5EHDA

Crystal structure of human nucleophosmin-core in complex with cytochrome c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
PQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human nucleophosmin-core in complex with cytochrome c
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Nucleophosmin
total genus 14
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H, I, J, a, b, c, d, e, f, g, h, i, j
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 5ehdA00
1XB9A 1NLQA 4CA9A 1K5JA 1XE0A 5EHDA 2VTXA 4N8MA 3T30A 2VTXJ 2P1BA
chains in the Genus database with same CATH superfamily
2DFBA 2QQNA 3ZYBA 1C8NA 2EXHA 3LDRA 4NMIA 1HIXA 1LRHA 3VDDB 5FYCA 4UWDA 1G8WA 2KD7A 5T5LA 1WD3A 4QPIB 2EXJA 2WAAA 4KMQA 1AR71 4NRMA 1GZTA 3B94A 4FTBA 1YCIA 3NV4A 5FXWA 3WT3A 1FMD1 2RS51 3OYWA 4AI3A 4YNIA 4Y24A 3KF5A 4N90A 5FP4A 3MIHA 3MGUA 4JDMA 3CMGA 1XSRA 1CESA 2WFPA 1FPN2 2J42A 4JHZA 4IGOA 4WM7B 1GQHA 4CDUC 4E2SA 1AR61 2IWGB 3VBUC 2VOVA 4ES8A 3POFA 2VMEA 2ZGOA 5FYVA 4XYXA 1E57A 3DL3A 4OQ9A 4XJ8A 3A7QA 4IV3B 4FQ4A 2OKXA 4YARA 2OX0A 3TEZA 4WZFA 1ZZ7A 4LLOA 3MFCA 3MI8A 4E8DA 1S1AA 4BISA 1POV1 2E9QA 1OUXA 3CJIA 3JUUA 3S7IA 1W3VA 1GNYA 4GKXA 4IEYA 2WN2A 1GANA 1TEIA 2RDRA 3APBA 4CEYC 1V6JA 2GP5A 3O1VA 2VZQA 1NA1C 1U5IA 4DB5A 4Q0UA 3NMBA 4I30A 3K3OA 3LFMA 3RJRA 3OGSA 4A6OA 3IB3A 2D3SA 3QCWA 2NQYA 3R0RA 4TZDA 1OFNA 4XF0A 2DVDA 3WW4A 4YSFA 2N7GA 2NMOA 2DCYA 5I0SA 4IGQA 2FZ1A 3EBRA 4WM8A 4AEDC 5IVYA 2WWJA 4HKOA 1AL22 2A3XA 2YFUA 1VAMA 5B4NA 4YM1A 4NIDA 1F5FA 3ZFGC 3LIHA 3RQ0A 1QOOA 4Q4W1 1DQ2A 1RUG3 1H2LA 2BW8A 2J1VA 1XSQA 2HWE1 3PUAA 3VKFC 3WCSA 4Y1VA 5JOZA 2L9LA 3N9LA 1FOD1 2VW0A 3H50A 4E4SA 3DXTA 5CB7A 5FKBA 1MZEA 1W2TA 2PLV1 3MW3A 3CF6E 5F5CA 4LK6A 3ALQA 4CEWA 2VVEA 1RUF2 1TNFA 2W92A 2WNVA 5DMYA 2MNGA 3WSOA 4Y4RA 1Y9QA 5BNPC 1D2QA 1UMIA 3GDBA 5FIXA 5JVVA 3ZYFA 2JB8A 1Q8OA 4R52A 3LDBA 2GNTA 2CU5A 3A23A 4PIYA 2D6OX 4BDVB 2A6VA 2OPWA 1EPWA 4Q4X2 1UD1A 3OB8A 4MSVA 3M3OA 4L9BA 4Y20A 5L9BA 4PQQA 1PK6C 3AVSA 5FJHA 3TOJA 1POV3 5FDBA 1JYXA 2Y33A 3ZO0B 3SCGA 3F95A 2PHUA 2A73B 2B5HA 1OA2A 2VU9A 4PHZA 1GOGA 4QGLA 3KVBA 2TEPA 1FNZA 1OF4A 1S55A 2DCZA 2DU1A 4P9GA 4QHBA 1WLCA 2HWC1 3WDWA 5C70A 5LY1A 4BYYA 3ZXDA 1X7NA 3SCFA 2DFCA 3CJXA 1MPXA 3OGGA 1TG7A 1REEA 5EV7A 1RUH1 1F15A 1YUDA 3HQUA 2LTNA 3NWKA 2FMDA 3WHTA 1SDWA 1YI9A 5FYHA 4H14A 5IVVA 3PTRB 3THDA 4XDQA 3DGTA 3NRUA 2P37A 5A6XA 3FHAA 4AVCA 2YC0A 2RR11 2Y6LA 5FOBB 3EMRA 2VZRA 1AHSA 4NIHA 4LHKA 4XPVA 2Y34A 4YFWA 3AZWA 1V6KA 3ASIA 1R093 4Y5Z0 5JI7A 4S2HA 3UK9A 4AF9A 5F9TA 4QXCA 3JQWA 4X8PA 3GNEA 4NUBA 1P8JA 3FN9A 5FJKA 3NV3A 1OLME 1IQAA 1LOAA 4M3CE 2UY9A 4ONUA 1NXD1 3BODA 4B8EA 3RPQA 2CAVA 3CQOA 4LPLA 3OD4A 1JYIA 1D4M1 5IK4A 1GP5A 2VTXJ 1Z7S3 4JGZC 1JTZX 3GBGA 4JDNA 4XDOA 2VXRA 1CJPA 2C26A 2I74A 2E26A 1RC6A 3OUIA 4OI4A 2Q8OA 2DVAA 4XIKA 1F2NA 2XJRA 1AL23 3B69A 5DDJ3 4MH0E 1GSLA 2VVDA 3H3ZA 1TME1 4DIQA 4BWOA 1XXNA 5CFCB 4AFCA 3MLKA 1KJLA 4AI1A 5BY5A 2LALA 2D5FA 2KXLA 3LF7A 4XE9A 3GJBA 4M4PA 2VC9A 5JLVA 3I2OA 2D7FA 2XONA 5LW9A 3DKQA 5JOWA 4K1YA 2JDUA 5CYYA 1XPWA 2QZ3A 3H3UA 4P9WA 2Y8KA 3AL6A 4HKLA 2VCCA 3T1LA 4PBOA 5EZWA 3TEXA 4BK5A 3AJYA 1PM7A 1RUOA 1QQP1 2WINB 4JQRA 2BVVA 4AXOA 2BBVA 1NZIA 2Q0AA 2J22A 1U5YA 3FFQA 3PL0A 4A7ZA 4PI2A 3H8UA 3O1SA 5BXXA 1TZOA 1QKQA 3D8CA 4DFSA 1RUJ2 3OSDA 1IPKA 1HDKA 5LK5A 2VO5A 3O0WA 5FPAA 5F7UA 1LGNA 4MVTA 2VCAA 4G4FA 1D0HA 5CU1A 1JOPA 3VDCA 5GKAC 4AG4A 3LCPA 4HKWA 1OF3A 5AVPA 1QGLA 1H30A 4FPEA 5LZ6A 5KR7A 4LBQB 4EWDA 2JG8B 5IK5A 1UZVA 4AFBA 2VR4A 2VMDA 3HNBM 1CONA 1Q43A 4I09A 1CIYA 4UBHA 4X6RB 5LBEA 3WX5A 3SXWA 4NHYA 2ZMNA 4LBMA 1RUNA 3ZOIA 4IE7A 2VM9A 3AMQA 3Q8AA 1H6XA 3KMHA 4UBGA 4IV3C 2E32A 2ZTNA 3R05A 4QKBA 1OOPC 4GH4A 1UXZA 3A0KA 4IL7A 1F35A 2HWF2 2G1MA 4WVZA 3OGRA 2CV6A 1DP0A 3LAGA 4GD4A 4XMAA 2XR4A 5CVRA 5IYYA 1O4YA 2VL4A 1W28A 1LESA 4H3WA 1V9U3 2FCTA 5I8YA 2B42B 4ATEA 5J1XA 3B5LB 2AACA 4YM2A 5LA2A 1W6PB 5A1FA 1MS9A 3AZXA 1O4TA 1UZYA 4FP2A 4Q4X1 2R0FA 5ERLA 3SKVA 1GR3A 4A41A 1Q8SA 3WF3A 3WP5A 2WQZC 4EN6B 2MEV1 2W3JA 4AAPA 2YMZA 1AR81 4XAEA 4UF0B 1B35B 4E4ZA 1NQJA 1WMFA 1IS3A 5IVBA 3QLQA 4WM8C 2HWD2 4AEDA 3GHMA 4IEZA 4OHWA 3GHNA 5BNPB 4AQ6A 4Z1VA 4MOAA 4HK8A 4XTMA 3ZN4A 2CHHA 1RJ8A 3PIJA 2DVGA 2HLEA 5EFUA 4B4PA 3POBA 5A3NA 1QXRA 1UIKA 3U4SA 3TN91 3JBG2 3W21A 1VBB1 1PVXA 2VZ3A 5DZGA 2CNAA 4R9AA 2ZOEB 2BU9A 4KG8A 4CXXA 1G9FA 5D8AB 2R062 1S4CA 3M70A 1HKDA 1BEV1 4BLJA 5A6QA 1XOYA 1YIFA 3WR0A 2NZ9A 4LA2A 4TWTA 1UU4A 4RN5A 5C8WA 1HN1A 4QD2A 3ZR5A 1WD4A 3U75A 3PVOA 2GNDA 3SEEA 4ATFA 1RVF3 1N1TA 3WDXA 2RV9A 2P6HA 1VBA2 2ZGKA 4G3YC 2HYXA 4PF1A 3ZSMA 1ND2C 1RMU1 4OMCA 4XQ4A 3RRDA 4UW6A 4RQPA 5F39A 5KHGA 3N7MA 4CUBA 4LK7A 4B1LA 1ACCA 2R0HA 5GZCA 1HRV1 3OBAA 2YYOA 2JE8A 3OCPA 2NM1A 2BGCA 1C5IA 4A44A 4I3PA 1C5HA 1OVPA 1COV1 5G04L 5FZAA 4O7XA 1VBA1 2RDQA 1OH4A 2AUYA 3J8F2 4L0PA 1PVC2 2BBAA 5IFPA 1WLTA 4XCBA 2RVAA 4CDUB 1ULFA 3EQEA 3KWVA 2D3RA 2ZHNA 3DYOA 4EN8B 4LKEA 1QNWA 2XWJB 4R9BA 1FAYA 3WF4A 1OQDA 1YEWA 1G7YA 2BP6A 5IT6A 3OY8B 3R4UA 4LBJA 2JDZA 3JXSA 2LROA 3DPRB 3F2ZA 4Q4X3 3AL5A 4ET7A 2UWCA 4DXTA 2VTFA 3FLPA 3PU8A 4R9DA 5D21A 4FPJA 1D4M2 1V6IA 2YROA 3WF2A 5E88A 3CU7A 5CBLA 1PMHX 3UL2A 4ISQA 1UY0A 3HQXA 1GZWB 1W6MB 5FKCA 4WVMB 1GOFA 4Y20B 3VB9A 3VBOB 1DFQA 1NCQB 2RS31 4AGVA 3FHQA 2EXIA 5K0UB 3NNMA 3D0SA 4XFHA 5F3EA 2UY8A 2CGPA 1C1LA 3MPPG 3BN6A 4PQ9A 2MEV2 4CZSA 4ZS2A 3FMGA 1E5HA 1NY71 2YC2A 2EIGA 3FHIB 3L2YA 3RGBA 1WWYA 2CTVA 5T54A 1RVF2 2XUEA 1GNHA 3FLRA 4JTNA 2JG9C 3OEAA 4YG6A 2WNUB 4AK3A 1SPPA 3ZDSA 4NOTA 2D6LX 4AFDA 5AC93 5FZ6A 1KGYA 4ZPIA 4LA3A 3RZZA 5LY2A 4JDOA 1O3TA 2VH9A 5A3OA 5K0UC 3VBHB 4AOCA 2R063 2VUJA 3JD73 3BPSA 4IE0A 3RG0A 1QJU3 3VBOC 3ZFFC 1F4AA 2R1DA 2V5DA 3V0BB 1YFXA 3ZXAC 4EN0A 2DTYA 4LOSA 1LHWA 1DZRA 1RINA 3FZ3A 5FYSA 4E4HA 1A34A 1WA4A 1APNA 4XHXA 2DBNA 2IXIA 1R082 1G9DA 1UOBA 1RUH3 2ORZA 5LRRA 4CEYB 2D6PA 2J1SA 1OUSA 1QJY2 1A8MA 5F2WA 5T55A 2BNNA 4MHUA 1HB3A 2P5BA 2PTMA 1QEXA 1HRV2 3P1IA 5KHIA 4LHNA 1JZ3A 1ZYBA 2ZAHA 4RFT0 4AI0A 2E51A 4NN0A 1CJDA 3THTA 4LTAA 4QXHA 1SBFA 1S2EA 4FCAA 4Y5TA 3WW3A 2Y6HA 2W1UA 3D6EA 5SV8A 1W0PA 1RUD1 2VUDA 2VBPA 4HSJA 2O14A 3HJRA 1CAXB 3LEIA 4M3CA 3UESA 2GMMA 3WEZA 2W1WA 5A70A 5IK8A 2DCTA 3ACIA 4N53A 2H6CA 4IEVA 4YPJA 1GKBA 3NAPA 3NJZA 5HCFA 4RYDA 4ASLA 2WNVC 2OVUA 1PGL2 3VDDC 3OBRA 1AL21 4LO8A 1WCDJ 3WQ1A 2VOKA 1OVSA 3AP5A 1JOJA 1BQPA 3MF9A 4XQWA 3TBDA 3C2UA 3MLJA 3BIWE 4KG0A 4NIGA 1H4HA 2FCUA 1C4RA 1DQ4A 1R1A1 2VNVA 1D7PM 2DCKA 1JODA 4MGYE 1AX2A 4LT5A 4GMP3 5FY4A 3H42B 5D8AC 2CYFA 2ZGSA 4OI1A 4QQLA 5TSWA 5BNOB 2RJKA 3O0VA 4NVPA 4GWJA 4AHWA 3USUB 1QJU1 1KRIA 5L9VA 2PHFA 3MDPA 2GMPA 4GQ7A 1XRUA 4HVQA 1Q56A 1RUG1 2X53S 3U07A 4FBFA 1C8M3 4CCJA 1YHFA 1J1LA 1Q8PA 1OSGA 2DF7A 2ZGQA 3GCXA 4CU8A 4B4QA 4Q0VA 3KQ4B 4DPNA 2XQXA 5L73A 1F5JA 1H0BA 1MEC2 2J7MA 1RUI2 3I3DA 1ZM1A 3BTXA 3VBFC 2QJVA 3BALA 2VD7A 1NZCA 5DAPA 4O9GA 4N53C 3HN1A 4FAHA 3UNPA 1UU5A 1XC6A 3VBRA 4AFAA 3LPGA 2LW8A 1IOAA 2OXBA 3NVCA 5F6KA 4ZS3A 5FYZA 3VDDA 3RVHA 4H7MA 1CD3G 1NAEA 2WC2A 2X29A 4I3GA 2WNEA 4COWA 2VQAA 3ZXLA 4CA9A 2ARCA 3C8XA 2Y6GA 1CZTA 2E53A 1HN0A 1OQEA 4BLIA 4FOVA 2JXAA 3OD0A 1JZ2A 3L2HA 1RTVA 3ZIWA 2B4KA 1VRH1 4IEOA 5ACA1 1HRV3 4K3UA 2JG8C 1ZZ9A 3ILRA 1QU0A 1PNFA 5B4XA 2XPJA 2BNOA 4IETA 1NE6A 1U5ZA 1S0EA 4IE5A 3ABZA 1R092 4Q27A 1FI2A 5FP9A 1H2MA 4XF1A 3KGLA 1VMHA 1UO9A 2VULA 2ZACA 4CCCA 4L92A 5H9SA 1W04A 5JMCA 3ZFEB 3I97A 5CG9A 1GOHA 1TE1B 3N7KA 2J1AA 2JDMA 1WLWA 4NRQA 1Z78A 5FY0A 2RHPA 3ME2A 4CP9A 5H9PA 1JBCA 3WNKA 3ES4A 1VBD1 2VOXA 2P3JA 1CPNA 5F5AA 3LE0A 3ZSLA 4JCKA 1YWKA 2OIIA 2VPVA 2VQUA 3GALA 2ZKNA 3J8F1 4BE3A 3NO8A 4QT6A 5APAA 2Q1ZB 4INDA 3WNPA 3S57A 4YVSB 3MYXA 3POJA 5FP8A 1RHI1 3HBZA 1ND3C 4QDSA 2WO2A 5F2SA 1VIWB 2XLFA 3P3PA 2D5HA 1XE7A 2P4EA 1XU1A 2F17A 2Z5WA 1IPSA 1AR92 4EWAA 2WUHA 4BQXA 3UGHA 3UETA 1UNBA 1JS9A 1G86A 2WRAA 2XJPA 1GMMA 3HOBA 2QDNA 2B45X 3K46A 5JIUA 5DZEA 5J36A 5ISLA 1UL9A 2A7AA 2VUAA 2TNFA 3LSDA 5F3IA 4L8QA 5L7OC 2GNBA 3O1RA 1NCRA 5T50A 1DGRN 3UGFA 3S0MA 1UOFA 1J83A 3K48A 4KL1A 4DZGA 1YJKA 5A7NA 3GXUA 3UV9A 4FI9A 2WO1A 5FZ9A 3RYKA 5IFTA 1E5RA 4QQPA 5C8CA 3D5OA 5FK7A 4Q8LA 4Y4YA 4IGPA 4L99A 2J1EA 2V4VA 5F1RA 1H6YA 2YY1A 1N3OA 1NCQA 4JRAA 1YJLA 1ODNA 2XHKA 2X5IB 5FZOB 1W9SA 1SDDB 1UOJA 1JZ4A 4CU9A 3A21A 5FPZA 4IESA 2W91A 3BGAA 4PF5A 2D6MA 3MZHA 