5EHDA

Crystal structure of human nucleophosmin-core in complex with cytochrome c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
PQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleophosmin
publication title Crystal structure of human nucleophosmin-core in complex with cytochrome c
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 14
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H, I, J, a, b, c, d, e, f, g, h, i, j
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 5ehdA00
5EHDA 1NLQA 4CA9A 1XE0A 2VTXJ 2P1BA 4N8MA 3T30A 1XB9A 2VTXA 1K5JA
chains in the Genus database with same CATH superfamily
2W1SA 2BUKA 1W6MB 4RGGA 3BOWA 3WF4A 3FL7A 3OGGA 1DGWX 1SFNA 2FQPA 2GMPA 3KVBA 3AK0A 1J3RA 3LD8A 1DYPA 3G7DA 3AYCA 4A2UA 1UY4A 4GMP0 4Z07A 2DYCA 4L9BA 4WVVA 5L9RA 3FZ3A 4OQ9A 4CCKA 3WHUA 2KA3A 1VRH3 4ASLA 2P1BA 3O5SA 3WHTA 2BOIA 1QJX2 4Y4RA 4O9GA 1UY1A 1VIWB 1O4ZA 1R081 1UNBA 4AYUA 1L7RA 1IKPA 2VOVA 1YIFA 1I5PA 3VL9A 4COYA 5FYHA 4D7TA 2R1DA 5A7SA 2VW0A 2YDEA 2ZS6B 3W20A 4COWA 4DUVA 5ABJC 5FLHA 3WSOA 3AX4A 1J84A 5K7PA 4Y1YA 4FOYA 4OVEA 4CEWB 1Q8OA 3PUIA 4Q8LA 1UAIA 1Z78A 3I3QA 1Q8VA 3KSCA 1MEC1 3CDZB 2DVGA 2Y0OA 4D8MA 3DEMA 1O3RA 4SBVA 4P08A 1SDDB 2XOMA 3N7KA 4J1XA 4YYOA 2V72A 1FAYA 2WNVA 2DVAA 4BQWA 1QXJA 1YLLA 5IVYA 3AMHA 3D8CA 4UOJA 2JG9A 2CNAA 4LULA 5DG1A 3M3EA 1XRUA 2WFF3 4EYUA 3AZYA 4E27A 2D3RA 2I74A 5FPLA 2D6PA 3SEEA 1ZBA3 1RMU2 1ZREA 5E1RA 2GZWA 2WZR3 4YW3A 5FV3A 1RMU1 1SLLA 3KVAA 2D5HA 4YW7A 4PQ9A 3ZYPA 3LSEA 1JMUB 4AEDA 2WT0A 4GWNA 1R1ZA 5E16A 3S6PA 2PAEA 2GNMA 2PXJA 3X29B 5FQ0A 1HXS3 1POQA 2DBNA 1QEXA 3H42B 2ZTNA 4I02A 5LATA 3WD5A 4IGPA 5FY4A 1RHI3 1JXNA 3FHQA 1VBD3 1K5JA 2Q1ZB 4ZU5A 4YG3A 3PMSA 4JRAA 2YG0A 3UKVA 1CONA 2FHRA 3ZSLA 2CDPA 5FY7A 1JODA 1LGCA 1WA6X 2BFUS 3UGFA 1MS9A 1HX6A 4AGRA 4QQ2A 1LOFA 3CZUA 4QKDA 1CZSA 4MGYE 3KS7A 2FDIA 1K42A 4QPGA 1NYWA 5ISLA 2GP5A 3VHRA 