;  2E1M C;  3X2Q H;  4ITV A;  1Z9C A;  2VN2 A;  2JK3 A;  3H3U A;  2X1D A;  3HTS B;  2G9W A;  3GX4 X;  4C3J J;  2LD5 A;  1LKX A;  2V6E A;  3DLA A;  3HOT A;  2JPC A;  4UB6 C;  2X4H A;  3U21 A;  3C2B A;  3QPT A;  2KIF A;  3NAR A;  3HBL A;  1SFE A;  1QPI A;  5KAF C;  2BY2 A;  4OIQ F;  1B1B A;  3TO7 A;  2R7F A;  1VQL I;  2MFZ A;  3F3X A;  1MBH A;  2XAQ A;  4PJ0 C;  2DMQ A;  3QYE A;  4LIV A;  2COM A;  2XUB A;  1P9Q C;  4HPQ A;  1VQM I;  2MC4 A;  1BW6 A;  4HAM A;  3GUD A;  5M3M J;  4PZJ A;  5L3B A;  3R60 A;  3GLX A;  3HPG A;  5CJ9 A;  1XN7 A;  2M2E A;  2CG4 A;  3CME I;  4KIF A;  4MEY F;  1SEU A;  1XSD A;  2EB7 A;  2E36 A;  5H6R A;  2HWV A;  4EAT A;  1A5J A;  2ZJ2 A;  3OS0 A;  4YG2 F;  4HF0 A;  3JRA A;  1KQ9 A;  2W57 A;  1PYV A;  3QYF A;  3B6A A;  5L3D A;  4F91 B;  1U78 A;  3PM1 A;  4RLQ A;  3ZGK A;  4F55 A;  2W85 A;  2M9H A;  4GRI A;  3ML6 A;  3F22 A;  4N9I A;  4NHJ A;  3OL4 A;  2EV0 A;  1TQM A;  2OAZ A;  1GV2 A;  4RLF A;  2VBY A;  3SFZ A;  2FNP A;  4S0H B;  3GME A;  2LY1 A;  1Z67 A;  1VQ8 I;  3D5S C;  2DFE A;  2X6W A;  2BZT A;  3RKX A;  1G59 A;  3S16 J;  3I71 A;  2J5P A;  4MGR A;  1GV5 A;  4LMY A;  4ENN A;  1JHH A;  2F5E A;  4RGR A;  4M3E A;  4LB5 A;  1B59 A;  3FMQ A;  4XID A;  3CES A;  3ZPL A;  5EF6 A;  2CV1 A;  1VQP I;  1BIA A;  2P6S A;  2L5Q A;  2VOO A;  5M3F J;  3O2P E;  5HDN A;  5DUI A;  3GBG A;  1O3Q A;  3SDG A;  2LH9 A;  3BPV A;  2IGM A;  5H6Q A;  4ZTF A;  5B3S H;  3OYG A;  1T2K A;  2FXA A;  2DA6 A;  3BRO A;  5GPA A;  3BOQ A;  2W24 A;  1YRN B;  1ODD A;  4IOA F;  1LDD A;  3MKY B;  4HDU A;  3ERM A;  1Y6I A;  1SD5 A;  2L3D A;  3S8P A;  5TRD A;  1RI7 A;  3FXQ A;  3MEX A;  1UAA A;  2M34 A;  3RDI A;  5M5W J;  2ZXW H;  3RYP A;  2NVX J;  4HV6 A;  3HOZ J;  3FWE A;  3CCL I;  3T8R A;  5C44 J;  2Y69 H;  1IRG A;  5HLG A;  2CQN A;  1YHQ I;  2F5V A;  4HNT A;  3V7C A;  1EH6 A;  4IPA A;  3CO6 C;  1R1U A;  1GXP A;  2IEK A;  1KU2 A;  3GFM A;  5IP7 J;  3J81 K;  1Z0X A;  4IRH A;  2LC2 A;  4XLH A;  4ZYH A;  1BJA A;  1PP8 F;  3GTO J;  3T0Y A;  1FYL A;  4HBL A;  3DF8 A;  3I5U A;  4F93 B;  2MA3 A;  3G3Z A;  1FOX A;  2EZK A;  2JWT A;  5ICF A;  1MKM A;  2ELK A;  5TJJ A;  3MKZ A;  1D1C A;  3WGG A;  1NK2 P;  3W6V A;  2LBF A;  2NNN A;  3VSK A;  2QGU A;  4XN0 A;  3CCS I;  2R7W A;  3R0A A;  3SZT A;  4BQA A;  3DV8 A;  4C3H J;  2FOW A;  5IPA A;  3R6S A;  4HNU A;  4UHT A;  3FZV A;  2DQR A;  5JLX A;  3LNQ A;  2LY9 A;  5FFZ A;  4LB6 B;  2XF5 A;  5J1Y A;  1XPX A;  3VPR A;  4AVZ A;  3ZQC A;  3RZD J;  3OIO A;  2DLL A;  4YFK F;  3KZI C;  1I50 J;  5B1B H;  3ECO A;  1LNW A;  3A4C A;  1G3T A;  2OCC H;  1FMV A;  4Y33 A;  5K7Z A;  4EJW A;  1GT0 C;  3CQZ J;  4MTE A;  1T08 B;  3M8J A;  4DBQ A;  2EA2 A;  4ZYA A;  5IYD J;  1YJN I;  3ZQG A;  2LF7 A;  3ZQF A;  2R7U A;  4B3X A;  3ZQL A;  1TT5 B;  5FRM A;  1ETY A;  3OYN A;  2WAQ N;  1FSE A;  4BE0 A;  4ZC3 A;  5FKL A;  3S2H J;  4ENK A;  1B6A A;  5CYV A;  4QPQ A;  4OIP F;  3FXM A;  1NHA A;  3ABU A;  3OYI A;  1MDM B;  3IWF A;  1IUF A;  1W7P A;  2L0K A;  5ILU A;  4XQF A;  