2WS91 5C9AC 3WF1A 5DUUA 4KI5M 5JZGB 1ZBA3 1UIJA 1QWRA 1S2KA 2WLQA 3S6PA 3PHMA 4DUXA 3O1MA 1W2NA 3IPVB 5F37A 5CG8A 2GNMA 5A6ZA 4P5HA 4Q0PA 4Y1ZA 1W0NA 1PZ7A 3N9OA 1X9PA 3T08A 4ZU4A 1ZBE2 4N43B 5IJRA 1DQ5A 3ZM8A 3V0AA 4IV1B 4Q0QA 3E6DA 3OPWA 4BIOA 3U14A 4YM3A 4UW5A 2OW4A 5FQ0B 3ZYIB 1ZRIA 3MBWA 4PDWA 5IVJA 2PHRA 5A3UA 2QCSB 3K75B 3VL8A 1UN1A 4P00B 1B09A 3N7JA 4R4ZA 1V6LA 4HVRA 4HT1T 1BVVA 2E7QA 2ES3A 2QTWB 3Q8FA 3C7FA 2WNUC 2R32A 1HV1A 3H3LA 2PHLA 3J4UH 2H0BA 4AQSA 3CNAA 5FZIA 4FFHA 1LB2A 3SKJE 5FWJA 1OH3A 2QQWA 4LO4B 1CZVA 1OFSA 4XW3A 3OPZA 3VBSC 4CDUA 3NKGA 3U37A 4F83A 2CGOA 4MGIE 3FLTA 1AYM1 1W8HA 4O61A 4QDQA 1AR83 1NKGA 3KM5A 4HLTA 2X8KA 5EYXA 3OY8A 5GZDA 3VN4A 5I0RA 2P3IA 3W58A 5LA0A 4CP1A 4OZOA 4V1PA 5CAZA 1YO8A 3BTYA 2XJQA 1LHNA 1VP6A 4CP2A 2C0ZA 2AYHA 5C8CC 5FQ0A 3USSA 3I49A 2FD8A 4CXYA 2Q8CA 4GB32 3AKPA 5FYIA 1OA3A 4Y5SA 1AXKA 2AEYA 2K0GA 1N1VA 1W2AX 3QH6A 4XURA 3K4DA 1NLQA 4Y22A 4YW7A 4RR3C 3WNLA 1NOVA 3N9PA 3VDBA 4K9SA 3ZKUA 2WJSA 1HV0A 1KXGA 1CVNA 1XYPA 4QB6A 1ODMA 3D4KA 4F7ZA 5JAXA 4LO5B 1SLBA 3OYWB 2DUPA 1DHKB 3PUSA 5EXOA 3NJXA 4MADA 1DLLA 1LJ7A 2PAEA 3T4HB 2E7AA 3ILNA 4XBNA 1AXYA 4H7LA 4LEJA 3B3QE 3ACFA 1ZBA2 2XJSA 3C7GA 3OG2A 3M3IA 3ZYGA 5GLUA 3ZFGA 3G6JB 3ZR6A 2IZWA 4A45A 1JZ6A 3MUZ1 2UWAA 3WDUA 1FNYA 1TMF1 3EB7A 3POGA 4YM0A 5FTTC 2OYZA 4XACA 3WOGA 4WBBA 2OZ6A 2WYSA 1MR5A 4DEVA 1ZRCA 3EYPA 4AVSA 1J84A 3RYPA 1UF2C 1QOSA 4XIOA 1RHI2 1G9BA 2XDVA 3M2MA 1QXPA 3OJBA 3H8OA 5FPLA 4CCLA 5EQUA 5JR7B 2WIIB 3NJVA 4HPKB 4JQTA 3WW1A 4QXBA 2JKBA 1DF0A 2ENRA 3ORJA 4NHMA 5K4LA 5J37A 1W05A 1R1ZA 1WCUA 2PQQA 3N7LA 4LJHA 2XLAA 5DAQA 3AYCA 2ID4A 1TQ5A 4P14A 4HZFA 1GP6A 2Q1MA 4Q0SA 2DCJA 3AP9A 4CCOA 3B93A 3M3QA 1M4WA 2XLGA 3H1YA 4ZZ8A 5C3SA 4N9IA 2VNRA 3ETPA 1ZZ6A 5FCCA 5FY9A 3M7AA 2VXJA 3CBNA 1EYBA 5JXGA 3ST7A 2PHWA 3FUQA 1LEMA 4CDXC 2WZEA 4KWLA 3AZVA 1OLMA 2QVSB 1S0JA 2ADDA 5A32A 1CQ9A 5AC92 4XFGA 2DWRA 4OUEA 5LBFA 4AVBA 4K8RB 5FZMA 3ELNA 4ZXEA 1X82A 4YGBA 1F31A 2HWC3 2RM22 4CP0A 5E6HA 2BTVC 1H2KA 1QF3A 5FO7B 2X09A 5BNOA 3SH3A 5C4WC 1LU1A 3MFAA 5FO8B 4KNCA 1OKQA 4LNVA 4P9JA 2XL7A 2IVIB 1OLRA 1JHNA 2BNMA 3GCWA 2RS32 4GH4B 1O7FA 5EIYB 1CWPA 1RUF1 3K3NA 1JI6A 1D2SA 2GC2A 3AKTA 5GLZA 5BYNA 1IS4A 1UWWA 4GA9A 4AZZA 1FOD2 3M1HA 3WNXA 2YU2A 2YZ4A 1ZX5A 1GZCA 4MYEA 4KQ7A 2NN8A 2D43A 4QPIA 5A3WA 1LOFC 1W6PA 1H8VA 2I07B 2BFUL 2AH2A 3AJZA 2R071 1MS4A 3IDCB 3VL9A 5FZGA 3TEWA 4IXLA 4XJAA 2QQJA 3HBKA 2WQ8A 2GDFA 1Q8VA 1BHGA 1O5LA 1CAUB 5C33A 1HQLA 1K12A 1ONAA 4HG6B 5HV0A 1N3QA 1IQDC 2W5FA 3WQ0A 4E2QA 1BLZA 5DZFA 5JPMB 3VBFB 2HWB3 1JN2P 3DV8A 1V6NA 5L7OB 4YGEA 1ZZCA 5FMOS 3IIIA 2D44A 5GLVA 1NX9A 4MO3M 4XETA 4YVSC 2ZJCA 1DIWA 1CAVA 1WCQA 2O8QA 2Z4FA 3U1XA 1F8VA 4CU6A 2BVBA 2VVFA 4CDQC 4QMAA 3LDKA 2FDHA 1JYVA 1SBEA 2ERFA 4YG0A 1Y9GA 5DUXA 2R7EB 4OHZA 4ZZ5A 3RZMA 3JBG1 2XL9A 3TN92 3S7EA 2FDGA 3GZTB 1RUC2 1W90A 2ORXA 3SISA 4QXKA 4ASMB 3ZYRA 2RE9A 2GN3A 3DUIA 4LBOA 1REFA 5CIRA 1S0CA 1ENSA 4RGGA 4CDWA 4MHRA 1ZBE3 3LQCA 3LB9A 5A3PA 4Z8BA 4PJYA 5FPVA 5C9AA 1C28A 1NLRA 1VBB2 1W03A 3GF6A 4LUKA 5T5OA 4C90A 1AR73 1RUD2 4X6QB 5GZFA 1VJ2A 3DN7A 4DUVA 1WBFA 2ET7A 3GZEA 1IKQA 4AHZA 1IS6A 2ZEXA 4FPLA 2Q8EA 4TN7A 3IZOA 1ZREA 1BEV3 2P3YA 1LECA 1JYNA 5JZGC 3V0BA 1YQ8A 4ZU7A 1J1TA 3RJ2X 2W9XA 3AP6A 1K5MA 2P1BA 4IDZA 3WP4A 2B39A 4NPMA 4AR2A 2XGXA 2YXSA 4LUMA 4W6WA 1X8MA 4Q4V2 1DBNA 1Y7BA 2X5IC 3ZSJA 5AC91 2G19A 3FX3A 3TNPB 3V56A 3Q8CA 1I5ZA 2JD4A 2W1SA 1QDOA 4J25A 3BTAA 1LGBA 1LOCA 1AXZA 4OHXA 2ARXA 4XJWA 1FPN3 1H8TA 3JD71 4NIIA 4D7SA 1LHVA 3AFGA 1C1FA 4WZCA 4E8CA 4I0BA 1WKYA 4XDPA 2VOWA 4TSVA 4A4AA 1CAXA 1AJKA 1WW5A 4PLOA 5F3CA 1SEFA 3RZJA 3CLPA 5T5JA 3IMMA 3QACA 4A7KA 5LBCA 5FY5A 4COZA 4N53B 1KDMA 3KCYA 5ABJA 2CWSA 1SLTA 1ZNPA 3INAA 4YG3A 4YW2A 2AGSA 1AYM3 3MIBA 2EIBA 2OPKA 2ZX1A 3K51A 3RYRA 1ZRDA 2P17A 1JOBA 1OD5A 4AE2A 1OC1A 4GWIA 4XUQA 1SLLA 5BNNB 4LR4A 4QM8A 4LE4A 1Q3EA 3LIGA 1VBB3 4QQHA 4R4XA 4AL9A 5BNNC 3K4ZA 4OCTA 2BOJA 5DG2A 2O8OA 4FFFA 1UU6A 4F8AA 4P5YA 5BNQA 3B01A 1O8PA 5LK7B 2BFUS 1KS5A 3R4DB 3VZMA 1A6CA 2DDUA 2XG3A 2DTWA 3SQOA 5EJ1B 2WDBA 4RQPC 3HAGA 3V65A 2VUCA 1S2BA 1Y9MA 2W46A 1RUC3 5FZOA 1ULGA 3IAPA 5FYUA 3KQRA 5JCTA 1DZTA 1EV12 2WFF1 4OHYA 4UYBA 2B8MA 3RFRA 4XXAA 5FZFA 4Y1YA 3OGJA 1YFYA 4AYUA 5L19A 2PFWA 4NPLA 1DCSA 4AEKA 4LKSA 4DMIA 2VMIA 2ZPXA 4IQPA 5FMDA 3U10A 2EF6A 5GLWA 4A7YA 2J1TA 1JZ5A 2XJTA 2WZR2 1V6MA 3TWIA 3FC0A 4W6YA 2PYTA 2D98A 4FOYA 4I0WB 5FZ8A 4CTEA 2PAKA 5CFDB 2P2KA 5EPAA 4RR3A 1QMJA 3BOPA 3O5SA 5FYMA 5HPOA 2XWBB 1VBA3 5EYYA 5K8SA 2WABA 1DGWA 1SFPA 4TLFA 2HJIA 4I02A 1A8DA 1FYUA 3LD8A 2D40A 3VD5A 4OFGA 4XBLA 4BHPA 5FMCA 2H0VA 4XUOA 4JV4A 2ZHMA 5FK8A 4PDWB 3VUOA 3RZKA 3KB5A 4I01A 1LHUA 4AVTA 1W8UA 4BQYA 1K5MC 1RUF3 2DUQA 4XABA 4U36A 4JVAA 3KV4A 1UYPA 1XYNA 5IVEA 1VB2A 1GUIA 4FXGB 4GULA 4XJZA 1CR7A 4QPIC 1NG0A 2HWF1 3N9MA 3RWNA 2FZ2A 4MGZE 3O12A 4GMP0 2HWD3 3EHKA 4XJ9A 4A2UA 4AQTA 2YBPA 5DAWA 2WA4A 2XVGA 3URFA 5C3OA 5LWBA 2Y6JA 3ITQA 3I3QA 3LKJA 4CEWB 1H8TB 1N3PA 1KFXL 2VNGA 1QHDA 3BOWA 4OUSA 1FT9A 1PGW1 4NJ4A 4BM8A 4JZRA 3G7DA 3E1F1 1VBC2 4FTEA 2WT0A 4UW4A 3HNYM 2K9ZA 4OYUA 1HB1A 3T1MA 2YBSA 3E6BA 4NHLA 1WMXA 5A33B 3J7LA 4UFHA 4AI2A 1HXS2 1RIRA 1WW7A 1DQ1A 3N35A 3EJKA 1HRI3 1QQP3 1W3XA 4FQZA 3BU0A 1XNDA 1YQ2A 1AL0G 4CEWC 3T2PA 1XJAA 3W20A 1UCXA 2UWBA 3P3NA 2JICA 5FLHA 4MV2A 1X33A 1O4ZA 1PNGA 2VCMA 1JW6A 2JKXA 2WNVB 3W5NA 2UYBA 3MIDA 4MLOA 2RM23 5CKQA 1VAKA 1SMVA 4JKLA 4JTOA 3I2KA 4EROA 2DVFA 1MACA 1CAWB 4XF4A 4YW4A 1S0BA 2PLV2 2BQPA 1AX0A 4PCRA 4A3ZA 3OUJA 2ZGTA 1EUTA 5DUWA 1LOGA 3PJQA 2C4XA 4QU2A 5GLTA 3WP3A 2QKDA 1JXNA 2W52A 3CO2A 1MEC1 1QOTA 4RD7A 2WL1A 2JDYA 4LBLA 4Z92B 5I91A 2F6BA 2VECA 5HCHA 4R9CA 1YQ5A 4WVVA 1XBFA 4DUWA 3KV5A 5J09A 1M06G 3P5BA 4ZXKA 1VR3A 1CAVB 3HVDA 5FUIA 4XTPA 1RMU2 4W65A 5DAVA 4DRRA 3SH5A 3HT2A 3AC0A 1UY1A 1MS5A 3EO6A 4GH4C 1SFNA 2WNUA 4XAAA 3IKWA 5DQ0A 1TMF2 2R30A 4MXVA 4M3CF 1QJU2 4BCUA 4MGTA 3DXUA 1W2UA 3NL1A 5BUVA 2XJVA 3KLSA 3MUY1 1GWLA 1YYNA 3O1UA 4D8MA 1WUVA 3ZFFB 2VZVA 1R1A2 1V00A 2IXKA 3PVEA 2FDKA 2WT1A 4LBQD 4TTGA 1UX7A 3E5QA 3IDAA 3I3MA 1GU3A 2HEYF 5F6LB 1AR93 3SCHA 2XBO1 5C8CB 1H1IA 4NROA 3VD3A 1R081 4IEXA 5EWSA 1Z0HA 3ECQA 4CDXB 4WVWA 3J7MA 1H4GA 3ZIXA 3POYA 2YUEA 3AMPA 4PLNA 1RUH2 1SCSA 3KT7A 3TN93 2ADEA 5KXEA 3PUIA 3BTZA 1BEV2 4SBVA 3ACGA 4CPBD 4KWJA 3FJSA 4I2OA 4YZ5A 4EZHA 4UFLA 2OUJA 3JD72 1E5IA 4HL0A 3VBSB 4EZ4A 2EIDA 2WBKA 1K5JA 3VKMA 3E6CC 4NPRA 4JGYA 1FV3A 1OBNA 3UGGA 1J3QA 1HB2A 5DG1A 5JZGA 2NYYA 4HBNA 1AR72 1RUD3 4P08A 4FSJA 1ASJ1 2PLV3 1PO12 1PX3A 2VZTA 3A22A 1B35C 4E2GA 3H1WA 2GMEA 3WVJA 1EAH1 1US2A 2WZPP 1K3IA 4A42A 1J58A 1Y4WA 2W68A 3E5XA 5FOJB 4QHZA 2GC3A 3B00A 5F32A 4COYA 4XUTA 3MV01 4S2DA 1K45A 3JCIA 1BBT1 2J1RA 2V09A 2BPA2 4R8HA 1UPSA 1XQNA 5DN2A 1ASJ2 2KA3A 2DV9A 4FXKB 3PVBB 2ZHLA 4UFMA 4ZONA 3POEA 5A7QA 3NV1A 3U11A 2JE9A 3EXUA 2PN5A 4BJ0A 4GJYA 1UZWA 2RDSA 5FMOL 2QQKA 4QPWA 4YW3A 3HWJA 2EA7A 4LHLA 1BMV2 4FPGA 4HN1A 2ZHKA 1UMZA 2W0XA 1RUE1 3MW2A 2YGLA 1UY3A 4K8FA 5IVCA 1JYWA 5DPNA 1LKNA 4CUGA 4XEZA 4D3WA 3IIAA 1KD7A 2ZEWA 2CSGA 3VZNA 1DQ6A 3B9CA 1MS8A 2AC1A 4HETA 1WCSA 3ZN6B 2HKXA 3VZLA 1DYKA 3LEKA 5FPBA 1IZ3A 3I2JA 4MGSA 5D2AA 5FPUA 4CDWB 2JDHA 4QQOA 1AUYA 2G4IA 3HR9A 3MF6A 4FFGA 1G9AA 1MEC3 3V64A 3J26N 1S0IA 3H8RA 1DDLA 4PBPA 3MIFA 4Q5OA 2QQOA 4IE6A 1H1MA 4XFAA 1ZBA1 1SHWB 3I2IA 5IUQA 3RZGA 1EV13 2UU8A 3LEMA 1PO22 3R6SA 3B9IA 2Z42A 1UPIA 2A6ZA 3SMHA 1S0DA 5CA6A 5CFCC 5EHDA 3S5QA 3T2QA 4CPBA 1JYCA 2W47A 2A6XA 3ZPYA 4AAXA 3RNSA 4AGGA 2XJUA 2D6KA 3WDVA 2WZ8A 2RS13 4WM8B 4XFCA 5CISA 5JSRA 1US3A 1WZXA 2VTXA 1HB4A 2RMU1 2XB6C 5DDJ1 5JUVA 1UYYA 1ULPA 4Y33A 2XBO3 1EPZA 3CL1A 1ALYA 1C57A 4HK9A 1WW6A 3KHCA 2OT7A 2ILMA 4HVOA 4LO7A 4FFIA 3D3AA 4LKDA 3JB4C 2YC4A 2YGMA 1X50A 4YVSA 3NAPB 2IXJA 1G6NA 2IFRA 2WSUA 3ZFGB 3TNQA 3GBFA 2WWUA 4JGZB 1KJRA 1DLCA 3ZSEA 3KCXA 1U5XA 1LR5A 2MEV3 4AHYA 1PO21 4YFZA 4AWDA 1W06A 4MX3A 2E63A 4GB31 1OOPB 3AXEA 4ISRA 1GNZA 4Y1XA 4BXSV 1FXZA 4LITA 3FL7A 3IM0A 1CZSA 5E16A 1QJX2 4KU8A 1OKOA 2ZGLA 4F3JA 1WA6X 1GZ9A 1GQGA 1XE0A 1ULEA 2C5DA 3WLUA 3AM2A 1NA1B 2QQLA 1B35A 3ACLA 5A7PA 2C9KA 4EWEA 1W8NA 1RHI3 4COVA 5C3PA 4BZ4A 5C4WB 3GBWA 1LTEA 4XQDA 5SV5A 1TNRA 2HWF3 2TBVA 2W39A 1YC61 4S2FA 4YVWC 3WF0A 1W8WA 3BB6A 1H9WA 2XMLA 3IDBB 4META 4NAOA 4NWWA 4OLLA 3VBOA 1RVF1 3WW2A 2W2IA 3OBZA 4HANA 