4DXSA 3H9AA 1UOFA 4JHZA 1AYM3 4PLMA 1LB2A 1XNDA 2QZ2A 2Q4SA 2XGXA 3OD4A 4YZ2A 1VBC1 3IKWA 3LPFA 3WG2A 4FP2A 3AZZA 1C8NA 2GAUA 3WXPA 4BLIA 5FO9B 3LKJA 1R1A1 2JDHA 2J1TA 2P37A 2R041 4X6QB 1X33A 1VRH2 2ZGSA 2E53A 5K4LA 5JMOA 2WDBA 2IXIA 2ZPXA 4MXWA 2JDNA 4WZCA 4XUNA 5KXBA 2ET1A 1YQ5A 4QKBA 3VDBA 4XIOA 3OGRA 3C7EA 3RZKA 4M3CB 1RUF3 3H8UA 4LKFA 1EPZA 2Y38A 2CAVA 2RG4A 1ZBE1 3JZVA 2RMU3 4BXSV 2AZ5A 4AFBA 1HRV3 1CX1A 2PAMA 2ADEA 1UYPA 1EP0A 3E5UA 3NJZA 4XUOA 1KS5A 2WC2A 3FHIB 3OYWB 5DAXA 1S0DA 5FO7B 3RGBA 3ZIWA 4L97A 2XVKA 3WNNA 4BMBA 2VMDA 1E5RA 3B69A 4MXVA 4LMFA 3TN91 3ZDVA 5A3PA 4Q4W1 3AL6A 1JW6A 5F39A 1AXKA 1G9DA 3D0SA 1AR93 2VQ0A 5ANQA 4EN9B 2J1EA 3ZFEB 3A0KA 4XF4A 3MIDA 4AEDC 5A1LA 1SQ4A 5FZ8A 1N3QA 2A73B 2P5BA 4BHPA 3WG3A 3S0MA 1POV0 1OQDA 1ND3A 4KWJA 4R4ZA 5FP4A 2D6LX 3FLTA 1ZRCA 1XBFA 5F2WA 2R7EB 4NPRA 2WZR2 3OF1A 3ZR5A 2C1FA 4DNYA 4CXYA 3NV2A 2QQVA 1DYKA 2EXIA 2XL9A 1WBLA 1QNYA 2ZBJA 4WM8C 2HJIA 3KWVA 4Y24A 2VMCA 2ETEA 1PZ8A 3O7OA 3S7IA 4B3NA 2AACA 3KT4A 1Z7S1 4F7ZA 1HXS2 1OOPA 5BYNA 1AX1A 1YFUA 4QPGC 4AE2A 1RHI2 4UFJA 1HXS1 4XQDA 4AGGA 3TAYA 2VPVA 2DU1A 4UFMA 2BGCA 2RE9A 4Q4Y3 3KV4A 5CYYA 2HWB1 1H1IA 3W9AA 3VKLA 4CDWA 5F3GA 1WW7A 4KWLA 3BOPA 4S2GA 4AAXA 1XQNA 1RVF1 5G04L 1ZRIA 2PHRA 2WZPP 1MVEA 1AYM2 1W9FA 1S55A 1ZM1A 5CKNA 1W9WA 3VZOA 4BU2A 3D5OA 5ACA3 3I7DA 1D0GA 4Q5OA 1JTZX 4Q8KA 1F4AA 2VNGA 4K6BA 4LIVA 2BZDA 2BGPA 2WAAA 4YFWA 4XHXA 4FCAA 4ATEA 2IC1A 3U14A 1ZA7A 1I6XA 4NMIA 1YQ6A 1CAUB 4Y5SA 5LEJA 1VMJA 5FPUA 2ZEXA 1A8DA 4LBJA 5FYUA 3ZN6A 3VB9A 2Y8KA 4G3YC 1WGPA 2VE1A 1RUF2 4GJZA 5GLZA 1GZCA 3SC7X 2D3PA 2AR6A 2WNOA 4NRQA 4Z8BA 1HQWA 2CL2A 2XJSA 3AKSA 3T2PA 1DFQA 5JSRA 2F4LA 3ENRA 3Q8FA 3RZMA 4MUVA 5C8WA 4OUEA 1HRV2 1KXGA 1WCDJ 3HWJA 2WZEA 1ZZ7A 3MF6A 4IEUA 5A7NA 2QTWB 2O14A 1F35A 1GSLA 2K2SA 2Q8CA 1LOAA 1ND3C 1X9TA 3RZGA 1O3SA 1WW6A 5FUNA 2YFZA 3IDAA 5CG8A 2JECA 2VXRA 1YC61 2ZHNA 2LTNA 5IVJA 