3HM5 A;  1XB4 A;  2O8X A;  3M9A A;  4BJT A;  4BQQ A;  1AHD P;  1JGS A;  2TDX A;  2V1X A;  2KRH A;  4M72 A;  3BJ6 A;  4I02 A;  3UKG A;  2DU9 A;  2CYY A;  5F0F A;  3CF2 A;  2JQ7 A;  5D5V B;  2JVH A;  1FPQ A;  1TWC J;  3F23 A;  2BE5 F;  3BJO A;  4D5C A;  4E6K G;  1Z77 A;  2IXS A;  3SEZ A;  3VYT B;  2JA2 A;  3T1B A;  3HSR A;  2ID3 A;  4FX4 A;  2HEO A;  1A04 A;  4YFX F;  3Q3S A;  5L3E A;  2K3P A;  2QQA A;  1ZRF A;  4ESF A;  3TMO A;  1GVD A;  4HYE A;  4U88 A;  4UVB A;  4C2U A;  3E97 A;  2M0C A;  5LBQ A;  3L00 A;  3ZMU A;  1IG7 A;  5LFA A;  2OJE D;  2KRF A;  3P9I A;  2CUF A;  3W2V A;  1O3T A;  4IQ4 A;  4Z2Y A;  2RKH A;  4XKB A;  2HFH A;  4BEH A;  2XAH A;  1OYW A;  2UXN A;  2BBY A;  5KNL A;  1ZQ3 P;  2E71 A;  2L7M P;  3OOU A;  2L9R A;  1Q1H A;  4ZH4 F;  1BR4 A;  4OMY A;  3TO6 A;  4U87 A;  4RBO A;  3DBR B;  2FSW A;  5L3C A;  2ZSI B;  2HOT A;  3HGG A;  3HZJ A;  1YS7 A;  2DTR A;  2BVM A;  2LG4 A;  3M7G A;  1BA5 A;  1R5I D;  4OAY A;  4PSX A;  3H36 A;  2R0Q C;  2G7H A;  4GDF A;  2IT0 A;  2XDV A;  4GYG A;  4RDU A;  4LLG F;  4BH9 A;  1X19 A;  4HG2 A;  3OY9 A;  3FKJ A;  3JR9 A;  2QKL B;  1J09 A;  5KAI C;  1VND A;  2JTV A;  3H3Z A;  1ZAR A;  3FHZ A;  1LFU P;  4ESB A;  2F5D A;  2IP2 A;  1UG2 A;  2VOP A;  4LK1 F;  2ELH A;  3OYB A;  2DYS H;  2KP6 A;  3P9C A;  2JA5 J;  2VXD A;  3ZOB A;  1V5F A;  2HXO A;  2K02 A;  2N8G A;  1ZN2 A;  2XRN A;  3G6E I;  2CU7 A;  4CCM A;  5H2F C;  1B72 B;  2ECB A;  3EUK L;  2Z9O A;  3S1R J;  4XSX F;  3UR3 C;  5FB2 A;  2CUJ A;  2G7U A;  3S3N A;  3BQZ A;  3V42 A;  2ICW G;  1F36 A;  3RZO J;  4HF2 A;  5K5R A;  2AXT C;  2O8K A;  3JAM Z;  1NH3 A;  2CW0 F;  1WI9 A;  1ZH5 A;  1AA7 A;  1ZG3 A;  3K4C A;  1VF9 A;  2FX0 A;  1OCC H;  3SDB A;  1Y8Q B;  4RAY A;  1RRJ A;  3JSO A;  1YW9 A;  1FBS A;  1O7L A;  2P7C B;  2K3F A;  4HLX A;  4HST A;  5GP9 A;  1K78 B;  3ONQ A;  5E17 F;  3T8T A;  3GTL J;  1PUE E;  2XAU A;  1WZ2 A;  3HUG A;  1USS A;  5AON A;  1DUX C;  1P4W A;  2HOS A;  2K86 A;  2WB1 N;  1D3Y A;  3I64 A;  3RKQ A;  1GDT A;  4JP0 A;  1FBQ A;  2Y9Z A;  3WU1 B;  1FMW A;  2BGC A;  2Z2S B;  1EJ9 A;  1SFX A;  2STW A;  2DOD A;  2HYG D;  2A07 F;  4A3L J;  3ZMT A;  4IHV A;  2CJJ A;  2VE9 A;  2L02 A;  3QOE A;  3RKW A;  1R1T A;  3B73 A;  1JJ8 C;  3E3V A;  2YR2 A;  1OLT A;  3DTE A;  1TWG J;  5HNH A;  3MAJ A;  3HOU J;  2FBK A;  2HDD A;  2JPB A;  1I1S A;  1BOA A;  3Q0U A;  3Q9V A;  5ED4 A;  4BNC A;  1H9G A;  2QSF X;  2CUZ A;  2OF7 A;  4BDY A;  3TKY A;  4CYD A;  2LYC A;  2DT6 A;  4RS8 A;  2HPM A;  3DTK A;  3A0H C;  4HX4 A;  4RM2 A;  1IC8 A;  2HTS A;  2MG4 A;  2ZC2 A;  4IHS A;  2ZSH B;  4UY8 I;  1DPR A;  2VT2 A;  2FMY A;  2NS0 A;  3DEE A;  4G6Q A;  2KIM A;  4FE4 A;  1HKQ A;  4RAZ A;  2XGD A;  4JX4 A;  2IVM A;  2XAJ A;  2LF8 A;  5D5W B;  1U0J A;  2AQE A;  2E1N A;  3A1Y A;  2GOM A;  4DZP A;  5DM7 F;  3OIQ A;  2LDU A;  1TZL A;  3FIW A;  4II2 A;  4JQF A;  1P6R A;  2FBH A;  2H6B A;  2VC0 A;  2RNJ A;  2XKP A;  3OYK A;  3DU6 A;  3OYH A;  3PFI A;  1O3S A;  2DT7 B;  1S6L A;  2PMU A;  1XDU A;  5ICG