2QQIA 4YZ1A 5T3NA 2W1QA 3QH7A 5FP7A 3ZMOA 1U0AA 3I2FA 4I0AA 5KHJA 4Y1UA 4Z82A 3UYJA 1YFWA 2IXLA 3ATGA 3RMXA 1NCRB 3UKVA 2YG0A 3RZLA 2KM2A 5D1IA 2V73A 2QNKA 4OUMA 4O65A 3V0AB 4QX5A 2Y60A 4LKFA 1DU3D 1PX4A 1V9U1 1YQ6A 3TRSB 3H8XA 3ZVXA 1CX1A 4K40A 3D0JA 3PDQA 2IUWA 2FDJA 3C7OA 1U12A 5LBBA 3KD4A 3KGZA 4EN9B 2EIEA 3VBHA 2CGNA 3HIFA 4DY5A 4RL7A 4HONA 4YGDA 3T09A 5JSPA 4CCMA 5FXXA 1MQTB 2PHXA 4M0NA 4B7KA 4DS0A 4BQ3A 3VD7A 1QXJA 2XOMA 1W8TA 1KS4A 4OVEA 4QX1A 3IDEA 2IFWA 2YDEA 3UT0A 2HWE3 1AR63 4QAWA 3KSCA 3WY6A 2IVJA 2PA7A 2JENA 2BEOA 2XBO2 3RMYA 3VBRC 1AYN3 1PIV1 3ON7A 1N1YA 2ZEZA 3MO4A 4CE8A 2Q5TA 1TME2 2RS33 4NIAA 3B7MA 1OA4A 3DKWA 4N43A 1DQ0A 1EUUA 4Q4W2 5IVFA 1C8M2 4XZPA 4URAA 4MZUA 2R49A 1Z7S1 4JHTA 3ZFFA 3B02A 2W94A 2LRPA 4OZXA 3I2GA 4KWKA 1I3HA 1YIPA 3VV1A 3RI8A 4WVMA 1V70A 1WBLA 2HWB1 4QX2A 3ZFEC 1X9TA 2QE3A 2W95A 4XJUA 5FUNA 3PMSA 4ZY9A 4KWUA 3T0BA 1O3SA 3PUHA 2VY0A 1BKZA 3AYAA 2GH2A 1KDKA 4NHKA 2JG9A 4CCKA 2XKPA 2ZCWA 2NPIA 2ETEA 1NLSA 2XH6A 4PI0A 4QB1A 4Y3OA 2HWB2 5J48A 2BZDA 3ACHA 1QJY1 3J7NA 1WW4A 3KHBA 1PGSA 4TLGA 1ND3A 1NT0A 5E1RA 2Z79A 1A3KA 1GLHA 2F4PA 3O7OA 2FMYA 4HSLA 5CFDC 5HXMA 2OUHA 1Y43B 1REDA 3POIA 1XYOA 1PO13 4EE2A 3BIEA 3HT1A 3M8LA 5AFEA 5CEHA 2MHFA 2HWC2 4NE9A 1FMD3 2RS53 3N4MA 3DEMA 3MPBA 4YZ4A 3VHNA 4UF0A 1D0GA 1LOBA 2WO3A 2XKOA 1CPMA 1N47A 2D93A 4FP3A 4IEPA 1F4HA 2ZA9A 4D6RA 1W8OA 4UT5A 2NMNA 4A6SA 1ZVFA 1A78A 3E5UA 3WD5A 4FPFA 3H1MA 5E8AA 2GC1A 3WG3A 1NY72 4EYUA 2ZMLA 1PMJX 1XU2A 5D8AA 4Q1RA 3AP7A 2CY6A 3ROUA 4KGGA 1QJZA 5DAXA 5LASA 5FLJA 4DNYA 1LAJA 3PTYA 2ZGPA 1LHOA 1BBT3 3PURA 1RGSA 2EXKA 5FV3A 3USUA 1BMV1 1OMIA 3Q8BA 4L2NA 2BGPA 1XNBA 3OF1A 1LODA 2A1XA 4WM7A 1COV3 4XOGA 5CKMA 4AI8A 5IK7A 3ZLIA 4IERA 3ZX7A 5BNPA 1JU3A 2OQ6A 3FBYA 3OUHA 2ZGRA 3WUCA 1UQXA 3ZYHA 4D7YA 1AJOA 2YV8A 3BYWA 4GKYA 1OLQA 4UFKA 4C0HA 3NQHA 2YPDA 1SLCA 1W6MA 1QJY3 4QPYA 3ETQA 1OURA 4PDWC 1RUG2 5FZ1A 2Y6FA 2CDOA 3JB8A 5LB6A 3RDIA 3DPRC 3T2OA 4GB33 4FVVA 1QQP2 2BWAA 1RUI1 1KEXA 1XNTA 2BYVE 3I4IA 3Q9OA 4FPHA 1ZBE1 2ZS6B 4MXWA 2PHTA 2BGOA 1VBE3 1PO11 2MPFA 5JXJA 2OQ7A 5M0TA 2K2SA 1MS3A 3W9AA 3WZ1A 2UYAA 1ZA7A 3DYMA 2ZAAA 3ZFEA 1LCLA 5ANNA 4AFMA 1QJFA 2VZOA 1ENXA 2VE1A 4COUA 5JSOA 1LENA 3AXDA 2AREA 3KS7A 1OD3A 3OEBA 4RS5A 2QQVA 1W9FA 5K7PA 2G9ZA 4XUNA 1EV11 3DCQA 2FDFA 2V72A 5HCAA 4CUCA 3WQBA 3MEPA 3IT8A 1VAVA 2VMHA 2WZR1 3HEIA 2VAUA 1H9PA 3VDAA 3CDZB 1LNSA 5K0UA 1R64A 1UW8A 4JKMA 3WG4A 2WSVA 4QPGA 3LOBA 1PIV2 5LA1A 2A6YA 4H55A 3NW4A 1XNKA 5F5IA 5FLIA 1W9YA 5GM0A 3AMNA 1NXMA 5KXDA 4P02B 4URTA 1COV2 1HX6A 1W99A 4FT8A 3RSJA 3O1PA 1JYTA 1SZBA 5FO9B 1VB4A 3VBHC 5CFDA 5B2GB 4UW3A 1QJX3 3HMYA 4BQWA 4C91A 5A1LA 3OBTA 2NP0A 1AR82 1SCRA 3GM8A 1O91A 2RR12 2HH9A 4ZKTB 3IWZA 5L36A 4XFBA 1OQ1A 3VBUA 2A71A 4ZU5A 4C1XA 1Z7S2 1W6QB 1J3RA 1H8TC 2PQSA 2X10A 5F3GA 4LQRA 4D6QA 5GZGA 2Q8DA 2A3WA 1VRBA 2EICA 4JKKA 4RHV1 2WNOA 5KXCA 1PM4A 2ATFA 2JDPA 2A6WA 1JZ7A 1IKPA 2LUWA 1OI6A 2WQ4A 2XUMA 3X29B 2X5IA 5HV4A 3VKLA 3AB0A 2VZSA 1HJGA 4J6GA 5JR2A 4UXAA 4QM9A 1SLAA 3VKNA 5A1AA 1CGPA 4DY3A 4M01A 5I8SA 3I54A 2IXCA 4BPZA 4E4DX 1W6NB 4QPGC 3O14A 4DINB 2VBDA 5E89A 2JIJA 3UJOA 5KC5A 3MLLA 3K2OA 5JPNB 2WO7A 1PZ9A 3AYEA 3GJAA 1SQ4A 4Q1PA 3ZN6A 4BU2A 1VMFA 4D7TA 4D94A 1HQNA 4YVWB 5JIAA 4FAGA 5KXBA 2R041 1GWMA 4RS5C 3WDTA 5CFCA 4NRPA 1H2NA 5A33A 4RS5B 3FFZA 4ITCA 4FOQA 1VBE2 5A3LA 1ND2A 1AYN2 1AX1A 2DYCA 2JECA 5JWPA 4IUGA 1BZWA 4CDQA 3C7HA 2G9GA 3AKQA 3TAYA 4QX7A 3WNMA 4QPGB 2VQTA 4D69A 4BIFA 1RJ7A 2RR13 1L7QA 1O59A 1SBDA 4P9YA 1JHJA 1VALA 4KBBA 1ZRRA 1Q5OA 2LM3A 2WYFA 3J9SA 3PMEA 3IAQA 4CYDA 5C6CA 3NV2A 4Q26A 3TEYA 4BQ1A 1UZ0A 5KC6A 2R6QA 2DBIA 2YHJA 2UURA 5FR3A 3NJYA 4N8MA 3GGLA 3KV9A 3QOPA 4KGQA 2WS92 5I8TA 4QB2A 1TVGA 3VGIA 5A80A 4OMDA 1PVC1 4AGRA 5FYTA 3SNMA 4FPKA 2RMU2 4AW7A 2O1QA 1Q8QA 3SLIA 1URXA 1W6OB 2HWE2 2VZPA 1RUJ3 4YVWA 3I2HA 2GU9A 1F9KA 1YNAA 4XXPA 3VKOA 4DXSA 4Z2AA 5BV6A 4Q4V3 2R073 3MIEA 2YB7A 3NNLA 3CIHA 3MICA 4UAPA 3N9NA 5FXVA 3W59A 1LU2A 5HXVA 2JJ6A 2RJLA 4KBZA 1KITA 1MQTC 5FP3A 5J98B 1L7RA 4O9EA 4K1ZA 2A70A 2AR6A 3ZXEA 1X36A 4DXZA 3PNAA 5CZKA 5L9RA 5IAXA 4ZHNA 4HXCA 1J59A 1HXS3 3QD6A 1OXCA 2WKKA 1VRH3 4NR1A 1SG3A 5GJ6A 5FZ0A 5H9QA 4DOUA 5ACA3 2QQPA 3DPRA 4M0HA 4XFFA 2FDIA 1AR91 1W8ZA 4MG2A 3THCA 4HOOA 5FZ4A 1BK1A 4QKDA 3POSA 4XFIA 1NCRC 4IV3A 4B3NA 4QU1A 4E27A 4ES9A 1W0OA 2G9FA 1DYOA 5C4WA 4BMBA 1O3QA 1AYM2 2V5YA 4E9KA 2D3PA 1MZ6A 4N7UA 3UKNA 4W8JA 3H9AA 2R072 4LORA 1IG0A 4NHXA 1PO23 1ULOA 1NYWA 4EQVA 3DF0A 5J7MA 4QKNA 3SITA 2K46A 2W87A 4XVHA 1KFUL 1ZZBA 4N9HA 1VMJA 3LOIA 3DYPA 4RGKA 2GN7A 4AHXA 4NO4A 1AZDA 3FUOA 3MV11 4M4RA 3KVAA 1VBD2 1W6NA 3H0OA 3R4SA 3NNJA 2Q1FA 5A6YA 4FTSA 1FMD2 1QY4A 2RS52 2ZABA 4W6XA 4BH9A 3UKTA 2WS93 1UYXA 1BXHA 1D4M3 2VZ1A 3WNNA 4BXFA 1BBT2 1CX4A 4RR3B 2QZ2A 3T30A 2GSYA 1GICA 5J96B 5BPXA 2RG4A 3H7YA 4IEWA 3RI9A 3FBMA 4HN0A 2AEZA 1PK6B 2ZEYA 4YW5A 5KBFA 2Q30A 1JH5A 3N9QA 4UOJA 4QX3A 2GALA 3T3YA 2WZR3 4A3XA 3ZN5A 5JOYA 3U0ZA 4ARYA 5C71A 1GP4A 3WCRA 2ZGUA 5A7WB 1L7LA 2NLRA 3K77A 2IXHA 1QH6A 5IHRA 4BQ5A 3W5MA 1ENQA 3NAPC 4CEYA 3JZVA 2ZMKA 2JG9B 3JBG3 3POWA 4PIZA 2RMU3 2B46X 5I0DA 5JOXA 3I3BA 3ZMNA 2A5ZA 1WLDA 3WQ7A 3LFIA 4M00A 1T6GC 1WGPA 1MVQA 2OZJA 1QJX1 3GYDA 2VBBA 1NQDA 4H2AA 1YRZA 5FZBA 3IMNA 4IEUA 4D0QA 5A32B 1RITA 2I45A 5FXZA 2JE7A 5JXHA 3SHRA 1DYPA 1PVC3 4FO9A 4GIQA 3DECA 1ULCA 4GXLA 1W39A 1MZ5A 1ZA4A 2ZX3A 1EAH2 1YXWA 3TB0A 1QH7A 3S5AA 4OHVA 3AKSA 1VBD3 2XVLA 1HRI2 3LZZA 2DURA 2XVKA 3BVCA 3M3CA 3MHZA 4YYOA 1NUKA 2JEMA 5FZHA 1RUI3 1S0GA 2D6NA 2JWPA 2Y0IA 3AMMA 1V6OA 3LSEA 4N7IA 5HBAA 4SLIA 2TUNA 1IG3A 1LOEA 1YI7A 3WV6A 2JDNA 2O0OA 1VBC3 4V2WA 1IHMA 4N43C 4G9SB 2FCVA 3VHPA 4ARXA 3MW4A 1EY2A 3ZXFA 2VW1A 3SC7X 4EN7B 4XUPA 1UYZA 1DG6A 2OS2A 1RUC1 1BVP1 5CADA 1TME3 1EP0A 3PVNA 3VHOA 2IC1A 1IGOA 2R043 4IV1A 1I1EA 1NE4A 1QDCA 4WV8A 3HNMA 4LULA 2WFF2 1O8SA 2ZXQA 4GWNA 4BA6A 1PK6A 2EVXA 3IN9A 4GMP1 1DGRA 2JG8A 5HCBA 5KHKA 2JD9A 2VMGA 3RS6A 4MGKE 2V4AA 3ILFA 3A4UA 4JGZA 1T2XA 2YPJA 3VLBB 4QKFA 3SH4A 3SEPA 2PHDA 5C5UA 5K9YA 1QNYA 3BCWA 3JQXA 1R091 3NNGA 3IPVA 3T2TA 1UKGA 3ZPOA 1JUIA 2VJXA 1OOPA 2VG9A 2C24A 3VBRB 3MIGA 5ANQA 5FZKA 2ZZJA 4RA0A 1LULA 4BK4A 2E33A 3I8TA 4J1WA 3PJYA 2ZX0A 4Z07A 2R042 4JRLA 3I7DA 3KCCA 4QHOA 1HJFA 2CL2A 1LGCA 2GC0A 3VBFA 4LBQA 5FY1A 5FRAA 3KF3A 4XHBA 1SFYA 2ZGNA 3NNFA 5FZ7A 1YLLA 3I2DA 1DGWX 1JU4A 2A75A 2BERA 2WLPA 2WT2A 4PLMA 5F5QA 2EAKA 2YU1A 5AVAA 3AKRA 3ZXKA 4AI9A 3AZYA 5C7GA 1AF9A 3AYDA 4OQ8A 2PAMA 2JDKA 2QFEA 2XHNA 5IWFA 4XF9A 3ZSKA 5FY7A 2D97A 1K42A 4GAZA 4CXWA 4D6SA 4TYSA 4CCDA 2VMFA 3AZZA 3KZ4C 3VBSA 5FZDA 4IV1C 1POQA 4BQ4A 1G9CA 4Y22B 4XMIA 4RHV2 1D4VB 4Q4Y3 1YFUA 4KU7A 4CDWC 2BV4A 1VLNA 5GALA 5C3RA 2WFF3 3LPFA 1NA1A 3BPZA 1HLCA 2B7YA 2VGDA 2RS12 1VRH2 5ACA2 3O1OA 3RZHA 5FFOC 5FMBA 3HQRA 4P9LA 1RXFA 5A3TA 1POV0 5C9AB 4K21A 5L7OA 4AVAA 1JUHA 1MS0A 1TMF3 1BK0A 5I93A 4LIVA 4HPKA 1W6OA 4B1MA 1RUE3 3LWCA 3HN3A 3VD4A 5FREA 2F4LA 2VMCA 2EALA 1I5PA 2HYKA 2QQUA 5LATA 4C0BA 1O3RA 4YW1A 2PXJA 2CAUA 4LE3A 4YWAA 4GWMA 2SLIA 4OULA 5DXDA 2ET1A 4CU7A 4XCAA 3J8F3 3BUCA 1FATA 1OHFA 4QWNA 2QDRA 1MZFA 4IE4A 4LHSA 4GZ9A 5FYBA 4AEMA 2R1BA 4YRDA 4LIUA 1PHMA 1J3PA 1V0AA 4LO6B 1ZRFA 2SBAA 2DUOA 4P9IA 3WINE 4K6BA 1BYHA 2VZUA 2WN3A 3CEWA 1RUJ1 1GQPA 1STMA 3AVRA 5JXIA 4NAMA 1RL3A 4KH9A 1RYYA 4L11A 4MGQA 2BUKA 3J7HA 5KHHA 4RQPB 4C8DA 5AFBA 4CCEA 3OOXA 2WA3A 1GWKA 1UMHA 1CIWA 3WHUA 3WUDA 2ZX4A 3CHXA 1UXXX 1GV9A 2VCBA 1GZWA 4IEQA 3BU7A 3N3HA 4XC9A 4Q8KA 4K7JA 1DZQA 1UY4A 3T4VA 4DEQA 1UY2A 1N1SA 4FOWA 5ABJC 1AR62 2C9AA 2ZKLA 3U78A 1ND3B 1C8M1 2Y38A 2JB4A 5FBZA 1RUE2 3ES1A 3CZJA 4UFIA 1ENRA 3LA2A 4Z2WA 4XBQA 2RJ2A 5DABA 1XNCA 3UJQA 4QGMA 3ZXGA 5G05L 4CP9B 3L9JT 1OPOA 4S2GA 2A3YA 2H6BA 2RM21 3LA3A 4RSUA 1W9TA 5CNAA 3FWEA 4BB3A 1RXGA 1WMDA 3AX4A 4W4ZA 2XQRA 1ST8A 2B9UA 3CKHA 4MUVA 4RHV3 2GH8A 4B4RA 5LCWL 5H9RA 2I2SA 3VHRA 1AYN1 1PIV3 4PIXA 4Q4Y2 3NSTA 4YW6A 4CCNA 1VBE1 1CN1A 3S30A 1ASJ3 4YGCA 3FE5A 1IS5A 5FY8A 5FUPA 3WNOA 2BJSA 4ASKA 2ZX2A 1RMU3 4JX0A 3AP4A 3JU9A 3OTFA 1DGLA 1VBC1 3LA7A 3VZKA 4CVUA 2VNOA 2RS11 3K4AA 4FPOB 4Q4Y1 3OPTA 2BDRA 2WR9A 4UI9L 2HBTA 4AEJA 1SPPB 4WM7C 1MS1A 3O1TA 3PU3A 5IAVA 2KR2A 1R1A3 4QQ2A 2E6VA 2E7TA 3CZUA 4DO0A 3PLQA 2FBEA 4DQAA 3RWKX 5LEJA 1UOGA 3AFKA 3D82A 1WCKA 5F8PA 4YZ2A 1W9WA 2BOIA 2GZWA 5LRSA 3GZAA 3WG1A 4BQ2A 