1AR92 1NUKA 1Y7BA 4QQOA 5FZOA 1MS8A 5DZGA 4V1PA 4XFCA 5DDJ1 3BODA 5IW0A 1OF3A 1S0JA 4UF0A 5EFUA 5G05L 1VMHA 4LBMA 4EWEA 4ZONA 3K4ZA 1RUG2 3AJYA 1GP6A 2JE8A 4OMCA 2Q8EA 1HQNA 3QH6A 1QH7A 3ST7A 2DFBA 1RUG1 4LK6A 1GU3A 4IV1B 4B7KA 1DQ4A 2RDQA 1OPOA 2RM21 2Y64A 3DPRB 2BTVC 5DAWA 5FY8A 5C3RA 4NROA 1GWKA 1N1VA 2QFEA 3BTAA 1GNHA 2IVJA 5FR3A 4UI9L 2AEZA 2WO1A 5BNOB 3A7QA 2VXJA 2ZGUA 4Q4Y2 5H9RA 5JZGB 2ZJCA 4QQLA 2HWC3 4Q0UA 3VN4A 1PIV3 5EIYB 1DGWA 1LECA 2DUQA 2WINB 4Y22A 1KJRA 2VR4A 2ZGOA 2ZX0A 3ZXEA 3IIAA 3SQOA 1RINA 3EJKA 5CFCC 1DGLA 4GB31 4XDOA 2E51A 4YGBA 4DO0A 2Y6KA 2XR4A 2YC0A 4IE6A 1PVC3 4W6XA 3PVBB 2HKXA 4QX1A 4WM7B 2XQRA 2JDUA 4AVAA 3VHPA 4Q27A 4YM3A 5ACA2 2WNUB 3VHOA 1CGPA 1DF0A 4OI0A 4AVBA 1GZWA 2XMLA 4CP9A 4SLIA 4LT5A 1APNA 4JKKA 1GZTA 5GZFA 1FT9A 4LORA 4GD4A 4RR3B 1AYN1 1SBFA 1VBE1 4IEPA 4MGKE 3GYDA 4N53A 5LZ6A 2H0VA 3DYPA 4AR2A 1UY0A 4YLZA 3HNMA 5DN2A 5FZ3A 4AQ6A 1OVPA 1MR5A 2PHDA 3D82A 1OQEA 2XXZA 3SCHA 2BWAA 4E2SA 1W3VA 4NRMA 4A44A 5L19A 2EALA 1AR83 1UD1A 2PHUA 3AMNA 3VKOA 5C7GA 2XPJA 3VD7A 4QX3A 3OPTA 1MZ6A 4Q1RA 1QJY3 3FLRA 2R061 3M4FA 1W8FA 2WWSA 2Z4FA 3J26N 2UWCA 1CZVA 3MEPA 2LW8A 2BNMA 3NVCA 2VQTA 3ZX7A 1FATA 2JKBA 4XMIA 1LHOA 4GWMA 5LRRA 4B29A 4BMEA 4ISQA 1J3QA 3RZHA 2QDNA 4Q4V1 2XVGA 4LKDA 1DYOA 4JCKA 3Q8CA 4CEWA 4QX7A 3RI9A 1JUHA 3MDPA 4LR4A 4EN7B 3S57A 3ZN4A 4LE3A 2VZ1A 1BCXA 2A3WA 5FY5A 3U07A 2C4XA 2QZ3A 4QXBA 2D6MA 3I3DA 4PJYA 2A5ZA 3BI3A 5T50A 3THTA 2EXHA 3R4DB 1IPKA 2JDKA 2JDMA 3PUSA 3KCYA 3VBRC 3DKWA 2DWRA 4M0HA 3ON7A 4Q0QA 1YFWA 2XONA 5ANNA 5EHDA 1GQGA 1UYZA 1UW8A 3UESA 3WP3A 4ONUA 5FJKA 2VNOA 3E5QA 1RUI1 4O9EA 1RUC3 4JAAA 4Y1VA 1AJKA 1KDKA 1YFYA 1ZZBA 2TNFA 2WYSA 4LIUA 5EWSA 5FMDA 2HWC2 3J8F3 1HV0A 1PIV2 4GKXA 5DABA 3W5MA 3BTYA 2B7YA 2ZAAA 3ZXLA 2Z2SB 2WKKA 4KQ7A 2VMFA 1A6CA 3IPVB 2W08A 5H9SA 5A3MA 1H0BA 1N1SA 1LGBA 3PHMA 1PVC2 3OBRA 4FXGB 4N53C 3R0RA 3I2HA 2TEPA 1GBGA 4JTNA 