A;  1Y39 A;  1XC5 A;  2K9S A;  3WU2 C;  3OYA A;  2HTJ A;  1TTY A;  3AFH A;  3BLY A;  3W6K B;  3I9V 2;  3GTP J;  1R58 A;  4HEA 2;  1YW8 A;  2FML A;  2HXI A;  2AXL A;  5J1R A;  5E8G A;  3F9K A;  4NC7 A;  2QQ8 A;  3BTC A;  4WCG A;  1POG A;  2VQH A;  3O8G A;  3JRF A;  3HDD A;  2VB6 A;  2H1K A;  1WRJ A;  3E6M A;  4CHU A;  2XRL A;  5C4J J;  1KU3 A;  2VUM J;  3VYR B;  4PJL A;  2PLY A;  3KPH A;  1PDN C;  3HOW J;  4F7Z A;  3NQO A;  4OOI A;  2HZD A;  4XRF A;  3TW7 A;  2M87 A;  1JXS A;  4JYK A;  1P4X A;  2MC3 A;  2HDW A;  2VKV A;  5J8C A;  3ESW B;  1YX5 A;  2VE8 A;  3CCV I;  4PGH A;  4EGY A;  1C0W A;  1LE8 B;  2B9S A;  4FCY A;  1MSF C;  3UNG C;  1W0T A;  3I59 A;  3VOD A;  3FHN A;  4E7J A;  2FE3 A;  1U5T C;  4IHX A;  2R7O A;  1Y1W J;  2IS1 A;  4IHY A;  2PJR B;  3DEW A;  5J40 A;  3V4G A;  1FOK A;  4A3D J;  2X6Y A;  1QZZ A;  4FET A;  5LHH A;  4A3G J;  5ILV A;  4I01 A;  2HGC A;  2Q2E A;  1NTC A;  2ZCW A;  4XL9 A;  3AG4 H;  3HKZ N;  1Z6T A;  1BC7 C;  3OR2 C;  2WBM A;  3TO9 A;  2F4M B;  2X9D A;  4HX7 A;  4AU7 A;  1R49 A;  3CCR I;  4XKW A;  4BAY A;  4CIC A;  1LQ1 A;  1WHU A;  2XGE A;  3L1P A;  3K4K A;  1SVL A;  1Z7U A;  2RDP A;  4E7I A;  2DA5 A;  2V1D A;  2X0L A;  2F4O B;  4L9V A;  3KFW X;  3G2B A;  1KQ8 A;  2B63 J;  2IRF G;  3ZN1 A;  4N9H A;  4A12 A;  4B48 A;  4OWR B;  4XMY A;  1UHS A;  1B8I A;  2Z5U A;  3QQA A;  4BS9 A;  2WTE A;  2F4I A;  5FD6 A;  5EGO A;  2BHY A;  3ABK H;  5E20 A;  2HZT A;  1KQ0 A;  2OC6 A;  2QQB A;  2A6H F;  3MZY A;  5HDG A;  1HSJ A;  4HLY A;  2DDA A;  2EIK H;  2VON A;  2Z16 A;  3KE2 A;  4GO1 A;  2EIL H;  1EV7 A;  3L2R A;  1BC8 C;  2GBY A;  3BC8 A;  2WAF A;  3HOX J;  3LSR A;  3I4P A;  3RQI A;  4EJV A;  5IP9 J;  2EIN H;  4XR6 A;  1DQU A;  4GYI A;  2CS3 A;  1RES A;  4A5N A;  5EZG A;  5KHD A;  3LQQ A;  3RQ4 A;  1Y0U A;  1AKH A;  2OQR A;  1ZGW A;  1RIO H;  3BDD A;  1YS6 A;  4HW0 A;  4BHB A;  4R79 A;  2BW3 A;  3BG7 A;  3LSH A;  4HX8 A;  4AID A;  2O3F A;  5EG0 B;  4LIT A;  4DJA A;  3TDU C;  4XLA A;  1D8J A;  2XSD C;  4G6D A;  3IKT A;  1G3W A;  1SC7 A;  5D8K B;  3GVA A;  5E79 C;  1A35 A;  1KU9 A;  2PQ8 A;  4YII A;  4II3 A;  3CCE I;  4ZTJ A;  5ERI A;  2WAD A;  2OV7 A;  3K70 C;  3GWZ A;  1ITY A;  1ZK8 A;  2X1C A;  1T33 A;  3G4S I;  3EYI A;  4A0Z A;  4B47 A;  3JAM K;  2HU9 A;  3FXO A;  4MTD A;  4E7L A;  4BDZ A;  1XCV A;  3R61 A;  3BJA A;  3ROU A;  1CGP A;  1IN4 A;  2HOA A;  2CQX A;  3EQL F;  3IAS 2;  4O3M A;  3K10 A;  2KDZ A;  4M3G A;  5FKN A;  2LK2 A;  3GTK J;  3IKV A;  3ZQH A;  1SD7 A;  2VIX A;  2UZK A;  2F5C A;  5DCM A;  2VJ5 A;  1RR8 C;  3HHH A;  2PMH A;  3RCO A;  4KIG A;  5ILS A;  2QBY B;  2KRC A;  1CF7 A;  3N05 A;  1I6X A;  2HR3 A;  5LLQ A;  1D0Z A;  2DI3 A;  4S05 A;  4MQV A;  3TQN A;  1V5E A;  3K4J A;  4EM2 A;  4DYR A;  3HL2 A;  3FMR A;  2FOK A;  4AYB A;  2Y30 A;  2R5Y A;  1YTY A;  2P81 A;  4Y7N J;  3PO3 J;  3K4L A;  2X1E A;  2CMP A;  4L5I A;  1IF1 A;  1IN6 A;  2GXG A;  3GXO A;  2E34 A;  1S7A A;  5CVV A;  3IAM 2;  3U9G A;  1OIS A;  3H9G A;  3ZQI A;  2NS8 A;  3L2V A;  