2DU0A 3C3VA 4Q29A 1KQRA 4M3CB 2WAOA 5A7OA 2HEVF 3I59B 5LA9A 1FV2A 5FYYA 2JIGA 3T0AA 3AK0A 4HMZA 1SACA 3PUQA 5T52A 5J3UA 2EAAA 1ZZ8A 4QX0A 4P9XA 5FZEA 4BMEA 3ZXJA 4FPCA 2VW2A 5I0UA 4V2VA 4RFRB 1YQCA 4TXWA 1HQWA 2C6SA 4YZ3A 2Y26A 2JX9A 5BNOC 1CAUA 5C5TA 1BJQA 1UZZA 2FQPA 3C7EA 3P6BA 5FWEA 1EAH3 2BRTA 2ZZQA 2ZGMA 4LLFA 2P3KA 3WP6A 2Y6KA 4DXRA 3BI3A 1XB9A 5HI0A 1E5SA 1MVEA 4EJRA 4NWVA 2E31A 4LBKA 2Y64A 4XF3A 3ZYPA 1CAWA 4Y26A 1OPMA 2ZBJA 2P6CA 5EP9A 5DDJ2 5JI9A 5DUVA 3VD9A 1ULDA 2QUOA 3QBQA 5GZEA 2C1FA 3THPA 4K20A 4L97A 3WDYA 4ORFA 1QIQA 4AEDB 1L3JA 3ZDVA 3GZUC 1PZ8A 4LXLA 4C1WA 4PT6A 2BWCA 2X05A 1MQTA 2JDAA 4CRQA 3M4FA 5FAXA 3H7JA 2YBKA 2P34A 1JZ8A 3O0XA 2R061 2QBXA 4MXWB 3I59A 1HW5A 1K5MB 3KT4A 1JMUB 1FPN1 5A7WA 1FX5A 4Q2FA 3CJIB 1XE8A 2AENA 2Z2SB 2CDPA 4GJZA 4HFSA 4XZUG 5C3QA 1PGL1 3NKTA 1I9RA 1WMEA 2YFZA 3I3EA 4AVVA 4UFJA 2AZ5A 1HRI1 1BCXA 1LEDA 1GFF2 5KWRA 4YLZA 4EV0A 4U2AA 2CWMA 2GAUA 4J1XA 5EJZB 4RGAA 4JC1A 3A0NA 5FBJA 5FZ3A 5FPXA 1UKRA 3E97A 1W8FA 4CSWA 5JMOA 1C3HA 1W6QA 2QQMA 1S0FA 2HEWF 3LEGA 3VBUB 3VZOA 3CJIC 3ZYJB 4QX8A 3TYJA 4Q4W3 4B29A 1RB8G 5FZCA 2PELA 5I0TA 2FHRA 1O6UA 4CDXA 3M3EA 5IATA 4QGNA 1T6BX 4W50A 2W08A 5CKNA 1VPHA 3KV6A 1ND2B 1FOD3 3PIGA 4X8NA 1IPJA 2J1UA 3ZKYA 3WG2A 1QJEA 3Q8EA 4B7EA 5EJ3A 5A7SA 1PGW2 1H1AA 1AVBA 2ARBA 1OT5A 4OI0A 2VOTA 2ARAA 4FPYA 1XNAA 2DVBA 2RDNA 2XXZA 3LGRA 2OA2A 4GALA 4LOTA 4OI2A 4CUAA 2HBUA 2Y0OA 1LOFA 4JGYB 4QDRA 5IW0A 5A3MA 4XILA 3T0DA 2HWD1 3AMHA 3BKZA 4Q4V1 5BNNA 5T5PA 5JDBA 3IBMA 1UAIA 2B9VA 4JAAA 2VQ0A 3KT1A 1GBGA 1Y3TA 4BOWA 4DRVA 3OGVA 1V9U2 2R16A 2WWSA 2Q4SA 3ENRA 1W2OA 3WXPA 5FZLA 2Z69A 4IW3A 3VZJA 1PMIA 2PMWB 2GP3A 1HXS1 5ABJB 4LMFA 3HPNA 1GYKA 4AQ2A 4CDQB 5LEKA 1NCQC 3N36A 4LBNA 1X8EA 1SLIA 4JGYC 3U4XA 1O5UA 1UX6A 1VE0A 2LS6A 3HD8B 1I6XA 1R083
chains in the Genus database with same CATH topology
1XB9A 1NLQA 4CA9A 1K5JA 1XE0A 5EHDA 2VTXA 4N8MA 3T30A 2VTXJ 2P1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XB9 A;  1NLQ A;  4CA9 A;  1K5J A;  1XE0 A;  5EHD A;  2VTX A;  4N8M A;  3T30 A;  2VTX J;  2P1B A; 
#chains in the Genus database with same CATH topology
 2DFB A;  2QQN A;  3ZYB A;  1C8N A;  2EXH A;  3LDR A;  4NMI A;  1HIX A;  1LRH A;  3VDD B;  5FYC A;  4UWD A;  1G8W A;  2KD7 A;  5T5L A;  1WD3 A;  4QPI B;  2EXJ A;  2WAA A;  4KMQ A;  1AR7 1;  4NRM A;  1GZT A;  3B94 A;  4FTB A;  1YCI A;  3NV4 A;  5FXW A;  3WT3 A;  1FMD 1;  2RS5 1;  3OYW A;  4AI3 A;  4YNI A;  4Y24 A;  3KF5 A;  4N90 A;  5FP4 A;  3MIH A;  3MGU A;  4JDM A;  3CMG A;  1XSR A;  1CES A;  2WFP A;  1FPN 2;  2J42 A;  4JHZ A;  4IGO A;  4WM7 B;  1GQH A;  4CDU C;  4E2S A;  1AR6 1;  2IWG B;  3VBU C;  2VOV A;  4ES8 A;  3POF A;  2VME A;  2ZGO A;  5FYV A;  4XYX A;  1E57 A;  3DL3 A;  4OQ9 A;  4XJ8 A;  3A7Q A;  4IV3 B;  4FQ4 A;  2OKX A;  4YAR A;  2OX0 A;  3TEZ A;  4WZF A;  1ZZ7 A;  4LLO A;  3MFC A;  3MI8 A;  4E8D A;  1S1A A;  4BIS A;  1POV 1;  2E9Q A;  1OUX A;  3CJI A;  3JUU A;  3S7I A;  1W3V A;  1GNY A;  4GKX A;  4IEY A;  2WN2 A;  1GAN A;  1TEI A;  2RDR A;  3APB A;  4CEY C;  1V6J A;  2GP5 A;  3O1V A;  2VZQ A;  1NA1 C;  1U5I A;  4DB5 A;  4Q0U A;  3NMB A;  4I30 A;  3K3O A;  3LFM A;  3RJR A;  3OGS A;  4A6O A;  3IB3 A;  2D3S A;  3QCW A;  2NQY A;  3R0R A;  4TZD A;  1OFN A;  4XF0 A;  2DVD A;  3WW4 A;  4YSF A;  2N7G A;  2NMO A;  2DCY A;  5I0S A;  4IGQ A;  2FZ1 A;  3EBR A;  4WM8 A;  4AED C;  5IVY A;  2WWJ A;  4HKO A;  1AL2 2;  2A3X A;  2YFU A;  1VAM A;  5B4N A;  4YM1 A;  4NID A;  1F5F A;  3ZFG C;  3LIH A;  3RQ0 A;  1QOO A;  4Q4W 1;  1DQ2 A;  1RUG 3;  1H2L A;  2BW8 A;  2J1V A;  1XSQ A;  2HWE 1;  3PUA A;  3VKF C;  3WCS A;  4Y1V A;  5JOZ A;  2L9L A;  3N9L A;  1FOD 1;  2VW0 A;  3H50 A;  4E4S A;  3DXT A;  5CB7 A;  5FKB A;  1MZE A;  1W2T A;  2PLV 1;  3MW3 A;  3CF6 E;  5F5C A;  4LK6 A;  3ALQ A;  4CEW A;  2VVE A;  1RUF 2;  1TNF A;  2W92 A;  2WNV A;  5DMY A;  2MNG A;  3WSO A;  4Y4R A;  1Y9Q A;  5BNP C;  1D2Q A;  1UMI A;  3GDB A;  5FIX A;  5JVV A;  3ZYF A;  2JB8 A;  1Q8O A;  4R52 A;  3LDB A;  2GNT A;  2CU5 A;  3A23 A;  4PIY A;  2D6O X;  4BDV B;  2A6V A;  2OPW A;  1EPW A;  4Q4X 2;  1UD1 A;  3OB8 A;  4MSV A;  3M3O A;  4L9B A;  4Y20 A;  5L9B A;  4PQQ A;  1PK6 C;  3AVS A;  5FJH A;  3TOJ A;  1POV 3;  5FDB A;  1JYX A;  2Y33 A;  3ZO0 B;  3SCG A;  3F95 A;  2PHU A;  2A73 B;  2B5H A;  1OA2 A;  2VU9 A;  4PHZ A;  1GOG A;  4QGL A;  3KVB A;  2TEP A;  1FNZ A;  1OF4 A;  1S55 A;  2DCZ A;  2DU1 A;  4P9G A;  4QHB A;  1WLC A;  2HWC 1;  3WDW A;  5C70 A;  5LY1 A;  4BYY A;  3ZXD A;  1X7N A;  3SCF A;  2DFC A;  3CJX A;  1MPX A;  3OGG A;  1TG7 A;  1REE A;  5EV7 A;  1RUH 1;  1F15 A;  1YUD A;  3HQU A;  2LTN A;  3NWK A;  2FMD A;  3WHT A;  1SDW A;  1YI9 A;  5FYH A;  4H14 A;  5IVV A;  3PTR B;  3THD A;  4XDQ A;  3DGT A;  3NRU A;  2P37 A;  5A6X A;  3FHA A;  4AVC A;  2YC0 A;  2RR1 1;  2Y6L A;  5FOB B;  3EMR A;  2VZR A;  1AHS A;  4NIH A;  4LHK A;  4XPV A;  2Y34 A;  4YFW A;  3AZW A;  1V6K A;  3ASI A;  1R09 3;  4Y5Z 0;  5JI7 A;  4S2H A;  3UK9 A;  4AF9 A;  5F9T A;  4QXC A;  3JQW A;  4X8P A;  3GNE A;  4NUB A;  1P8J A;  3FN9 A;  5FJK A;  3NV3 A;  1OLM E;  1IQA A;  1LOA A;  4M3C E;  2UY9 A;  4ONU A;  1NXD 1;  3BOD A;  4B8E A;  3RPQ A;  2CAV A;  3CQO A;  4LPL A;  3OD4 A;  1JYI A;  1D4M 1;  5IK4 A;  1GP5 A;  2VTX J;  1Z7S 3;  4JGZ C;  1JTZ X;  3GBG A;  4JDN A;  4XDO A;  2VXR A;  1CJP A;  2C26 A;  2I74 A;  2E26 A;  1RC6 A;  3OUI A;  4OI4 A;  2Q8O A;  2DVA A;  4XIK A;  1F2N A;  2XJR A;  1AL2 3;  3B69 A;  5DDJ 3;  4MH0 E;  1GSL A;  2VVD A;  3H3Z A;  1TME 1;  4DIQ A;  4BWO A;  1XXN A;  5CFC B;  4AFC A;  3MLK A;  1KJL A;  4AI1 A;  5BY5 A;  2LAL A;  2D5F A;  2KXL A;  3LF7 A;  4XE9 A;  3GJB A;  4M4P A;  2VC9 A;  5JLV A;  3I2O A;  2D7F A;  2XON A;  5LW9 A;  3DKQ A;  5JOW A;  4K1Y A;  2JDU A;  5CYY A;  1XPW A;  2QZ3 A;  3H3U A;  4P9W A;  2Y8K A;  3AL6 A;  4HKL A;  2VCC A;  3T1L A;  4PBO A;  5EZW A;  3TEX A;  4BK5 A;  3AJY A;  1PM7 A;  1RUO A;  1QQP 1;  2WIN B;  4JQR A;  2BVV A;  4AXO A;  2BBV A;  1NZI A;  2Q0A A;  2J22 A;  1U5Y A;  3FFQ A;  3PL0 A;  4A7Z A;  4PI2 A;  3H8U A;  3O1S A;  5BXX A;  1TZO A;  1QKQ A;  3D8C A;  4DFS A;  1RUJ 2;  3OSD A;  1IPK A;  1HDK A;  5LK5 A;  2VO5 A;  3O0W A;  5FPA A;  5F7U A;  1LGN A;  4MVT A;  2VCA A;  4G4F A;  1D0H A;  5CU1 A;  1JOP A;  3VDC A;  5GKA C;  4AG4 A;  3LCP A;  4HKW A;  1OF3 A;  5AVP A;  1QGL A;  1H30 A;  4FPE A;  5LZ6 A;  5KR7 A;  4LBQ B;  4EWD A;  2JG8 B;  5IK5 A;  1UZV A;  4AFB A;  2VR4 A;  2VMD A;  3HNB M;  1CON A;  1Q43 A;  4I09 A;  1CIY A;  4UBH A;  4X6R B;  5LBE A;  3WX5 A;  3SXW A;  4NHY A;  2ZMN A;  4LBM A;  1RUN A;  3ZOI A;  4IE7 A;  2VM9 A;  3AMQ A;  3Q8A A;  1H6X A;  3KMH A;  4UBG A;  4IV3 C;  2E32 A;  2ZTN A;  3R05 A;  4QKB A;  1OOP C;  4GH4 A;  1UXZ A;  3A0K A;  4IL7 A;  1F35 A;  2HWF 2;  2G1M A;  4WVZ A;  3OGR A;  2CV6 A;  1DP0 A;  3LAG A;  4GD4 A;  4XMA A;  2XR4 A;  5CVR A;  5IYY A;  1O4Y A;  2VL4 A;  1W28 A;  1LES A;  4H3W A;  1V9U 3;  2FCT A;  5I8Y A;  2B42 B;  4ATE A;  5J1X A;  3B5L B;  2AAC A;  4YM2 A;  5LA2 A;  1W6P B;  5A1F A;  1MS9 A;  3AZX A;  1O4T A;  1UZY A;  4FP2 A;  4Q4X 1;  2R0F A;  5ERL A;  3SKV A;  1GR3 A;  4A41 A;  1Q8S A;  3WF3 A;  3WP5 A;  2WQZ C;  4EN6 B;  2MEV 1;  2W3J A;  4AAP A;  2YMZ A;  1AR8 1;  4XAE A;  4UF0 B;  1B35 B;  4E4Z A;  1NQJ A;  1WMF A;  1IS3 A;  5IVB A;  3QLQ A;  4WM8 C;  2HWD 2;  4AED A;  3GHM A;  4IEZ A;  4OHW A;  3GHN A;  5BNP B;  4AQ6 A;  4Z1V A;  4MOA A;  4HK8 A;  4XTM A;  3ZN4 A;  2CHH A;  1RJ8 A;  3PIJ A;  2DVG A;  2HLE A;  5EFU A;  4B4P A;  3POB A;  5A3N A;  1QXR A;  1UIK A;  3U4S A;  3TN9 1;  3JBG 2;  3W21 A;  1VBB 1;  1PVX A;  2VZ3 A;  5DZG A;  2CNA A;  4R9A A;  2ZOE B;  2BU9 A;  4KG8 A;  4CXX A;  1G9F A;  5D8A B;  2R06 2;  1S4C A;  3M70 A;  1HKD A;  1BEV 1;  4BLJ A;  5A6Q A;  1XOY A;  1YIF A;  3WR0 A;  2NZ9 A;  4LA2 A;  4TWT A;  1UU4 A;  4RN5 A;  5C8W A;  1HN1 A;  4QD2 A;  3ZR5 A;  1WD4 A;  3U75 A;  3PVO A;  2GND A;  3SEE A;  4ATF A;  1RVF 3;  1N1T A;  3WDX A;  2RV9 A;  2P6H A;  1VBA 2;  2ZGK A;  4G3Y C;  2HYX A;  4PF1 A;  3ZSM A;  1ND2 C;  1RMU 1;  4OMC A;  4XQ4 A;  3RRD A;  4UW6 A;  4RQP A;  5F39 A;  5KHG A;  3N7M A;  4CUB A;  4LK7 A;  4B1L A;  1ACC A;  2R0H A;  5GZC A;  1HRV 1;  3OBA A;  2YYO A;  