1UL9A 4XAAA 4BWOA 2DVBA 3VBSC 1G86A 1HJGA 1WW4A 4LPLA 3IMMA 5B4XA 4Q0PA 1M06G 1QH6A 3WDYA 1ULOA 1WA4A 2GMEA 1NCRC 4IE4A 4OHVA 1GOFA 3FFQA 3LGRA 1K45A 4HPKB 4LBNA 2CV6A 2Y33A 3CKHA 4JGZC 3AKQA 1L3JA 1ZNPA 4W6YA 4NIIA 3S7EA 1X50A 2D6OX 4DXRA 2CU5A 5FZGA 5I8YA 1G9AA 5GALA 5HPOA 3WEZA 5IK5A 2BPA2 4Y1UA 3USUA 4YNIA 4M00A 1AR82 4IUGA 4M01A 2ZABA 2LALA 3FWEA 3H1WA 3ZSKA 1EAH3 5KHJA 1QJY2 3MZHA 2Y60A 3O0WA 2A6XA 1TME1 4YM2A 3GXUA 3POGA 1AHSA 4M3CA 5T3NA 4LOTA 4CPBD 4KWKA 4FPJA 1BQPA 2HEYF 1U0AA 4XEZA 4IEXA 3VZKA 5A3OA 3SEPA 1NLRA 1I5ZA 2BNOA 4OMDA 1EUTA 1CR7A 3HAGA 1C3HA 1Q43A 3OYWA 4EZ4A 1QGLA 2X09A 2ZGRA 3IM0A 4AFDA 3T4HB 2AEYA 3AKTA 3CIHA 1ZZCA 2UYAA 3W21A 4AZZA 1EYBA 2RS53 4B8EA 2W94A 1J3PA 2BDRA 1D7PM 2XWBB 3H1YA 3J7HA 4FT8A 1JOPA 4XQ4A 3ZO0B 5I0TA 2ZMKA 3NAPB 4H14A 3ZFEA 4CXWA 2XUEA 3NRUA 2YROA 3MO4A 2VULA 5IUQA 5SV5A 4N7UA 2GN7A 2XWJB 2K46A 5FYZA 1CPNA 3GM8A 3RFRA 1GOGA 4XF3A 1FOD3 3I2DA 1WLCA 2CAUA 5L73A 1SLIA 4MGSA 3ZFFB 1W6QB 5BNQA 3UETA 1COV3 2WQ8A 2HWE3 1D2SA 1Q3EA 1LOBA 4XZPA 1SMVA 3B7MA 3A21A 3J8F2 1AL23 4E4ZA 5C8CB 1BYHA 2FDFA 2OZ6A 1SPPB 2DUPA 3K3OA 4LEJA 4XXPA 4CCNA 1NAEA 2P2KA 5FWJA 3K77A 1BLZA 2GH8A 5I8SA 5GZCA 4GULA 4QHBA 4TLFA 2G9ZA 4FO9A 2ZCWA 4OI2A 3RG0A 2UY9A 3FUOA 1AL0G 3OBAA 4Y1XA 1WLWA 3OUJA 3WF2A 3JU9A 2ZOEB 2AUYA 4QPYA 2HWD1 2ZHMA 3M3IA 1W8NA 2Z42A 1IKQA 2Y6GA 2J1UA 4EN8B 1NX9A 1W8WA 3GBGA 2XLAA 1GR3A 3RPQA 2XLFA 2ZX3A 2PHWA 4LUMA 1Q5OA 3MW4A 2E63A 3MV11 2NN8A 3MUY1 3WQ1A 2W1UA 3H50A 1WLDA 1CAUA 3AVRA 1PMIA 4DUXA 5BNPB 3I49A 1EAH2 1VAMA 1DCSA 5FWEA 1XU1A 4AQTA 1N3PA 5JAXA 1J59A 4PDWC 5D2AA 4ES8A 4BH9A 2JICA 3OEBA 4OI4A 2DV9A 4WVZA 1O4YA 4PLNA 2J7MA 2VM9A 4ZU4A 1XNAA 2DDUA 5IJRA 4IETA 4PQQA 3MICA 4D6QA 1GZ9A 2P3YA 4IGQA 3UKNA 1KFXL 4BK5A 3QCWA 2WZ8A 1D4M3 4GMP1 4TLGA 1VBA1 4LO7A 5F5QA 4CCJA 3FC0A 1X8MA 4PHZA 1SEFA 4N9IA 4TXWA 5FZ6A 4LO6B 3ZYHA 2Y34A 4XAEA 4NIHA 3N7JA 3WW2A 