4Y17 A;  2ESN A;  3RI4 A;  2RRE A;  1OCP A;  5E18 F;  2V4J C;  4A93 J;  5EZH A;  3F6V A;  3HEF A;  1MND A;  1UZC A;  1G3Y A;  1Z7L A;  3D5R C;  2FEZ A;  5BOX A;  4O5V A;  1R6R A;  2VKH A;  4I0B A;  1JGG A;  2QUF A;  3K4B A;  2M1B A;  3L2C A;  2EZL A;  1BR2 A;  2K9Q A;  3PIO F;  2KIQ A;  4XSZ F;  3FXK A;  1JT0 A;  2XV4 S;  4NDL A;  5EDN A;  1S3J A;  2E35 A;  3DEU A;  3KIO A;  4KT6 A;  1K4S A;  2XGC A;  3W3C A;  2AS5 F;  4Y15 A;  1DPU A;  3CP2 A;  3WG7 H;  4H0E A;  1I39 A;  3I0T A;  1Z05 A;  2ME6 A;  1OR7 C;  1AOY A;  1STZ A;  4P96 A;  3KCC A;  1Y8R B;  2DAO A;  4B09 A;  5LGT A;  4RB2 C;  4A3I J;  4L0Z B;  2ZNY A;  3H9J A;  3K1P A;  1J75 A;  1MBG A;  4JK1 X;  3N97 A;  1T56 A;  4BBR J;  3MQ0 A;  2A61 A;  2CV0 A;  2E1M B;  2DBB A;  2ZKZ A;  4U0V A;  2H6C A;  3CC4 I;  2R7V A;  3E6C C;  1H88 C;  1UMQ A;  2JUG A;  4ZDL A;  1W36 D;  3CCM I;  3K7A J;  2MSY A;  3OYD A;  2E7X A;  3BQY A;  3OYF A;  1QNT A;  1SVO A;  3PL8 A;  1KON A;  2LKX A;  3AL0 C;  1MGT A;  1MZB A;  2M45 A;  1BI0 A;  3RYR A;  3BG3 A;  2EV5 A;  1MJB A;  4LK0 F;  2YX7 A;  4PSW A;  1ZEL A;  4JX5 A;  4G7H F;  1ZTR A;  1WQ2 A;  1R22 A;  3PNY A;  1TQI A;  5LD2 C;  5DYM A;  3F72 A;  3H0G J;  4CO8 A;  1BOB A;  3VOE A;  3QRF F;  2CV2 A;  2IBD A;  1OR7 A;  4YIF A;  2EWN A;  2ZJP F;  2R92 J;  3MZH A;  3FM5 A;  2X51 A;  2K27 A;  2FQ3 A;  1YG2 A;  3QYB A;  3P9K A;  2VJI A;  2ACJ A;  3IRR A;  3JRI A;  4RAG A;  1FTZ A;  3KP7 A;  2E60 A;  3ZCO A;  2K40 A;  1IXC A;  2O03 A;  2YPR A;  4A3F J;  2KMU A;  3LA2 A;  1SD4 A;  4NQW A;  3LWF A;  2W48 A;  2DYR H;  3BZ6 A;  5LEK A;  1HXD A;  4I09 A;  3IV5 A;  4BY7 J;  3VSL A;  1SAU A;  3HPH A;  4BHC A;  3AKZ A;  4M3F A;  4I99 C;  4D7N A;  2FNA A;  2LLK A;  3PSF A;  2JRT A;  2VKD A;  5FGM A;  5HLI A;  1BL0 A;  4EM0 B;  4U7B A;  2LBF B;  2M5W A;  3E6B A;  4Y52 J;  4IO9 F;  5DEQ A;  1ETV A;  2GQQ A;  3OMY A;  3J80 Z;  3G1L A;  3SFI A;  4QIW N;  4KIB A;  2DOA A;  2W1O A;  2PJP A;  3BR2 A;  2A5Y B;  4C2T A;  4LOC A;  5C4X J;  3D1N I;  1WCM J;  2JSC A;  3VEP A;  2CH0 A;  2Z3Y A;  4MFD A;  4CZC A;  4G12 A;  1X2M A;  5D5X B;  1MJA A;  3HB9 A;  1WJB A;  3TP3 A;  2RN7 A;  2X85 A;  1U2W A;  1YOV B;  1A36 A;  1WH7 A;  2DPU A;  2YSR A;  3H3V K;  2QCO A;  1IXS B;  2EFN A;  2FD5 A;  2XAG A;  1ENH A;  4HQE A;  1KGS A;  3D0S A;  5J4Y A;  1T8I A;  1X1C A;  1TWA J;  3WOD F;  4ANJ A;  2CUE A;  3PJR A;  1CQT A;  5AIQ A;  3I3L A;  3QPH A;  5F1J A;  2P0W A;  3VDX A;  5JVG F;  3WTU C;  3RPQ A;  1FJL A;  2O6G E;  1RUN A;  3G1M A;  2NOJ B;  3S1N J;  3ZXS A;  2QSG X;  2E2H J;  2DFF A;  3MKL A;  1W7P B;  4CCO A;  2EJR A;  2I5U A;  4E4H A;  2RC4 A;  1RR7 A;  3SEQ A;  1BM9 A;  2XPV A;  5K7H A;  1S8N A;  2EFO A;  3E0J B;  1R23 A;  3LOC A;  4Y4R A;  3GZ5 A;  3V8K A;  1X4P A;  5D6E A;  3PUF A;  1B9N A;  3CUO A;  3WU0 A;  2DK8 A;  4QTR A;  1BI3 A;  1RKW A;  1O57 A;  1SMT A;  1IDY A;  2LKP A;  1QHG A;  3SXY A;  3F8F A;  4A6E A;  4UNO A;  4AM3 A;  2DO7 A;  3KYC B;  1T95 A;  3K1N A;  3QU6 A;  5HS8 A;  2F5F A;  4QSH A;  4MNU