2JE8 A;  3OCP A;  2NM1 A;  2BGC A;  1C5I A;  4A44 A;  4I3P A;  1C5H A;  1OVP A;  1COV 1;  5G04 L;  5FZA A;  4O7X A;  1VBA 1;  2RDQ A;  1OH4 A;  2AUY A;  3J8F 2;  4L0P A;  1PVC 2;  2BBA A;  5IFP A;  1WLT A;  4XCB A;  2RVA A;  4CDU B;  1ULF A;  3EQE A;  3KWV A;  2D3R A;  2ZHN A;  3DYO A;  4EN8 B;  4LKE A;  1QNW A;  2XWJ B;  4R9B A;  1FAY A;  3WF4 A;  1OQD A;  1YEW A;  1G7Y A;  2BP6 A;  5IT6 A;  3OY8 B;  3R4U A;  4LBJ A;  2JDZ A;  3JXS A;  2LRO A;  3DPR B;  3F2Z A;  4Q4X 3;  3AL5 A;  4ET7 A;  2UWC A;  4DXT A;  2VTF A;  3FLP A;  3PU8 A;  4R9D A;  5D21 A;  4FPJ A;  1D4M 2;  1V6I A;  2YRO A;  3WF2 A;  5E88 A;  3CU7 A;  5CBL A;  1PMH X;  3UL2 A;  4ISQ A;  1UY0 A;  3HQX A;  1GZW B;  1W6M B;  5FKC A;  4WVM B;  1GOF A;  4Y20 B;  3VB9 A;  3VBO B;  1DFQ A;  1NCQ B;  2RS3 1;  4AGV A;  3FHQ A;  2EXI A;  5K0U B;  3NNM A;  3D0S A;  4XFH A;  5F3E A;  2UY8 A;  2CGP A;  1C1L A;  3MPP G;  3BN6 A;  4PQ9 A;  2MEV 2;  4CZS A;  4ZS2 A;  3FMG A;  1E5H A;  1NY7 1;  2YC2 A;  2EIG A;  3FHI B;  3L2Y A;  3RGB A;  1WWY A;  2CTV A;  5T54 A;  1RVF 2;  2XUE A;  1GNH A;  3FLR A;  4JTN A;  2JG9 C;  3OEA A;  4YG6 A;  2WNU B;  4AK3 A;  1SPP A;  3ZDS A;  4NOT A;  2D6L X;  4AFD A;  5AC9 3;  5FZ6 A;  1KGY A;  4ZPI A;  4LA3 A;  3RZZ A;  5LY2 A;  4JDO A;  1O3T A;  2VH9 A;  5A3O A;  5K0U C;  3VBH B;  4AOC A;  2R06 3;  2VUJ A;  3JD7 3;  3BPS A;  4IE0 A;  3RG0 A;  1QJU 3;  3VBO C;  3ZFF C;  1F4A A;  2R1D A;  2V5D A;  3V0B B;  1YFX A;  3ZXA C;  4EN0 A;  2DTY A;  4LOS A;  1LHW A;  1DZR A;  1RIN A;  3FZ3 A;  5FYS A;  4E4H A;  1A34 A;  1WA4 A;  1APN A;  4XHX A;  2DBN A;  2IXI A;  1R08 2;  1G9D A;  1UOB A;  1RUH 3;  2ORZ A;  5LRR A;  4CEY B;  2D6P A;  2J1S A;  1OUS A;  1QJY 2;  1A8M A;  5F2W A;  5T55 A;  2BNN A;  4MHU A;  1HB3 A;  2P5B A;  2PTM A;  1QEX A;  1HRV 2;  3P1I A;  5KHI A;  4LHN A;  1JZ3 A;  1ZYB A;  2ZAH A;  4RFT 0;  4AI0 A;  2E51 A;  4NN0 A;  1CJD A;  3THT A;  4LTA A;  4QXH A;  1SBF A;  1S2E A;  4FCA A;  4Y5T A;  3WW3 A;  2Y6H A;  2W1U A;  3D6E A;  5SV8 A;  1W0P A;  1RUD 1;  2VUD A;  2VBP A;  4HSJ A;  2O14 A;  3HJR A;  1CAX B;  3LEI A;  4M3C A;  3UES A;  2GMM A;  3WEZ A;  2W1W A;  5A70 A;  5IK8 A;  2DCT A;  3ACI A;  4N53 A;  2H6C A;  4IEV A;  4YPJ A;  1GKB A;  3NAP A;  3NJZ A;  5HCF A;  4RYD A;  4ASL A;  2WNV C;  2OVU A;  1PGL 2;  3VDD C;  3OBR A;  1AL2 1;  4LO8 A;  1WCD J;  3WQ1 A;  2VOK A;  1OVS A;  3AP5 A;  1JOJ A;  1BQP A;  3MF9 A;  4XQW A;  3TBD A;  3C2U A;  3MLJ A;  3BIW E;  4KG0 A;  4NIG A;  1H4H A;  2FCU A;  1C4R A;  1DQ4 A;  1R1A 1;  2VNV A;  1D7P M;  2DCK A;  1JOD A;  4MGY E;  1AX2 A;  4LT5 A;  4GMP 3;  5FY4 A;  3H42 B;  5D8A C;  2CYF A;  2ZGS A;  4OI1 A;  4QQL A;  5TSW A;  5BNO B;  2RJK A;  3O0V A;  4NVP A;  4GWJ A;  4AHW A;  3USU B;  1QJU 1;  1KRI A;  5L9V A;  2PHF A;  3MDP A;  2GMP A;  4GQ7 A;  1XRU A;  4HVQ A;  1Q56 A;  1RUG 1;  2X53 S;  3U07 A;  4FBF A;  1C8M 3;  4CCJ A;  1YHF A;  1J1L A;  1Q8P A;  1OSG A;  2DF7 A;  2ZGQ A;  3GCX A;  4CU8 A;  4B4Q A;  4Q0V A;  3KQ4 B;  4DPN A;  2XQX A;  5L73 A;  1F5J A;  1H0B A;  1MEC 2;  2J7M A;  1RUI 2;  3I3D A;  1ZM1 A;  3BTX A;  3VBF C;  2QJV A;  3BAL A;  2VD7 A;  1NZC A;  5DAP A;  4O9G A;  4N53 C;  3HN1 A;  4FAH A;  3UNP A;  1UU5 A;  1XC6 A;  3VBR A;  4AFA A;  3LPG A;  2LW8 A;  1IOA A;  2OXB A;  3NVC A;  5F6K A;  4ZS3 A;  5FYZ A;  3VDD A;  3RVH A;  4H7M A;  1CD3 G;  1NAE A;  2WC2 A;  2X29 A;  4I3G A;  2WNE A;  4COW A;  2VQA A;  3ZXL A;  4CA9 A;  2ARC A;  3C8X A;  2Y6G A;  1CZT A;  2E53 A;  1HN0 A;  1OQE A;  4BLI A;  4FOV A;  2JXA A;  3OD0 A;  1JZ2 A;  3L2H A;  1RTV A;  3ZIW A;  2B4K A;  1VRH 1;  4IEO A;  5ACA 1;  1HRV 3;  4K3U A;  2JG8 C;  1ZZ9 A;  3ILR A;  1QU0 A;  1PNF A;  5B4X A;  2XPJ A;  2BNO A;  4IET A;  1NE6 A;  1U5Z A;  1S0E A;  4IE5 A;  3ABZ A;  1R09 2;  4Q27 A;  1FI2 A;  5FP9 A;  1H2M A;  4XF1 A;  3KGL A;  1VMH A;  1UO9 A;  2VUL A;  2ZAC A;  4CCC A;  4L92 A;  5H9S A;  1W04 A;  5JMC A;  3ZFE B;  3I97 A;  5CG9 A;  1GOH A;  1TE1 B;  3N7K A;  2J1A A;  2JDM A;  1WLW A;  4NRQ A;  1Z78 A;  5FY0 A;  2RHP A;  3ME2 A;  4CP9 A;  5H9P A;  1JBC A;  3WNK A;  3ES4 A;  1VBD 1;  2VOX A;  2P3J A;  1CPN A;  5F5A A;  3LE0 A;  3ZSL A;  4JCK A;  1YWK A;  2OII A;  2VPV A;  2VQU A;  3GAL A;  2ZKN A;  3J8F 1;  4BE3 A;  3NO8 A;  4QT6 A;  5APA A;  2Q1Z B;  4IND A;  3WNP A;  3S57 A;  4YVS B;  3MYX A;  3POJ A;  5FP8 A;  1RHI 1;  3HBZ A;  1ND3 C;  4QDS A;  2WO2 A;  5F2S A;  1VIW B;  2XLF A;  3P3P A;  2D5H A;  1XE7 A;  2P4E A;  1XU1 A;  2F17 A;  2Z5W A;  1IPS A;  1AR9 2;  4EWA A;  2WUH A;  4BQX A;  3UGH A;  3UET A;  1UNB A;  1JS9 A;  1G86 A;  2WRA A;  2XJP A;  1GMM A;  3HOB A;  2QDN A;  2B45 X;  3K46 A;  5JIU A;  5DZE A;  5J36 A;  5ISL A;  1UL9 A;  2A7A A;  2VUA A;  2TNF A;  3LSD A;  5F3I A;  4L8Q A;  5L7O C;  2GNB A;  3O1R A;  1NCR A;  5T50 A;  1DGR N;  3UGF A;  3S0M A;  1UOF A;  1J83 A;  3K48 A;  4KL1 A;  4DZG A;  1YJK A;  5A7N A;  3GXU A;  3UV9 A;  4FI9 A;  2WO1 A;  5FZ9 A;  3RYK A;  5IFT A;  1E5R A;  4QQP A;  5C8C A;  3D5O A;  5FK7 A;  4Q8L A;  4Y4Y A;  4IGP A;  4L99 A;  2J1E A;  2V4V A;  5F1R A;  1H6Y A;  2YY1 A;  1N3O A;  1NCQ A;  4JRA A;  1YJL A;  1ODN A;  2XHK A;  2X5I B;  5FZO B;  1W9S A;  1SDD B;  1UOJ A;  1JZ4 A;  4CU9 A;  3A21 A;  5FPZ A;  4IES A;  2W91 A;  3BGA A;  4PF5 A;  2D6M A;  3MZH A;  2WS9 1;  5C9A C;  3WF1 A;  5DUU A;  4KI5 M;  5JZG B;  1ZBA 3;  1UIJ A;  1QWR A;  1S2K A;  2WLQ A;  3S6P A;  3PHM A;  4DUX A;  3O1M A;  1W2N A;  3IPV B;  5F37 A;  5CG8 A;  2GNM A;  5A6Z A;  4P5H A;  4Q0P A;  4Y1Z A;  1W0N A;  1PZ7 A;  3N9O A;  1X9P A;  3T08 A;  4ZU4 A;  1ZBE 2;  4N43 B;  5IJR A;  1DQ5 A;  3ZM8 A;  3V0A A;  4IV1 B;  4Q0Q A;  3E6D A;  3OPW A;  4BIO A;  3U14 A;  4YM3 A;  4UW5 A;  2OW4 A;  5FQ0 B;  3ZYI B;  1ZRI A;  3MBW A;  4PDW A;  5IVJ A;  2PHR A;  5A3U A;  2QCS B;  3K75 B;  3VL8 A;  1UN1 A;  4P00 B;  1B09 A;  3N7J A;  4R4Z A;  1V6L A;  4HVR A;  4HT1 T;  1BVV A;  2E7Q A;  2ES3 A;  2QTW B;  3Q8F A;  3C7F A;  2WNU C;  2R32 A;  1HV1 A;  3H3L A;  2PHL A;  3J4U H;  2H0B A;  4AQS A;  3CNA A;  5FZI A;  4FFH A;  1LB2 A;  3SKJ E;  5FWJ A;  1OH3 A;  2QQW A;  4LO4 B;  1CZV A;  1OFS A;  4XW3 A;  3OPZ A;  3VBS C;  4CDU A;  3NKG A;  3U37 A;  4F83 A;  2CGO A;  4MGI E;  3FLT A;  1AYM 1;  1W8H A;  4O61 A;  4QDQ A;  1AR8 3;  1NKG A;  3KM5 A;  4HLT A;  2X8K A;  5EYX A;  3OY8 A;  5GZD A;  3VN4 A;  5I0R A;  2P3I A;  3W58 A;  5LA0 A;  4CP1 A;  4OZO A;  4V1P A;  5CAZ A;  1YO8 A;  3BTY A;  2XJQ A;  1LHN A;  1VP6 A;  4CP2 A;  2C0Z A;  2AYH A;  5C8C C;  5FQ0 A;  3USS A;  3I49 A;  2FD8 A;  4CXY A;  2Q8C A;  4GB3 2;  3AKP A;  5FYI A;  1OA3 A;  4Y5S A;  1AXK A;  2AEY A;  2K0G A;  1N1V A;  1W2A X;  3QH6 A;  4XUR A;  3K4D A;  1NLQ A;  4Y22 A;  4YW7 A;  4RR3 C;  3WNL A;  1NOV A;  3N9P A;  3VDB A;  4K9S A;  3ZKU A;  2WJS A;  1HV0 A;  1KXG A;  1CVN A;  1XYP A;  4QB6 A;  1ODM A;  3D4K A;  4F7Z A;  5JAX A;  4LO5 B;  1SLB A;  3OYW B;  2DUP A;  1DHK B;  3PUS A;  5EXO A;  3NJX A;  4MAD A;  1DLL A;  1LJ7 A;  2PAE A;  3T4H B;  2E7A A;  3ILN A;  4XBN A;  1AXY A;  4H7L A;  4LEJ A;  3B3Q E;  3ACF A;  1ZBA 2;  2XJS A;  3C7G A;  3OG2 A;  3M3I A;  3ZYG A;  5GLU A;  3ZFG A;  3G6J B;  3ZR6 A;  2IZW A;  4A45 A;  1JZ6 A;  3MUZ 1;  2UWA A;  3WDU A;  1FNY A;  1TMF 1;  3EB7 A;  3POG A;  4YM0 A;  5FTT C;  2OYZ A;  4XAC A;  3WOG A;  4WBB A;  2OZ6 A;  2WYS A;  1MR5 A;  4DEV A;  1ZRC A;  3EYP A;  4AVS A;  1J84 A;  3RYP A;  1UF2 C;  1QOS A;  4XIO A;  1RHI 2;  1G9B A;  2XDV A;  3M2M A;  1QXP A;  3OJB A;  3H8O A;  5FPL A;  4CCL A;  5EQU A;  5JR7 B;  2WII B;  3NJV A;  4HPK B;  4JQT A;  3WW1 A;  4QXB A;  2JKB A;  1DF0 A;  2ENR A;  3ORJ A;  4NHM A;  5K4L A;  5J37 A;  1W05 A;  1R1Z A;  1WCU A;  2PQQ A;  3N7L A;  4LJH A;  2XLA A;  5DAQ A;  3AYC A;  2ID4 A;  1TQ5 A;  4P14 A;  4HZF A;  1GP6 A;  2Q1M A;  4Q0S A;  2DCJ A;  3AP9 A;  4CCO A;  3B93 A;  3M3Q A;  1M4W A;  2XLG A;  3H1Y A;  4ZZ8 A;  5C3S A;  4N9I A;  2VNR A;  3ETP A;  1ZZ6 A;  5FCC A;  5FY9 A;  3M7A A;  2VXJ A;  3CBN A;  1EYB A;  5JXG A;  3ST7 A;  2PHW A;  3FUQ A;  1LEM A;  4CDX C;  2WZE A;  4KWL A;  3AZV A;  1OLM A;  2QVS B;  1S0J A;  2ADD A;  5A32 A;  1CQ9 A;  5AC9 2;  4XFG A;  2DWR A;  4OUE A;  5LBF A;  4AVB A;  4K8R B;  5FZM A;  3ELN A;  4ZXE