5A7WB 4QX2A 1TE1B 3L9JT 5DAVA 3OOXA 4K7JA 4V2VA 3WP4A 2O8OA 3ZSMA 5L7OC 4UFIA 1H8VA 2NMNA 2RS52 1VR3A 3AFGA 2NLRA 4L99A 1RL3A 4QDRA 4TSVA 3ZKYA 1Y9GA 4CCEA 3ES4A 1IHMA 4BLJA 2WO2A 4YM0A 1IS3A 5F37A 1LCLA 1ZRDA 2C9AA 3SLIA 4XJ8A 1FOD2 1QQP1 1V6JA 2Y6HA 3WNOA 2PTMA 2UY8A 1UKGA 1FX5A 2XJRA 1RUE1 3WQ0A 2WRAA 5DXDA 5A70A 1COV2 1ENXA 2HWE2 5C3QA 3J7MA 2I07B 3DPRA 5GJ6A 1AL22 1B35C 1QDCA 4H2AA 1RUH1 2E7TA 4BM8A 4CTEA 4UXAA 5BNOA 1DHKB 5FZLA 4LO4B 4GH4B 5CFDB 2XH6A 1R083 3WT3A 1TG7A 1TNRA 4JKLA 5JZGA 2VMHA 5C4WB 1NA1C 3DL3A 1SG3A 2VZVA 3QOPA 2LM3A 4RS5C 4EWAA 5AC91 4NHXA 3H8RA 4C1WA 4NJ4A 5JR2A 3CMGA 2VW2A 3RYKA 4YWAA 1ND2B 3BB6A 2VW1A 4GALA 2WNEA 2Y6LA 4WM7A 2WJSA 4EWDA 3QD6A 1ULEA 1X9PA 2D98A 1UZWA 2WNUA 1MQTA 4DY3A 4Q29A 2JG8A 5FY9A 3VD3A 1H8TC 1MEC3 2E31A 1WKYA 2ZGKA 2CGOA 3ILFA 1JYCA 4UAPA 3DKQA 4N7IA 2H0BA 4RR3A 2PELA 3L2HA 2VGDA 5D21A 5GLTA 5GKAC 1XE0A 2DCJA 4NPMA 1OC1A 1WD3A 1VB2A 3CO2A 3OBZA 5CKQA 3WY6A 2IUWA 4LHKA 4A3XA 2FCTA 5IATA 1NQDA 5C9AB 1ULDA 3ALQA 1JOJA 4QXCA 2DCTA 3HT1A 4XXAA 5D8AC 5FPZA 4Q0SA 4CDUB 1OURA 2XQXA 3A0NA 5L9VA 2ZMNA 4LBLA 1YEWA 4PI0A 4INDA 3NNJA 5LA2A 1OMIA 3E1F1 2R16A 2XHNA 4I01A 3MLKA 4FBFA 1BMV1 4XJAA 1D4M2 1RMU3 2WFPA 3MIFA 3CJXA 4FPHA 2YBPA 2RJ2A 4WBBA 3ZR6A 1V6NA 2OX0A 4URTA 3T1MA 4QWNA 4GXLA 4XJUA 3AMQA 3LAGA 1YNAA 3HT2A 5CG9A 1KGYA 2KM2A 1IZ3A 3ZFGB 3WQ7A 3U37A 1Y9QA 2VCBA 4XILA 1D0HA 1OKOA 3CJIB 3EQEA 2K9ZA 3SMHA 2X5IA 3DPRC 1NCQB 1PNFA 1JHNA 3C7HA 3N35A 4XBQA 3T2QA 4XBNA 3KCXA 4QU2A 3MPBA 3VZMA 5A6QA 1F9KA 2BEOA 4C91A 2RJKA 3OSDA 4HK9A 1NXD1 1V6KA 5F8PA 4DFSA 5BNOC 2RJLA 3GCWA 2YFUA 3KMHA 5EJZB 2VQUA 1VBC3 5BXXA 3GZTB 5KHKA 1D4VB 1SBDA 1A78A 3C8XA 4U36A 3H8OA 1R1A3 1DIWA 3PVNA 2R043 4XE9A 1FYUA 3C7OA 4XACA 5HCBA 3IDEA 3H7YA 1I1EA 1R082 2TBVA 1POV1 1YJLA 3INAA 1W0OA 1KD7A 4RSUA 1DQ1A 2WNUC 1C8M1 3B9IA 4CUGA 1MQTC 2ZGTA 2JG8C 3ME2A 4IESA 1US3A 4OYUA 1JYXA 3U4SA 1ZZ9A 