A;  3CO7 C;  2K5C A;  1V5G A;  2COB A;  1Y1V J;  4OU0 A;  5DUK A;  3ZMV A;  2E5Z A;  2HS5 A;  3RTR A;  2GOX B;  2CFX A;  4F52 A;  4ON0 A;  3JRE A;  3ZMZ A;  4KFC A;  3J7A Y;  3FM3 A;  2Y0M A;  4BJ5 C;  3BR0 A;  3M07 A;  4A3B J;  4JX6 A;  3K6G A;  3GF2 A;  3MN2 A;  3LSI A;  1W36 C;  1JUS A;  4BEH B;  4DBR A;  1OCT C;  2FQ4 A;  4EJO A;  1HKT A;  1IN7 A;  2A68 F;  1E3P A;  4L18 B;  4UVC A;  2VPR A;  3IUO A;  2IA1 A;  2R5Z B;  4L9T A;  1TQP A;  3MFK A;  1IXR C;  4N0B A;  4D0P A;  3CDI A;  1N78 A;  2R7T A;  2HI3 A;  1GHC A;  2HKO A;  2KQR A;  2L7K A;  1BJZ A;  2CFO A;  1IO2 A;  3WTZ A;  1WVR A;  2CW7 A;  2XC7 A;  2GM4 A;  1VZ0 A;  3DTI A;  3EDP A;  4K2E A;  4V2F A;  4KIC A;  2OU2 A;  5LEJ A;  4EJT A;  4C2M J;  2OZU A;  5L3G A;  3U1K A;  1BR1 A;  2RQP A;  5FLV A;  1G6N A;  4DIQ A;  2STT A;  3FK7 A;  1MH4 A;  2XPW A;  3QAH A;  4B8X A;  2P4W A;  3NWT A;  2QVO A;  1ZRE A;  4WF2 A;  3B6C A;  4ZZL A;  2LSO A;  5CQG A;  5CVU A;  2EIJ H;  1BI2 A;  2HQA A;  4Q48 A;  3E5Q A;  2ZFU A;  1R71 A;  2D5V A;  2V9V A;  2Y2Z A;  5ICC A;  1FLI A;  2VBX A;  2E2J J;  1LFB A;  4D7M A;  3DKX A;  2MD0 A;  2CO5 A;  5HS9 A;  3A03 A;  5FFX A;  1B4A A;  4HNV A;  4A5M A;  4MLO A;  3SZP A;  3H5N A;  3RIR A;  3D5L A;  2BV6 A;  5E1W A;  2GIV A;  4PDK A;  3HUG B;  2Z99 A;  5CPR B;  1DP3 A;  3ECH A;  1D0Y A;  3G73 A;  3KX2 A;  4UV9 A;  2KJB A;  1RZ4 A;  4GCV A;  3CJR B;  3H0D A;  2KJC A;  2HVR A;  3OYJ A;  4X6A J;  4EJU A;  4H4K C;  2PBI A;  2BXY A;  2E1O A;  2I10 A;  2ME0 A;  5D4R A;  1WH5 A;  4ASN A;  1N77 A;  1XS9 A;  3CP8 A;  2J5O A;  3Q0W A;  1YIT I;  1WKM A;  2O0Y A;  1JE8 A;  3TED A;  3CLQ A;  5DM6 F;  3KP6 A;  1FY7 A;  4OMZ A;  3F0C A;  5IT3 A;  1FT9 A;  1S72 I;  3PO2 J;  1ETX A;  4FIS A;  1WJF A;  2K9N A;  1UG0 A;  4U0W A;  1E3H A;  2GIZ A;  5LGN A;  3CMA I;  3BY6 A;  5F04 A;  2DJN A;  4L9N A;  4YFN F;  2DA7 A;  2NNY A;  1EH7 A;  4BY1 J;  4CDG A;  1LEA A;  3AAF A;  4A3J J;  3A2K A;  2IGK A;  1KYZ A;  4XRS A;  5LHG A;  5KVR A;  5IT9 Z;  5GTH C;  2A5W A;  4RM3 A;  4EQQ A;  1NK3 P;  2EFW A;  2OTL I;  3FMS A;  2ZJQ F;  3IHU A;  1OFC X;  4BHP A;  3J7A O;  4AIK A;  3LFU A;  3BZK A;  2LRE A;  2DJI A;  2ID6 A;  4KIT B;  1IRZ A;  3IH3 A;  2DFI A;  2XAS A;  1F43 A;  1ONV A;  3O3K A;  2PX9 A;  4DOZ A;  1I3A A;  1WJD A;  3J80 K;  1OCR H;  2W25 A;  4XLE A;  4XK4 A;  1W1W E;  1XG1 A;  4LD5 A;  3HRT A;  3EUA A;  5L3F A;  2A05 A;  3ASN H;  4A3E J;  4M6V A;  1JKO C;  5GPC A;  2H1L A;  1A31 A;  1X1D A;  4RGS A;  5E3O A;  3CDL A;  4E7S A;  1H89 C;  3BZC A;  1PUF A;  4I2O A;  3OSF A;  2YU9 J;  3LAP A;  3KEQ A;  4IEJ A;  2KHM A;  1KA8 A;  3W2A A;  2LFB A;  3EUH C;  4FX0 A;  4ENM A;  1IJW C;  5HS7 A;  3ZQ7 A;  4YEL A;  2RVC A;  2YUS A;  2Z1D A;  1OCO H;  2QA4 I;  1HW1 A;  2VQL A;  3KYL A;  5A2Q Z;  5GTI C;  1P7J A;  1DGW Y;  2IAI A;  2P6T A;  3S93 A;  2IGN A;  3K4N A;  3M1E A;  2EPF A;  3FXJ A;  4W1U A;  3DPL C;  1D1B A;  2NVU B;  1JKQ C;  2H8R A;  2QEX I;  2B0L A;  1JI8 A;  2P5L C;  4P9F A;  2QQ9 A;  3V8L A;  2NXN B;  