A;  1X82 A;  4YGB A;  1F31 A;  2HWC 3;  2RM2 2;  4CP0 A;  5E6H A;  2BTV C;  1H2K A;  1QF3 A;  5FO7 B;  2X09 A;  5BNO A;  3SH3 A;  5C4W C;  1LU1 A;  3MFA A;  5FO8 B;  4KNC A;  1OKQ A;  4LNV A;  4P9J A;  2XL7 A;  2IVI B;  1OLR A;  1JHN A;  2BNM A;  3GCW A;  2RS3 2;  4GH4 B;  1O7F A;  5EIY B;  1CWP A;  1RUF 1;  3K3N A;  1JI6 A;  1D2S A;  2GC2 A;  3AKT A;  5GLZ A;  5BYN A;  1IS4 A;  1UWW A;  4GA9 A;  4AZZ A;  1FOD 2;  3M1H A;  3WNX A;  2YU2 A;  2YZ4 A;  1ZX5 A;  1GZC A;  4MYE A;  4KQ7 A;  2NN8 A;  2D43 A;  4QPI A;  5A3W A;  1LOF C;  1W6P A;  1H8V A;  2I07 B;  2BFU L;  2AH2 A;  3AJZ A;  2R07 1;  1MS4 A;  3IDC B;  3VL9 A;  5FZG A;  3TEW A;  4IXL A;  4XJA A;  2QQJ A;  3HBK A;  2WQ8 A;  2GDF A;  1Q8V A;  1BHG A;  1O5L A;  1CAU B;  5C33 A;  1HQL A;  1K12 A;  1ONA A;  4HG6 B;  5HV0 A;  1N3Q A;  1IQD C;  2W5F A;  3WQ0 A;  4E2Q A;  1BLZ A;  5DZF A;  5JPM B;  3VBF B;  2HWB 3;  1JN2 P;  3DV8 A;  1V6N A;  5L7O B;  4YGE A;  1ZZC A;  5FMO S;  3III A;  2D44 A;  5GLV A;  1NX9 A;  4MO3 M;  4XET A;  4YVS C;  2ZJC A;  1DIW A;  1CAV A;  1WCQ A;  2O8Q A;  2Z4F A;  3U1X A;  1F8V A;  4CU6 A;  2BVB A;  2VVF A;  4CDQ C;  4QMA A;  3LDK A;  2FDH A;  1JYV A;  1SBE A;  2ERF A;  4YG0 A;  1Y9G A;  5DUX A;  2R7E B;  4OHZ A;  4ZZ5 A;  3RZM A;  3JBG 1;  2XL9 A;  3TN9 2;  3S7E A;  2FDG A;  3GZT B;  1RUC 2;  1W90 A;  2ORX A;  3SIS A;  4QXK A;  4ASM B;  3ZYR A;  2RE9 A;  2GN3 A;  3DUI A;  4LBO A;  1REF A;  5CIR A;  1S0C A;  1ENS A;  4RGG A;  4CDW A;  4MHR A;  1ZBE 3;  3LQC A;  3LB9 A;  5A3P A;  4Z8B A;  4PJY A;  5FPV A;  5C9A A;  1C28 A;  1NLR A;  1VBB 2;  1W03 A;  3GF6 A;  4LUK A;  5T5O A;  4C90 A;  1AR7 3;  1RUD 2;  4X6Q B;  5GZF A;  1VJ2 A;  3DN7 A;  4DUV A;  1WBF A;  2ET7 A;  3GZE A;  1IKQ A;  4AHZ A;  1IS6 A;  2ZEX A;  4FPL A;  2Q8E A;  4TN7 A;  3IZO A;  1ZRE A;  1BEV 3;  2P3Y A;  1LEC A;  1JYN A;  5JZG C;  3V0B A;  1YQ8 A;  4ZU7 A;  1J1T A;  3RJ2 X;  2W9X A;  3AP6 A;  1K5M A;  2P1B A;  4IDZ A;  3WP4 A;  2B39 A;  4NPM A;  4AR2 A;  2XGX A;  2YXS A;  4LUM A;  4W6W A;  1X8M A;  4Q4V 2;  1DBN A;  1Y7B A;  2X5I C;  3ZSJ A;  5AC9 1;  2G19 A;  3FX3 A;  3TNP B;  3V56 A;  3Q8C A;  1I5Z A;  2JD4 A;  2W1S A;  1QDO A;  4J25 A;  3BTA A;  1LGB A;  1LOC A;  1AXZ A;  4OHX A;  2ARX A;  4XJW A;  1FPN 3;  1H8T A;  3JD7 1;  4NII A;  4D7S A;  1LHV A;  3AFG A;  1C1F A;  4WZC A;  4E8C A;  4I0B A;  1WKY A;  4XDP A;  2VOW A;  4TSV A;  4A4A A;  1CAX A;  1AJK A;  1WW5 A;  4PLO A;  5F3C A;  1SEF A;  3RZJ A;  3CLP A;  5T5J A;  3IMM A;  3QAC A;  4A7K A;  5LBC A;  5FY5 A;  4COZ A;  4N53 B;  1KDM A;  3KCY A;  5ABJ A;  2CWS A;  1SLT A;  1ZNP A;  3INA A;  4YG3 A;  4YW2 A;  2AGS A;  1AYM 3;  3MIB A;  2EIB A;  2OPK A;  2ZX1 A;  3K51 A;  3RYR A;  1ZRD A;  2P17 A;  1JOB A;  1OD5 A;  4AE2 A;  1OC1 A;  4GWI A;  4XUQ A;  1SLL A;  5BNN B;  4LR4 A;  4QM8 A;  4LE4 A;  1Q3E A;  3LIG A;  1VBB 3;  4QQH A;  4R4X A;  4AL9 A;  5BNN C;  3K4Z A;  4OCT A;  2BOJ A;  5DG2 A;  2O8O A;  4FFF A;  1UU6 A;  4F8A A;  4P5Y A;  5BNQ A;  3B01 A;  1O8P A;  5LK7 B;  2BFU S;  1KS5 A;  3R4D B;  3VZM A;  1A6C A;  2DDU A;  2XG3 A;  2DTW A;  3SQO A;  5EJ1 B;  2WDB A;  4RQP C;  3HAG A;  3V65 A;  2VUC A;  1S2B A;  1Y9M A;  2W46 A;  1RUC 3;  5FZO A;  1ULG A;  3IAP A;  5FYU A;  3KQR A;  5JCT A;  1DZT A;  1EV1 2;  2WFF 1;  4OHY A;  4UYB A;  2B8M A;  3RFR A;  4XXA A;  5FZF A;  4Y1Y A;  3OGJ A;  1YFY A;  4AYU A;  5L19 A;  2PFW A;  4NPL A;  1DCS A;  4AEK A;  4LKS A;  4DMI A;  2VMI A;  2ZPX A;  4IQP A;  5FMD A;  3U10 A;  2EF6 A;  5GLW A;  4A7Y A;  2J1T A;  1JZ5 A;  2XJT A;  2WZR 2;  1V6M A;  3TWI A;  3FC0 A;  4W6Y A;  2PYT A;  2D98 A;  4FOY A;  4I0W B;  5FZ8 A;  4CTE A;  2PAK A;  5CFD B;  2P2K A;  5EPA A;  4RR3 A;  1QMJ A;  3BOP A;  3O5S A;  5FYM A;  5HPO A;  2XWB B;  1VBA 3;  5EYY A;  5K8S A;  2WAB A;  1DGW A;  1SFP A;  4TLF A;  2HJI A;  4I02 A;  1A8D A;  1FYU A;  3LD8 A;  2D40 A;  3VD5 A;  4OFG A;  4XBL A;  4BHP A;  5FMC A;  2H0V A;  4XUO A;  4JV4 A;  2ZHM A;  5FK8 A;  4PDW B;  3VUO A;  3RZK A;  3KB5 A;  4I01 A;  1LHU A;  4AVT A;  1W8U A;  4BQY A;  1K5M C;  1RUF 3;  2DUQ A;  4XAB A;  4U36 A;  4JVA A;  3KV4 A;  1UYP A;  1XYN A;  5IVE A;  1VB2 A;  1GUI A;  4FXG B;  4GUL A;  4XJZ A;  1CR7 A;  4QPI C;  1NG0 A;  2HWF 1;  3N9M A;  3RWN A;  2FZ2 A;  4MGZ E;  3O12 A;  4GMP 0;  2HWD 3;  3EHK A;  4XJ9 A;  4A2U A;  4AQT A;  2YBP A;  5DAW A;  2WA4 A;  2XVG A;  3URF A;  5C3O A;  5LWB A;  2Y6J A;  3ITQ A;  3I3Q A;  3LKJ A;  4CEW B;  1H8T B;  1N3P A;  1KFX L;  2VNG A;  1QHD A;  3BOW A;  4OUS A;  1FT9 A;  1PGW 1;  4NJ4 A;  4BM8 A;  4JZR A;  3G7D A;  3E1F 1;  1VBC 2;  4FTE A;  2WT0 A;  4UW4 A;  3HNY M;  2K9Z A;  4OYU A;  1HB1 A;  3T1M A;  2YBS A;  3E6B A;  4NHL A;  1WMX A;  5A33 B;  3J7L A;  4UFH A;  4AI2 A;  1HXS 2;  1RIR A;  1WW7 A;  1DQ1 A;  3N35 A;  3EJK A;  1HRI 3;  1QQP 3;  1W3X A;  4FQZ A;  3BU0 A;  1XND A;  1YQ2 A;  1AL0 G;  4CEW C;  3T2P A;  1XJA A;  3W20 A;  1UCX A;  2UWB A;  3P3N A;  2JIC A;  5FLH A;  4MV2 A;  1X33 A;  1O4Z A;  1PNG A;  2VCM A;  1JW6 A;  2JKX A;  2WNV B;  3W5N A;  2UYB A;  3MID A;  4MLO A;  2RM2 3;  5CKQ A;  1VAK A;  1SMV A;  4JKL A;  4JTO A;  3I2K A;  4ERO A;  2DVF A;  1MAC A;  1CAW B;  4XF4 A;  4YW4 A;  1S0B A;  2PLV 2;  2BQP A;  1AX0 A;  4PCR A;  4A3Z A;  3OUJ A;  2ZGT A;  1EUT A;  5DUW A;  1LOG A;  3PJQ A;  2C4X A;  4QU2 A;  5GLT A;  3WP3 A;  2QKD A;  1JXN A;  2W52 A;  3CO2 A;  1MEC 1;  1QOT A;  4RD7 A;  2WL1 A;  2JDY A;  4LBL A;  4Z92 B;  5I91 A;  2F6B A;  2VEC A;  5HCH A;  4R9C A;  1YQ5 A;  4WVV A;  1XBF A;  4DUW A;  3KV5 A;  5J09 A;  1M06 G;  3P5B A;  4ZXK A;  1VR3 A;  1CAV B;  3HVD A;  5FUI A;  4XTP A;  1RMU 2;  4W65 A;  5DAV A;  4DRR A;  3SH5 A;  3HT2 A;  3AC0 A;  1UY1 A;  1MS5 A;  3EO6 A;  4GH4 C;  1SFN A;  2WNU A;  4XAA A;  3IKW A;  5DQ0 A;  1TMF 2;  2R30 A;  4MXV A;  4M3C F;  1QJU 2;  4BCU A;  4MGT A;  3DXU A;  1W2U A;  3NL1 A;  5BUV A;  2XJV A;  3KLS A;  3MUY 1;  1GWL A;  1YYN A;  3O1U A;  4D8M A;  1WUV A;  3ZFF B;  2VZV A;  1R1A 2;  1V00 A;  2IXK A;  3PVE A;  2FDK A;  2WT1 A;  4LBQ D;  4TTG A;  1UX7 A;  3E5Q A;  3IDA A;  3I3M A;  1GU3 A;  2HEY F;  5F6L B;  1AR9 3;  3SCH A;  2XBO 1;  5C8C B;  1H1I A;  4NRO A;  3VD3 A;  1R08 1;  4IEX A;  5EWS A;  1Z0H A;  3ECQ A;  4CDX B;  4WVW A;  3J7M A;  1H4G A;  3ZIX A;  3POY A;  2YUE A;  3AMP A;  4PLN A;  1RUH 2;  1SCS A;  3KT7 A;  3TN9 3;  2ADE A;  5KXE A;  3PUI A;  3BTZ A;  1BEV 2;  4SBV A;  3ACG A;  4CPB D;  4KWJ A;  3FJS A;  4I2O A;  4YZ5 A;  4EZH A;  4UFL A;  2OUJ A;  3JD7 2;  1E5I A;  4HL0 A;  3VBS B;  4EZ4 A;  2EID A;  2WBK A;  1K5J A;  3VKM A;  3E6C C;  4NPR A;  4JGY A;  1FV3 A;  1OBN A;  3UGG A;  1J3Q A;  1HB2 A;  5DG1 A;  5JZG A;  2NYY A;  4HBN A;  1AR7 2;  1RUD 3;  4P08 A;  4FSJ A;  1ASJ 1;  2PLV 3;  1PO1 2;  1PX3 A;  2VZT A;  3A22 A;  1B35 C;  4E2G A;  3H1W A;  2GME A;  3WVJ A;  1EAH 1;  1US2 A;  2WZP P;  1K3I A;  4A42 A;  1J58 A;  1Y4W A;  2W68 A;  3E5X A;  5FOJ B;  4QHZ A;  2GC3 A;  3B00 A;  5F32 A;  4COY A;  4XUT A;  3MV0 1;  4S2D A;  1K45 A;  3JCI A;  1BBT 1;  2J1R A;  2V09 A;  2BPA 2;  4R8H A;  1UPS A;  1XQN A;  5DN2 A;  1ASJ 2;  2KA3 A;  2DV9 A;  4FXK B;  3PVB B;  2ZHL A;  4UFM A;  4ZON A;  3POE A;  5A7Q A;  3NV1 A;  3U11 A;  2JE9 A;  3EXU A;  2PN5 A;  4BJ0 A;  4GJY A;  1UZW A;  2RDS A;  5FMO L;  2QQK A;  4QPW A;  4YW3 A;  3HWJ A;  2EA7 A;  4LHL A;  1BMV 2;  4FPG A;  4HN1 A;  2ZHK A;  1UMZ A;  2W0X A;  1RUE 1;  3MW2 A;  2YGL A;  1UY3 A;  4K8F A;  5IVC A;  1JYW A;  5DPN A;  1LKN A;  4CUG A;  4XEZ A;  4D3W A;  3IIA A;  1KD7 A;  2ZEW A;  2CSG A;  3VZN A;  1DQ6 A;  3B9C A;  1MS8 A;  2AC1 A;  4HET A;  1WCS A;  3ZN6 B;  2HKX A;  3VZL A;  1DYK A;  3LEK A;  5FPB A;  1IZ3 A;  3I2J A;  4MGS A;  5D2A A;  5FPU A;  4CDW B;  2JDH A;  4QQO A;  1AUY A;  2G4I A;  3HR9 A;  3MF6 A;  4FFG A;  1G9A A;  1MEC 3;  3V64 A;  3J26 N;  1S0I A;  3H8R A;  1DDL A;  4PBP A;  3MIF A;  4Q5O A;  2QQO A;  4IE6 A;  1H1M A;  4XFA A;  1ZBA 1;  1SHW B;  3I2I A;  5IUQ A;  3RZG A;  1EV1 3;  2UU8 A;  3LEM A;  1PO2 2;  3R6S A;  3B9I A;  2Z42 A;  1UPI A;  2A6Z A;  3SMH A;  1S0D A;  5CA6 A;  5CFC C;  5EHD A;  3S5Q A;  3T2Q A;  4CPB A;  1JYC A;  2W47 A;  2A6X A;  3ZPY A;  4AAX A;  3RNS A;  4AGG A;  2XJU A;  2D6K A;  3WDV