4LFU A;  1HQC A;  4KIS A;  1K7A A;  3CJT B;  4WWC A;  2DMT A;  1RNL A;  2W84 A;  2LP0 A;  3RJP A;  3V8J A;  3KLO A;  2Z33 A;  4WXC A;  3I59 B;  1G4D A;  1G3S A;  4BXU A;  4HZF A;  2Y48 A;  2IS4 A;  3JTG A;  1ORK A;  2MGQ A;  1R7J A;  4XRS G;  4DYQ A;  2C6Y A;  1XGM A;  4LG0 A;  3TDZ C;  4Q5S F;  4Z6Y A;  3LSG A;  3GYH X;  3DLL F;  4CYC A;  3DP7 A;  3BTL A;  3CF5 F;  4KN4 X;  2Q2E B;  5ICE A;  5F6F A;  4KYW A;  2HYF A;  1ZR4 A;  2E1C A;  1BW5 A;  1S7E A;  1YIO A;  2ZXI A;  2FUG 2;  1DGR M;  3OOP A;  1J9I A;  1X3Z B;  2KIU A;  1R4N B;  3TW6 A;  3GTG J;  3JRG A;  3VWB A;  4P9U A;  3BTI A;  1G8X A;  3S32 A;  1W4M A;  3DKY A;  3KEO A;  1U6G A;  2OTJ I;  4BAC A;  1SVM A;  1X1B A;  4R1H A;  2BEO A;  5CVJ A;  1XMK A;  2F6C A;  5JI6 A;  4ZYE A;  3IL2 A;  2PMZ N;  3EUH A;  3TGN A;  1DU6 A;  2CQ7 A;  1T0F A;  2OA4 A;  2E19 A;  3QPS A;  3O8H A;  4A2U A;  1KZH A;  3COA C;  3FDY A;  1B8I B;  1XGN A;  2PMZ A;  4BJ6 C;  4XKC A;  1EA3 A;  1Z91 A;  3HOV J;  3QOP A;  2KFD A;  3TOA A;  2M4G A;  3WTY C;  5EGO B;  4CH7 A;  3ABL H;  1JKR C;  1O3R A;  2NYX A;  4V19 K;  3KP2 A;  1QBJ A;  2UWM A;  1OPC A;  1HLV A;  1GUU A;  1L3L A;  3LSJ A;  2AHQ A;  1BIB A;  2AO9 A;  3P5J A;  1RET A;  1LPQ A;  4WX9 A;  2QZ8 A;  5B66 C;  2WAE A;  1D5Y A;  9ANT A;  3TBI A;  5KCM A;  3V7S A;  3U2R A;  2XRO A;  2CQK A;  1J59 A;  2A6T A;  1ACI A;  1LE8 A;  2L9N A;  1U5T B;  3DBL B;  4IJA A;  5F64 A;  1V55 H;  4B3A A;  4UUS A;  1ON2 A;  2PJR A;  5JVT A;  3L2W A;  1AKH B;  4NC8 A;  3KP5 A;  2V9K A;  3BR3 A;  2Q0O A;  4B4C A;  1Y56 A;  2BW3 B;  2R4G A;  1QGP A;  3ZP5 A;  4KUM A;  3C2H A;  3NEU A;  2JA8 J;  3OV8 A;  1MH3 A;  3JRD A;  3MVP A;  1PVE A;  3MCZ A;  4UXN A;  3CD6 I;  4PGG A;  1U8R A;  1LJ9 A;  2RQQ A;  1QRY A;  4YEJ A;  1Z6R A;  3HHG A;  2R7Z J;  5EEG A;  1IRX A;  1K4T A;  5J1U A;  5CVI A;  1JTY A;  4PUS A;  2GXB A;  2K4J A;  3HSE A;  4MHG A;  3L09 A;  5F27 A;  2QYO A;  4QLC U;  2DMN A;  1P92 A;  3R4K A;  2E5N A;  5BNG A;  3PIP F;  4L9J A;  4MO7 A;  2QKM B;  1ZLK A;  1T98 A;  3F21 A;  1W5C C;  1VI0 A;  3HIF A;  3OIP A;  4BU2 A;  5F0H A;  1FYM A;  1OJL A;  1ZLJ A;  4BXF A;  1FWZ A;  2PEX A;  1OMI A;  3CUQ C;  3WGH A;  1NG6 A;  1WWX A;  2V79 A;  3N4M A;  3WTX C;  2H27 A;  5K7F A;  1YJW I;  2O9L A;  1ZRD A;  5DCM B;  3CDH A;  2FBI A;  4CCL A;  4RB1 A;  3ZMS A;  4KA4 A;  3A01 A;  5J4V A;  2XGX A;  2A6E F;  2D2W A;  3FF5 A;  2YS9 A;  3WTS C;  2LNB A;  2IJL A;  2DK5 A;  4BE2 A;  1MMG A;  2RNG A;  3ULQ B;  4MEX F;  4DYC A;  5BQT A;  2M8E A;  3BWG A;  2O7O A;  3ZR8 X;  1ETK A;  1X1P A;  2R7R A;  4M6X A;  4PJJ A;  3DQV C;  2GA2 A;  2R5Y B;  3PUB A;  4ESJ A;  4PFO A;  2AQF A;  2UUZ A;  3A02 A;  2LOO A;  4XLC A;  1TT0 A;  2QM3 A;  3GLL A;  2HVQ A;  2WY8 Q;  1SFO J;  1Z3X A;  2V1U A;  3BTJ A;  2JJ7 A;  5HDK A;  4DGW B;  4AYB N;  1X58 A;  2ZME C;  3F6O A;  1JUM A;  1R36 A;  2KZG A; 
#chains in the Genus database with same CATH homology