A;  2WZ8 A;  2RS1 3;  4WM8 B;  4XFC A;  5CIS A;  5JSR A;  1US3 A;  1WZX A;  2VTX A;  1HB4 A;  2RMU 1;  2XB6 C;  5DDJ 1;  5JUV A;  1UYY A;  1ULP A;  4Y33 A;  2XBO 3;  1EPZ A;  3CL1 A;  1ALY A;  1C57 A;  4HK9 A;  1WW6 A;  3KHC A;  2OT7 A;  2ILM A;  4HVO A;  4LO7 A;  4FFI A;  3D3A A;  4LKD A;  3JB4 C;  2YC4 A;  2YGM A;  1X50 A;  4YVS A;  3NAP B;  2IXJ A;  1G6N A;  2IFR A;  2WSU A;  3ZFG B;  3TNQ A;  3GBF A;  2WWU A;  4JGZ B;  1KJR A;  1DLC A;  3ZSE A;  3KCX A;  1U5X A;  1LR5 A;  2MEV 3;  4AHY A;  1PO2 1;  4YFZ A;  4AWD A;  1W06 A;  4MX3 A;  2E63 A;  4GB3 1;  1OOP B;  3AXE A;  4ISR A;  1GNZ A;  4Y1X A;  4BXS V;  1FXZ A;  4LIT A;  3FL7 A;  3IM0 A;  1CZS A;  5E16 A;  1QJX 2;  4KU8 A;  1OKO A;  2ZGL A;  4F3J A;  1WA6 X;  1GZ9 A;  1GQG A;  1XE0 A;  1ULE A;  2C5D A;  3WLU A;  3AM2 A;  1NA1 B;  2QQL A;  1B35 A;  3ACL A;  5A7P A;  2C9K A;  4EWE A;  1W8N A;  1RHI 3;  4COV A;  5C3P A;  4BZ4 A;  5C4W B;  3GBW A;  1LTE A;  4XQD A;  5SV5 A;  1TNR A;  2HWF 3;  2TBV A;  2W39 A;  1YC6 1;  4S2F A;  4YVW C;  3WF0 A;  1W8W A;  3BB6 A;  1H9W A;  2XML A;  3IDB B;  4MET A;  4NAO A;  4NWW A;  4OLL A;  3VBO A;  1RVF 1;  3WW2 A;  2W2I A;  3OBZ A;  4HAN A;  2QQI A;  4YZ1 A;  5T3N A;  2W1Q A;  3QH7 A;  5FP7 A;  3ZMO A;  1U0A A;  3I2F A;  4I0A A;  5KHJ A;  4Y1U A;  4Z82 A;  3UYJ A;  1YFW A;  2IXL A;  3ATG A;  3RMX A;  1NCR B;  3UKV A;  2YG0 A;  3RZL A;  2KM2 A;  5D1I A;  2V73 A;  2QNK A;  4OUM A;  4O65 A;  3V0A B;  4QX5 A;  2Y60 A;  4LKF A;  1DU3 D;  1PX4 A;  1V9U 1;  1YQ6 A;  3TRS B;  3H8X A;  3ZVX A;  1CX1 A;  4K40 A;  3D0J A;  3PDQ A;  2IUW A;  2FDJ A;  3C7O A;  1U12 A;  5LBB A;  3KD4 A;  3KGZ A;  4EN9 B;  2EIE A;  3VBH A;  2CGN A;  3HIF A;  4DY5 A;  4RL7 A;  4HON A;  4YGD A;  3T09 A;  5JSP A;  4CCM A;  5FXX A;  1MQT B;  2PHX A;  4M0N A;  4B7K A;  4DS0 A;  4BQ3 A;  3VD7 A;  1QXJ A;  2XOM A;  1W8T A;  1KS4 A;  4OVE A;  4QX1 A;  3IDE A;  2IFW A;  2YDE A;  3UT0 A;  2HWE 3;  1AR6 3;  4QAW A;  3KSC A;  3WY6 A;  2IVJ A;  2PA7 A;  2JEN A;  2BEO A;  2XBO 2;  3RMY A;  3VBR C;  1AYN 3;  1PIV 1;  3ON7 A;  1N1Y A;  2ZEZ A;  3MO4 A;  4CE8 A;  2Q5T A;  1TME 2;  2RS3 3;  4NIA A;  3B7M A;  1OA4 A;  3DKW A;  4N43 A;  1DQ0 A;  1EUU A;  4Q4W 2;  5IVF A;  1C8M 2;  4XZP A;  4URA A;  4MZU A;  2R49 A;  1Z7S 1;  4JHT A;  3ZFF A;  3B02 A;  2W94 A;  2LRP A;  4OZX A;  3I2G A;  4KWK A;  1I3H A;  1YIP A;  3VV1 A;  3RI8 A;  4WVM A;  1V70 A;  1WBL A;  2HWB 1;  4QX2 A;  3ZFE C;  1X9T A;  2QE3 A;  2W95 A;  4XJU A;  5FUN A;  3PMS A;  4ZY9 A;  4KWU A;  3T0B A;  1O3S A;  3PUH A;  2VY0 A;  1BKZ A;  3AYA A;  2GH2 A;  1KDK A;  4NHK A;  2JG9 A;  4CCK A;  2XKP A;  2ZCW A;  2NPI A;  2ETE A;  1NLS A;  2XH6 A;  4PI0 A;  4QB1 A;  4Y3O A;  2HWB 2;  5J48 A;  2BZD A;  3ACH A;  1QJY 1;  3J7N A;  1WW4 A;  3KHB A;  1PGS A;  4TLG A;  1ND3 A;  1NT0 A;  5E1R A;  2Z79 A;  1A3K A;  1GLH A;  2F4P A;  3O7O A;  2FMY A;  4HSL A;  5CFD C;  5HXM A;  2OUH A;  1Y43 B;  1RED A;  3POI A;  1XYO A;  1PO1 3;  4EE2 A;  3BIE A;  3HT1 A;  3M8L A;  5AFE A;  5CEH A;  2MHF A;  2HWC 2;  4NE9 A;  1FMD 3;  2RS5 3;  3N4M A;  3DEM A;  3MPB A;  4YZ4 A;  3VHN A;  4UF0 A;  1D0G A;  1LOB A;  2WO3 A;  2XKO A;  1CPM A;  1N47 A;  2D93 A;  4FP3 A;  4IEP A;  1F4H A;  2ZA9 A;  4D6R A;  1W8O A;  4UT5 A;  2NMN A;  4A6S A;  1ZVF A;  1A78 A;  3E5U A;  3WD5 A;  4FPF A;  3H1M A;  5E8A A;  2GC1 A;  3WG3 A;  1NY7 2;  4EYU A;  2ZML A;  1PMJ X;  1XU2 A;  5D8A A;  4Q1R A;  3AP7 A;  2CY6 A;  3ROU A;  4KGG A;  1QJZ A;  5DAX A;  5LAS A;  5FLJ A;  4DNY A;  1LAJ A;  3PTY A;  2ZGP A;  1LHO A;  1BBT 3;  3PUR A;  1RGS A;  2EXK A;  5FV3 A;  3USU A;  1BMV 1;  1OMI A;  3Q8B A;  4L2N A;  2BGP A;  1XNB A;  3OF1 A;  1LOD A;  2A1X A;  4WM7 A;  1COV 3;  4XOG A;  5CKM A;  4AI8 A;  5IK7 A;  3ZLI A;  4IER A;  3ZX7 A;  5BNP A;  1JU3 A;  2OQ6 A;  3FBY A;  3OUH A;  2ZGR A;  3WUC A;  1UQX A;  3ZYH A;  4D7Y A;  1AJO A;  2YV8 A;  3BYW A;  4GKY A;  1OLQ A;  4UFK A;  4C0H A;  3NQH A;  2YPD A;  1SLC A;  1W6M A;  1QJY 3;  4QPY A;  3ETQ A;  1OUR A;  4PDW C;  1RUG 2;  5FZ1 A;  2Y6F A;  2CDO A;  3JB8 A;  5LB6 A;  3RDI A;  3DPR C;  3T2O A;  4GB3 3;  4FVV A;  1QQP 2;  2BWA A;  1RUI 1;  1KEX A;  1XNT A;  2BYV E;  3I4I A;  3Q9O A;  4FPH A;  1ZBE 1;  2ZS6 B;  4MXW A;  2PHT A;  2BGO A;  1VBE 3;  1PO1 1;  2MPF A;  5JXJ A;  2OQ7 A;  5M0T A;  2K2S A;  1MS3 A;  3W9A A;  3WZ1 A;  2UYA A;  1ZA7 A;  3DYM A;  2ZAA A;  3ZFE A;  1LCL A;  5ANN A;  4AFM A;  1QJF A;  2VZO A;  1ENX A;  2VE1 A;  4COU A;  5JSO A;  1LEN A;  3AXD A;  2ARE A;  3KS7 A;  1OD3 A;  3OEB A;  4RS5 A;  2QQV A;  1W9F A;  5K7P A;  2G9Z A;  4XUN A;  1EV1 1;  3DCQ A;  2FDF A;  2V72 A;  5HCA A;  4CUC A;  3WQB A;  3MEP A;  3IT8 A;  1VAV A;  2VMH A;  2WZR 1;  3HEI A;  2VAU A;  1H9P A;  3VDA A;  3CDZ B;  1LNS A;  5K0U A;  1R64 A;  1UW8 A;  4JKM A;  3WG4 A;  2WSV A;  4QPG A;  3LOB A;  1PIV 2;  5LA1 A;  2A6Y A;  4H55 A;  3NW4 A;  1XNK A;  5F5I A;  5FLI A;  1W9Y A;  5GM0 A;  3AMN A;  1NXM A;  5KXD A;  4P02 B;  4URT A;  1COV 2;  1HX6 A;  1W99 A;  4FT8 A;  3RSJ A;  3O1P A;  1JYT A;  1SZB A;  5FO9 B;  1VB4 A;  3VBH C;  5CFD A;  5B2G B;  4UW3 A;  1QJX 3;  3HMY A;  4BQW A;  4C91 A;  5A1L A;  3OBT A;  2NP0 A;  1AR8 2;  1SCR A;  3GM8 A;  1O91 A;  2RR1 2;  2HH9 A;  4ZKT B;  3IWZ A;  5L36 A;  4XFB A;  1OQ1 A;  3VBU A;  2A71 A;  4ZU5 A;  4C1X A;  1Z7S 2;  1W6Q B;  1J3R A;  1H8T C;  2PQS A;  2X10 A;  5F3G A;  4LQR A;  4D6Q A;  5GZG A;  2Q8D A;  2A3W A;  1VRB A;  2EIC A;  4JKK A;  4RHV 1;  2WNO A;  5KXC A;  1PM4 A;  2ATF A;  2JDP A;  2A6W A;  1JZ7 A;  1IKP A;  2LUW A;  1OI6 A;  2WQ4 A;  2XUM A;  3X29 B;  2X5I A;  5HV4 A;  3VKL A;  3AB0 A;  2VZS A;  1HJG A;  4J6G A;  5JR2 A;  4UXA A;  4QM9 A;  1SLA A;  3VKN A;  5A1A A;  1CGP A;  4DY3 A;  4M01 A;  5I8S A;  3I54 A;  2IXC A;  4BPZ A;  4E4D X;  1W6N B;  4QPG C;  3O14 A;  4DIN B;  2VBD A;  5E89 A;  2JIJ A;  3UJO A;  5KC5 A;  3MLL A;  3K2O A;  5JPN B;  2WO7 A;  1PZ9 A;  3AYE A;  3GJA A;  1SQ4 A;  4Q1P A;  3ZN6 A;  4BU2 A;  1VMF A;  4D7T A;  4D94 A;  1HQN A;  4YVW B;  5JIA A;  4FAG A;  5KXB A;  2R04 1;  1GWM A;  4RS5 C;  3WDT A;  5CFC A;  4NRP A;  1H2N A;  5A33 A;  4RS5 B;  3FFZ A;  4ITC A;  4FOQ A;  1VBE 2;  5A3L A;  1ND2 A;  1AYN 2;  1AX1 A;  2DYC A;  2JEC A;  5JWP A;  4IUG A;  1BZW A;  4CDQ A;  3C7H A;  2G9G A;  3AKQ A;  3TAY A;  4QX7 A;  3WNM A;  4QPG B;  2VQT A;  4D69 A;  4BIF A;  1RJ7 A;  2RR1 3;  1L7Q A;  1O59 A;  1SBD A;  4P9Y A;  1JHJ A;  1VAL A;  4KBB A;  1ZRR A;  1Q5O A;  2LM3 A;  2WYF A;  3J9S A;  3PME A;  3IAQ A;  4CYD A;  5C6C A;  3NV2 A;  4Q26 A;  3TEY A;  4BQ1 A;  1UZ0 A;  5KC6 A;  2R6Q A;  2DBI A;  2YHJ A;  2UUR A;  5FR3 A;  3NJY A;  4N8M A;  3GGL A;  3KV9 A;  3QOP A;  4KGQ A;  2WS9 2;  5I8T A;  4QB2 A;  1TVG A;  3VGI A;  5A80 A;  4OMD A;  1PVC 1;  4AGR A;  5FYT A;  3SNM A;  4FPK A;  2RMU 2;  4AW7 A;  2O1Q A;  1Q8Q A;  3SLI A;  1URX A;  1W6O B;  2HWE 2;  2VZP A;  1RUJ 3;  4YVW A;  3I2H A;  2GU9 A;  1F9K A;  1YNA A;  4XXP A;  3VKO A;  4DXS A;  4Z2A A;  5BV6 A;  4Q4V 3;  2R07 3;  3MIE A;  2YB7 A;  3NNL A;  3CIH A;  3MIC A;  4UAP A;  3N9N A;  5FXV A;  3W59 A;  1LU2 A;  5HXV A;  2JJ6 A;  2RJL A;  4KBZ A;  1KIT A;  1MQT C;  5FP3 A;  5J98 B;  1L7R A;  4O9E A;  4K1Z A;  2A70 A;  2AR6 A;  3ZXE A;  1X36 A;  4DXZ A;  3PNA A;  5CZK A;  5L9R A;  5IAX A;  4ZHN A;  4HXC A;  1J59 A;  1HXS 3;  3QD6 A;  1OXC A;  2WKK A;  1VRH 3;  4NR1 A;  1SG3 A;  5GJ6 A;  5FZ0 A;  5H9Q A;  4DOU A;  5ACA 3;  2QQP A;  3DPR A;  4M0H A;  4XFF A;  2FDI A;  1AR9 1;  1W8Z A;  4MG2 A;  3THC A;  4HOO A;  5FZ4 A;  1BK1 A;  4QKD A;  3POS A;  4XFI A;  1NCR C;  4IV3 A;  4B3N A;  4QU1 A;  4E27 A;  4ES9 A;  1W0O A;  2G9F A;  1DYO A;  5C4W A;  4BMB A;  1O3Q A;  1AYM 2;  2V5Y A;  4E9K A;  2D3P A;  1MZ6 A;  4N7U A;  3UKN A;  4W8J A;  3H9A A;  2R07 2;  4LOR A;  1IG0 A;  4NHX A;  1PO2 3;  1ULO A;  1NYW A;  4EQV A;  3DF0 A;  5J7M A;  4QKN A;  3SIT A;  2K46 A;  2W87 A;  4XVH A;  1KFU L;  1ZZB A;  4N9H A;  1VMJ A;  3LOI A;  3DYP A;  4RGK A;  2GN7 A;  4AHX A;  4NO4 A;  1AZD A;  3FUO A;  3MV1 1;  4M4R A;  3KVA A;  1VBD 2;  1W6N A;  3H0O A;  3R4S A;  3NNJ A;  2Q1F A;  5A6Y A;  4FTS A;  1FMD 2;  1QY4 A;  2RS5 2;  2ZAB A;  4W6X A;  4BH9 A;  3UKT A;  2WS9 3;  1UYX A;  1BXH