 4IHW A;  3IV5 A;  4BY7 J;  4RBO A;  3S17 J;  4M3F A;  2HOT A;  3HGG A;  1Q1V A;  2EZH A;  2RAE A;  4D7N A;  2LLK A;  1BA5 A;  2R0Q C;  1MBF A;  3WHC A;  2Y9Y A;  3BR5 A;  1BL0 A;  2VKE A;  3E7L A;  4B1R A;  4RDU A;  4Y52 J;  4BXX J;  3JR9 A;  5E3L A;  1QVU A;  2NVY J;  1ETV A;  4EEF G;  1VND A;  2CQQ A;  3G1L A;  3SFI A;  4QIW N;  5E3N A;  5C3E J;  1ZKG A;  1LFU P;  4C3I J;  3BR2 A;  4LOC A;  5C4X J;  1UG2 A;  3D1N I;  1WCM J;  1E3O C;  1TWH J;  5IYC J;  1MSE C;  2JA5 J;  2LVS A;  3ZOB A;  4UUS B;  4MFD A;  2EH3 A;  2HXO A;  3BG9 A;  1H8A C;  4G12 A;  2N8G A;  1X2M A;  3SJM A;  1APL C;  2E2I J;  3HB9 A;  3IH4 A;  2CU7 A;  3TP3 A;  2MW8 A;  4A69 C;  1B72 B;  1WH7 A;  2ECB A;  5FKM A;  3H3V K;  2QCO A;  3S1R J;  2FD5 A;  1ENH A;  3BQZ A;  2TCT A;  1F36 A;  2X48 A;  5F08 A;  3RZO J;  3BR1 A;  2O8K A;  1TWA J;  2CUE A;  1RPW A;  1CQT A;  1VF9 A;  2FX0 A;  5F1J A;  1TWF J;  4GFB A;  1U9N A;  4X1E A;  1FJL A;  5GP9 A;  3FK6 A;  3GTM J;  3G1M A;  2DA4 A;  3GTL J;  5FKO A;  3S1N J;  3FIS A;  3S2D J;  2HOS A;  4V2G A;  4FTH A;  3K2A A;  5FJ8 J;  2WB1 N;  3RKQ A;  1GDT A;  2E2H J;  3MKL A;  4JP0 A;  1EF4 A;  2Y9Z A;  1JJ6 C;  1SAN A;  4A3L J;  1ETO A;  4IHV A;  2CJJ A;  3TP0 A;  1RR7 A;  3LSP A;  1JJ8 C;  3JRH A;  1ZR2 A;  2XPV A;  5K7H A;  1JKP C;  1JTX A;  1TWG J;  3HOU J;  3LOC A;  5M5Y J;  2HDD A;  3DCF A;  1JUP A;  3I4N J;  3Q0U A;  3A01 B;  1MBK A;  4QTR A;  1MBJ A;  1RKW A;  1DU0 A;  5IP6 A;  2FJ1 A;  2OF7 A;  1IDY A;  2EQR A;  5E3M A;  4QSH A;  1IC8 A;  5HOD A;  3I4M J;  4I76 A;  2LTP A;  2COB A;  1Y1V J;  2MG4 A;  2XB0 X;  4UUT A;  2HYJ A;  3HGY A;  3JRE A;  1MBE A;  1WPK A;  4FE4 A;  3BR0 A;  4I6Z A;  3JRC A;  2XGD A;  4A3B J;  4JX4 A;  3WHB A;  4JX6 A;  2ECC A;  1I6H J;  2TRT A;  3MN2 A;  1JUS A;  3NAU A;  4DZP A;  3HOY J;  1OCT C;  3FIW A;  2FQ4 A;  4M3D A;  5IOY A;  2CRG A;  2VPR A;  1HDD C;  2R5Z B;  4BKX A;  3GTQ J;  1XC5 A;  4XIC A;  2K9S A;  4MIM A;  2HI3 A;  2OPT A;  2JA6 J;  1ETQ A;  1HOM A;  2WV1 A;  1BJZ A;  5JLW A;  5EG0 A;  3GTP J;  2HXI A;  2GM4 A;  5J1R A;  1IV6 A;  1U8B A;  1FIP A;  3GTJ J;  4V2F A;  4A3M J;  3BTC A;  1R9T J;  1POG A;  3FKI J;  2DA1 A;  2Y31 A;  1WGX A;  4C2M J;  3O8G A;  3JRF A;  3HDD A;  4BBS J;  2H1K A;  5FLV A;  2XRL A;  5C4J J;  3CCY A;  2VUM J;  1G2H A;  3FK7 A;  3HOW J;  4J19 A;  1MH4 A;  2XPW A;  3TW7 A;  1O4X A;  3S1M J;  4JYK A;  1IGN A;  2VI6 A;  3B6C A;  3OSG A;  2VKV A;  4M3B A;  3BT9 A;  1A6I A;  5M5X J;  3JRB A;  2D5V A;  1MSF C;  2Y2Z A;  1LE8 B;  4FCY A;  1W0T A;  2NS7 A;  5IOZ A;  5EYR A;  1LFB A;  4D7M A;  3Q0V A;  2DN0 A;  2E2J J;  1Y1W J;  4IHX A;  4IHY A;  3M4O J;  3A03 A;  4HNV A;  3DEW A;  4A3D J;  4MLO A;  4A3G J;  1JT6 A;  1FEX A;  1NTC A;  1YRN A;  3HKZ N;  5FKK A;  5DTD A;  2X9D A;  4W97 A;  4X6A J;  2XGE A;  3L1P A;  2E1O A;  2I10 A;  2ME0 A;  2L7F P;  1WH5 A;  2DA5 A;  2EBI A;  2JK3 A;  1XS9 A;  3Q0W A;  1HCR A;  2B63 J;  3TED A;  2DA3 A;  4C3J J;  2LD5 A;  3F0C A;  1UHS A;  1B8I A;  3PO2 J;  1ETX A;  4FIS A;  4DZJ A;  2DMU A;  2K9N A;  3QQA A;  3C2B A;  4AC0 A;  3NAR A;  5EGO A;  3HBL A;  5F04 A;  2DJN A;  1QPI A;  2DA7 A;  4BY1 J;  2NVT J;  2JN6 A;  4A3J J;  2XPU A;  3S1Q J;  1MBH A;  4XRS A;  2DMQ A;  1X2N A;  3IH2 A;  1NK3 P;  1BW6 A;  2GBY A;  5M3M J;  3HOX J;  1OFC X;  3LSR A;  3RQI A;  5IP9 J;  2M2E A;  2ID6 A;  1IRZ A;  3IH3 A;  1RES A;  5EZG A;  1QVT A;  1F43 A;  1AKH A;  1ZGW A;  1A5J A;  4XK4 A;  1XG1 A;  3JRA A;  4FE7 A;  5EG0 B;  3B6A A;  4A3E J;  4M6V A;  1JKO C;  2R93 J;  5GPC A;  3S14 J;  2ZB9 A;  5E3O A;  3CDL A;  1FIA A;  2XSD C;  1H89 C;  1PUF A;  1U78 A;  3PM1 A;  3OSF A;  2YU9 J;  4IEJ A;  2M9H A;  3QPL A;  2LFB A;  1IJW C;  3M3Y J;  1GV2 A;  2DTZ A;  2YUS A;  4S0H B;  1RKT A;  1ITY A;  1ZK8 A;  1T33 A;  2GLO A;  1P7J A;  2IAI A;  3S16 J;  4W1U A;  1JKQ C;  2H8R A;  1GV5 A;  4M3E A;  1W0U A;  4XID A;  2HOA A;  2CQX A;  2DMP A;  1ETW A;  1U9O A;  2KDZ A;  4M3G A;  5FKN A;  5EF6 A;  2LK2 A;  3GTK J;  2DMT A;  3ZQH A;  2LP0 A;  1K83 J;  4L5E A;  5M3F J;  5EEA A;  3GBG A;  1TC3 C;  3SDG A;  1ORK A;  2MGQ A;  4AUX A;  1IDZ A;  4XRS G;  2KT0 A;  4DYQ A;  3LSG A;  2DA6 A;  5GPA A;  4CYC A;  3BTL A;  4DYR A;  1YRN B;  1ZR4 A;  1BW5 A;  4ABZ A;  1S7E A;  2R5Z A;  2R5Y A;  2Y30 A;  3CMY A;  1MNM C;  3TW6 A;  1P7I A;  2JMW A;  2M34 A;  2P81 A;  4Y7N J;  3GTG J;  3JRG A;  3PO3 J;  5M5W J;  3BTI A;  2M8G X;  2NVX J;  3HOZ J;  2JA7 J;  5C44 J;  2Y0S N;  2QF7 A;  5F0C A;  2EZI A;  2PMZ N;  3ZQI A;  4DW6 A;  1DU6 A;  2NS8 A;  2E19 A;  2IEK A;  3QPS A;  3O8H A;  5IP7 J;  1Z0X A;  3G1O A;  1AU7 A;  1B8I B;  3GTO J;  1OCP A;  3HOV J;  4A93 J;  5EZH A;  3HEF A;  5EGO B;  1JKR C;  2EZK A;  2JWT A;  1JGG A;  1WI3 A;  2ELK A;  1HLV A;  1GUU A;  1NK2 P;  3LSJ A;  2AHQ A;  3W6V A;  2AO9 A;  1RET A;  2EZL A;  2K9Q A;  3BR6 A;  1JT0 A;  1HF0 A;  2G0E A;  5J3L A;  1D5Y A;  4NDL A;  5IYB J;  9ANT A;  5EDN A;  4C3H J;  4A3K J;  5IPA A;  2XGC A;  1LE8 A;  2X6O A;  4B3A A;  4UUS A;  5JLX A;  3LNQ A;  2ME6 A;  2LY9 A;  5J1Y A;  3VPR A;  1AKH B;  3BR3 A;  3ZQC A;  3RZD J;  4A3C J;  3OIO A;  4B4C A;  4A3I J;  1B72 A;  1I50 J;  2JA8 J;  4MFE A;  1MH3 A;  3JRD A;  3MVP A;  1MBG A;  5K7Z A;  1GT0 C;  3CQZ J;  1PUF B;  1QRY A;  2L7Z A;  1T56 A;  4BBR J;  5IYD J;  2R7Z J;  3ZQG A;  3ZQF A;  5J1U A;  3ZQL A;  1JTY A;  1ETY A;  2WAQ N;  5F27 A;  2DMN A;  4XRM A;  5FKL A;  1H88 C;  3S2H J;  5BNG A;  1UMQ A;  4MO7 A;  3K7A J;  1IUF A;  2MSY A;  2L0K A;  5F0H A;  1VI0 A;  3BQY A;  1OJL A;  3HM5 A;  1AHD P;  2LKX A;  3S15 J;  3BG3 A;  3UKG A;  5K7F A;  5F0F A;  2O9L A;  1TWC J;  4D5C A;  1Z77 A;  4JX5 A;  3A01 A;  3BG5 A;  1ZTR A;  2ID3 A;  2NOG A;  2YS9 A;  3Q3S A;  4CYC B;  4D5F A;  4DYC A;  3H0G J;  1GVD A;  2O7O A;  1K61 A;  1ETK A;  2HQ5 A;  2IBD A;  2NVQ J;  2LR8 A;  5FLM J;  2R92 J;  2R5Y B;  1HDP A;  2M0C A;  1I3Q J;  2DA2 A;  1IG7 A;  3A02 A;  3JRI A;  1FTZ A;  1SFO J;  2CUF A;  1VFC A;  2K40 A;  3BTJ A;  2JJ7 A;  2XB5 A;  4A3F J;  5DS9 A;  4AYB N;  1ZQ3 P;  3OOU A;  1X58 A;  2L7M P;  1FTT A;  2L9R A;  2W48 A;  1JUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...