A;  1D4M 3;  2VZ1 A;  3WNN A;  4BXF A;  1BBT 2;  1CX4 A;  4RR3 B;  2QZ2 A;  3T30 A;  2GSY A;  1GIC A;  5J96 B;  5BPX A;  2RG4 A;  3H7Y A;  4IEW A;  3RI9 A;  3FBM A;  4HN0 A;  2AEZ A;  1PK6 B;  2ZEY A;  4YW5 A;  5KBF A;  2Q30 A;  1JH5 A;  3N9Q A;  4UOJ A;  4QX3 A;  2GAL A;  3T3Y A;  2WZR 3;  4A3X A;  3ZN5 A;  5JOY A;  3U0Z A;  4ARY A;  5C71 A;  1GP4 A;  3WCR A;  2ZGU A;  5A7W B;  1L7L A;  2NLR A;  3K77 A;  2IXH A;  1QH6 A;  5IHR A;  4BQ5 A;  3W5M A;  1ENQ A;  3NAP C;  4CEY A;  3JZV A;  2ZMK A;  2JG9 B;  3JBG 3;  3POW A;  4PIZ A;  2RMU 3;  2B46 X;  5I0D A;  5JOX A;  3I3B A;  3ZMN A;  2A5Z A;  1WLD A;  3WQ7 A;  3LFI A;  4M00 A;  1T6G C;  1WGP A;  1MVQ A;  2OZJ A;  1QJX 1;  3GYD A;  2VBB A;  1NQD A;  4H2A A;  1YRZ A;  5FZB A;  3IMN A;  4IEU A;  4D0Q A;  5A32 B;  1RIT A;  2I45 A;  5FXZ A;  2JE7 A;  5JXH A;  3SHR A;  1DYP A;  1PVC 3;  4FO9 A;  4GIQ A;  3DEC A;  1ULC A;  4GXL A;  1W39 A;  1MZ5 A;  1ZA4 A;  2ZX3 A;  1EAH 2;  1YXW A;  3TB0 A;  1QH7 A;  3S5A A;  4OHV A;  3AKS A;  1VBD 3;  2XVL A;  1HRI 2;  3LZZ A;  2DUR A;  2XVK A;  3BVC A;  3M3C A;  3MHZ A;  4YYO A;  1NUK A;  2JEM A;  5FZH A;  1RUI 3;  1S0G A;  2D6N A;  2JWP A;  2Y0I A;  3AMM A;  1V6O A;  3LSE A;  4N7I A;  5HBA A;  4SLI A;  2TUN A;  1IG3 A;  1LOE A;  1YI7 A;  3WV6 A;  2JDN A;  2O0O A;  1VBC 3;  4V2W A;  1IHM A;  4N43 C;  4G9S B;  2FCV A;  3VHP A;  4ARX A;  3MW4 A;  1EY2 A;  3ZXF A;  2VW1 A;  3SC7 X;  4EN7 B;  4XUP A;  1UYZ A;  1DG6 A;  2OS2 A;  1RUC 1;  1BVP 1;  5CAD A;  1TME 3;  1EP0 A;  3PVN A;  3VHO A;  2IC1 A;  1IGO A;  2R04 3;  4IV1 A;  1I1E A;  1NE4 A;  1QDC A;  4WV8 A;  3HNM A;  4LUL A;  2WFF 2;  1O8S A;  2ZXQ A;  4GWN A;  4BA6 A;  1PK6 A;  2EVX A;  3IN9 A;  4GMP 1;  1DGR A;  2JG8 A;  5HCB A;  5KHK A;  2JD9 A;  2VMG A;  3RS6 A;  4MGK E;  2V4A A;  3ILF A;  3A4U A;  4JGZ A;  1T2X A;  2YPJ A;  3VLB B;  4QKF A;  3SH4 A;  3SEP A;  2PHD A;  5C5U A;  5K9Y A;  1QNY A;  3BCW A;  3JQX A;  1R09 1;  3NNG A;  3IPV A;  3T2T A;  1UKG A;  3ZPO A;  1JUI A;  2VJX A;  1OOP A;  2VG9 A;  2C24 A;  3VBR B;  3MIG A;  5ANQ A;  5FZK A;  2ZZJ A;  4RA0 A;  1LUL A;  4BK4 A;  2E33 A;  3I8T A;  4J1W A;  3PJY A;  2ZX0 A;  4Z07 A;  2R04 2;  4JRL A;  3I7D A;  3KCC A;  4QHO A;  1HJF A;  2CL2 A;  1LGC A;  2GC0 A;  3VBF A;  4LBQ A;  5FY1 A;  5FRA A;  3KF3 A;  4XHB A;  1SFY A;  2ZGN A;  3NNF A;  5FZ7 A;  1YLL A;  3I2D A;  1DGW X;  1JU4 A;  2A75 A;  2BER A;  2WLP A;  2WT2 A;  4PLM A;  5F5Q A;  2EAK A;  2YU1 A;  5AVA A;  3AKR A;  3ZXK A;  4AI9 A;  3AZY A;  5C7G A;  1AF9 A;  3AYD A;  4OQ8 A;  2PAM A;  2JDK A;  2QFE A;  2XHN A;  5IWF A;  4XF9 A;  3ZSK A;  5FY7 A;  2D97 A;  1K42 A;  4GAZ A;  4CXW A;  4D6S A;  4TYS A;  4CCD A;  2VMF A;  3AZZ A;  3KZ4 C;  3VBS A;  5FZD A;  4IV1 C;  1POQ A;  4BQ4 A;  1G9C A;  4Y22 B;  4XMI A;  4RHV 2;  1D4V B;  4Q4Y 3;  1YFU A;  4KU7 A;  4CDW C;  2BV4 A;  1VLN A;  5GAL A;  5C3R A;  2WFF 3;  3LPF A;  1NA1 A;  3BPZ A;  1HLC A;  2B7Y A;  2VGD A;  2RS1 2;  1VRH 2;  5ACA 2;  3O1O A;  3RZH A;  5FFO C;  5FMB A;  3HQR A;  4P9L A;  1RXF A;  5A3T A;  1POV 0;  5C9A B;  4K21 A;  5L7O A;  4AVA A;  1JUH A;  1MS0 A;  1TMF 3;  1BK0 A;  5I93 A;  4LIV A;  4HPK A;  1W6O A;  4B1M A;  1RUE 3;  3LWC A;  3HN3 A;  3VD4 A;  5FRE A;  2F4L A;  2VMC A;  2EAL A;  1I5P A;  2HYK A;  2QQU A;  5LAT A;  4C0B A;  1O3R A;  4YW1 A;  2PXJ A;  2CAU A;  4LE3 A;  4YWA A;  4GWM A;  2SLI A;  4OUL A;  5DXD A;  2ET1 A;  4CU7 A;  4XCA A;  3J8F 3;  3BUC A;  1FAT A;  1OHF A;  4QWN A;  2QDR A;  1MZF A;  4IE4 A;  4LHS A;  4GZ9 A;  5FYB A;  4AEM A;  2R1B A;  4YRD A;  4LIU A;  1PHM A;  1J3P A;  1V0A A;  4LO6 B;  1ZRF A;  2SBA A;  2DUO A;  4P9I A;  3WIN E;  4K6B A;  1BYH A;  2VZU A;  2WN3 A;  3CEW A;  1RUJ 1;  1GQP A;  1STM A;  3AVR A;  5JXI A;  4NAM A;  1RL3 A;  4KH9 A;  1RYY A;  4L11 A;  4MGQ A;  2BUK A;  3J7H A;  5KHH A;  4RQP B;  4C8D A;  5AFB A;  4CCE A;  3OOX A;  2WA3 A;  1GWK A;  1UMH A;  1CIW A;  3WHU A;  3WUD A;  2ZX4 A;  3CHX A;  1UXX X;  1GV9 A;  2VCB A;  1GZW A;  4IEQ A;  3BU7 A;  3N3H A;  4XC9 A;  4Q8K A;  4K7J A;  1DZQ A;  1UY4 A;  3T4V A;  4DEQ A;  1UY2 A;  1N1S A;  4FOW A;  5ABJ C;  1AR6 2;  2C9A A;  2ZKL A;  3U78 A;  1ND3 B;  1C8M 1;  2Y38 A;  2JB4 A;  5FBZ A;  1RUE 2;  3ES1 A;  3CZJ A;  4UFI A;  1ENR A;  3LA2 A;  4Z2W A;  4XBQ A;  2RJ2 A;  5DAB A;  1XNC A;  3UJQ A;  4QGM A;  3ZXG A;  5G05 L;  4CP9 B;  3L9J T;  1OPO A;  4S2G A;  2A3Y A;  2H6B A;  2RM2 1;  3LA3 A;  4RSU A;  1W9T A;  5CNA A;  3FWE A;  4BB3 A;  1RXG A;  1WMD A;  3AX4 A;  4W4Z A;  2XQR A;  1ST8 A;  2B9U A;  3CKH A;  4MUV A;  4RHV 3;  2GH8 A;  4B4R A;  5LCW L;  5H9R A;  2I2S A;  3VHR A;  1AYN 1;  1PIV 3;  4PIX A;  4Q4Y 2;  3NST A;  4YW6 A;  4CCN A;  1VBE 1;  1CN1 A;  3S30 A;  1ASJ 3;  4YGC A;  3FE5 A;  1IS5 A;  5FY8 A;  5FUP A;  3WNO A;  2BJS A;  4ASK A;  2ZX2 A;  1RMU 3;  4JX0 A;  3AP4 A;  3JU9 A;  3OTF A;  1DGL A;  1VBC 1;  3LA7 A;  3VZK A;  4CVU A;  2VNO A;  2RS1 1;  3K4A A;  4FPO B;  4Q4Y 1;  3OPT A;  2BDR A;  2WR9 A;  4UI9 L;  2HBT A;  4AEJ A;  1SPP B;  4WM7 C;  1MS1 A;  3O1T A;  3PU3 A;  5IAV A;  2KR2 A;  1R1A 3;  4QQ2 A;  2E6V A;  2E7T A;  3CZU A;  4DO0 A;  3PLQ A;  2FBE A;  4DQA A;  3RWK X;  5LEJ A;  1UOG A;  3AFK A;  3D82 A;  1WCK A;  5F8P A;  4YZ2 A;  1W9W A;  2BOI A;  2GZW A;  5LRS A;  3GZA A;  3WG1 A;  4BQ2 A;  2DU0 A;  3C3V A;  4Q29 A;  1KQR A;  4M3C B;  2WAO A;  5A7O A;  2HEV F;  3I59 B;  5LA9 A;  1FV2 A;  5FYY A;  2JIG A;  3T0A A;  3AK0 A;  4HMZ A;  1SAC A;  3PUQ A;  5T52 A;  5J3U A;  2EAA A;  1ZZ8 A;  4QX0 A;  4P9X A;  5FZE A;  4BME A;  3ZXJ A;  4FPC A;  2VW2 A;  5I0U A;  4V2V A;  4RFR B;  1YQC A;  4TXW A;  1HQW A;  2C6S A;  4YZ3 A;  2Y26 A;  2JX9 A;  5BNO C;  1CAU A;  5C5T A;  1BJQ A;  1UZZ A;  2FQP A;  3C7E A;  3P6B A;  5FWE A;  1EAH 3;  2BRT A;  2ZZQ A;  2ZGM A;  4LLF A;  2P3K A;  3WP6 A;  2Y6K A;  4DXR A;  3BI3 A;  1XB9 A;  5HI0 A;  1E5S A;  1MVE A;  4EJR A;  4NWV A;  2E31 A;  4LBK A;  2Y64 A;  4XF3 A;  3ZYP A;  1CAW A;  4Y26 A;  1OPM A;  2ZBJ A;  2P6C A;  5EP9 A;  5DDJ 2;  5JI9 A;  5DUV A;  3VD9 A;  1ULD A;  2QUO A;  3QBQ A;  5GZE A;  2C1F A;  3THP A;  4K20 A;  4L97 A;  3WDY A;  4ORF A;  1QIQ A;  4AED B;  1L3J A;  3ZDV A;  3GZU C;  1PZ8 A;  4LXL A;  4C1W A;  4PT6 A;  2BWC A;  2X05 A;  1MQT A;  2JDA A;  4CRQ A;  3M4F A;  5FAX A;  3H7J A;  2YBK A;  2P34 A;  1JZ8 A;  3O0X A;  2R06 1;  2QBX A;  4MXW B;  3I59 A;  1HW5 A;  1K5M B;  3KT4 A;  1JMU B;  1FPN 1;  5A7W A;  1FX5 A;  4Q2F A;  3CJI B;  1XE8 A;  2AEN A;  2Z2S B;  2CDP A;  4GJZ A;  4HFS A;  4XZU G;  5C3Q A;  1PGL 1;  3NKT A;  1I9R A;  1WME A;  2YFZ A;  3I3E A;  4AVV A;  4UFJ A;  2AZ5 A;  1HRI 1;  1BCX A;  1LED A;  1GFF 2;  5KWR A;  4YLZ A;  4EV0 A;  4U2A A;  2CWM A;  2GAU A;  4J1X A;  5EJZ B;  4RGA A;  4JC1 A;  3A0N A;  5FBJ A;  5FZ3 A;  5FPX A;  1UKR A;  3E97 A;  1W8F A;  4CSW A;  5JMO A;  1C3H A;  1W6Q A;  2QQM A;  1S0F A;  2HEW F;  3LEG A;  3VBU B;  3VZO A;  3CJI C;  3ZYJ B;  4QX8 A;  3TYJ A;  4Q4W 3;  4B29 A;  1RB8 G;  5FZC A;  2PEL A;  5I0T A;  2FHR A;  1O6U A;  4CDX A;  3M3E A;  5IAT A;  4QGN A;  1T6B X;  4W50 A;  2W08 A;  5CKN A;  1VPH A;  3KV6 A;  1ND2 B;  1FOD 3;  3PIG A;  4X8N A;  1IPJ A;  2J1U A;  3ZKY A;  3WG2 A;  1QJE A;  3Q8E A;  4B7E A;  5EJ3 A;  5A7S A;  1PGW 2;  1H1A A;  1AVB A;  2ARB A;  1OT5 A;  4OI0 A;  2VOT A;  2ARA A;  4FPY A;  1XNA A;  2DVB A;  2RDN A;  2XXZ A;  3LGR A;  2OA2 A;  4GAL A;  4LOT A;  4OI2 A;  4CUA A;  2HBU A;  2Y0O A;  1LOF A;  4JGY B;  4QDR A;  5IW0 A;  5A3M A;  4XIL A;  3T0D A;  2HWD 1;  3AMH A;  3BKZ A;  4Q4V 1;  5BNN A;  5T5P A;  5JDB A;  3IBM A;  1UAI A;  2B9V A;  4JAA A;  2VQ0 A;  3KT1 A;  1GBG A;  1Y3T A;  4BOW A;  4DRV A;  3OGV A;  1V9U 2;  2R16 A;  2WWS A;  2Q4S A;  3ENR A;  1W2O A;  3WXP A;  5FZL A;  2Z69 A;  4IW3 A;  3VZJ A;  1PMI A;  2PMW B;  2GP3 A;  1HXS 1;  5ABJ B;  4LMF A;  3HPN A;  1GYK A;  4AQ2 A;  4CDQ B;  5LEK A;  1NCQ C;  3N36 A;  4LBN A;  1X8E A;  1SLI A;  4JGY C;  3U4X A;  1O5U A;  1UX6 A;  1VE0 A;  2LS6 A;  3HD8 B;  1I6X A;  1R08 3; 
#chains in the Genus database with same CATH homology
 1XB9 A;  1NLQ A;  4CA9 A;  1K5J A;  1XE0 A;  5EHD A;  2VTX A;  4N8M A;  3T30 A;  2VTX J;  2P1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...