4UFHA 5BNNB 3VBHC 1RB8G 1SHWB 1UYYA 3IPVA 2HWF3 1ZBE3 2DCYA 3K48A 1W8ZA 4DPNA 4O65A 5FZ0A 5F9TA 3M8LA 1CX4A 4DUWA 5EZWA 2RDRA 5BUVA 4IEOA 2BVVA 3WQBA 3B02A 3T0DA 2Z79A 5IK8A 5I93A 3TN93 1MEC2 4Q4W3 2EXKA 3MF9A 5A6ZA 1UCXA 1H2KA 3WV6A 2VMEA 4HPKA 4KU8A 3V0AB 4MADA 1N1YA 4HBNA 1HB1A 4XZUG 3N7LA 1KDMA 1Y3TA 4NN0A 4DMIA 5IFTA 4NPLA 4CDXB 3M70A 4IV3B 3B94A 5FUPA 4CCCA 2XUMA 3B01A 1BEV1 5F5CA 1BZWA 5EJ1B 4RL7A 3U11A 2Q8OA 3THPA 1VJ2A 1DGRA 1XNCA 4OULA 1JZ4A 3H0OA 3MUZ1 4WZFA 4WV8A 2X5IC 3MLLA 1OKQA 1HLCA 1XSQA 2X10A 1Z7S3 2JDZA 5CVRA 5FYIA 2WS91 4UW4A 3IAQA 4Z92B 3NV1A 4FAGA 3O1RA 3QBQA 5DUXA 4QU1A 3IBMA 4W4ZA 3AYAA 3VZNA 5LK7B 3ZSEA 4AI1A 1KRIA 4QX8A 4YW1A 2OVUA 3I2GA 3ROUA 3OBTA 4QAWA 2HWB3 3VBUA 4P9YA 3UK9A 4LBKA 1PK6A 1DQ5A 2J22A 2FZ1A 3A4UA 4MSVA 3J7NA 3WNLA 2AREA 1AJOA 3C7GA 2DU0A 1LRHA 1RVF3 3N9QA 1NY71 1PHMA 3NAPA 4RHV1 2BP6A 3LA2A 3OUHA 4NHMA 2W5FA 1VBC2 3EXUA 5EQUA 3RMYA 1OF4A 1SCSA 2VUJA 2EF6A 4I3PA 1OBNA 4UW6A 5K0UA 3RWNA 1PNGA 2QVSB 4FFHA 3UNPA 3FJSA 5FCCA 5IWFA 2EIBA 4UBHA 1YHFA 4J6GA 2XBO1 4AHWA 1R1A2 4I09A 1OD5A 2R042 3JBG1 1W0NA 1ZYBA 3H3UA 3ZFFA 3T4VA 1W6QA 1ASJ1 1RXFA 4B1MA 1JYNA 2ZZQA 2ZKLA 4MGQA 4ARYA 2Z69A 2ARXA 3ILRA 1G9FA 5C8CA 3KGZA 4CP2A 4XTMA 1SPPA 2VG9A 4QKFA 5A32B 4BQ4A 4NRPA 1LJ7A 1OPMA 3WP6A 4CEYB 2HWF2 3MI8A 1ZBE2 3OGJA 2VCMA 3R4UA 2HWF1 4LBOA 4IERA 1QDOA 3V64A 3LA3A 3POIA 2PLV1 5F6LB 2WNVC 1U5YA 3O1MA 1V70A 5C33A 2XKOA 2ZX1A 2VQAA 4IE7A 5I0UA 2JG9C 5J98B 3VBFB 4FTEA 3TN92 4URAA 4DOUA 1C28A 2W2IA 2Q5TA 4Q4W2 3JD71 2BOJA 1BKZA 5GZGA 3K51A 2A70A 1O4TA 2A75A 3VBOB 3VGIA 2FD8A 5DDJ3 1LOCA 2EXJA 4ES9A 1GV9A 4XDQA 2CYFA 3T1LA 1LHWA 2R0FA 4UT5A 2QQJA 2XJVA 3IDCB 2CSGA 1CIYA 3ZVXA 5HXVA 2GC0A 1RUG3 2EIEA 2YUEA 4MV2A 3VDAA 3VBUC 4Y4YA 1PK6C 1Q8QA 2RM23 4G4FA 4AI3A 1DG6A 3D0JA 1Z7S2 3MPPG 2WUHA 1XXNA 1LOFC 3IAPA 1ALYA 4YGCA 3BUCA 1O8PA 2EICA 2X53S 1NQJA 2ZKNA 3OG2A 4ASMB 2JKXA 3SCGA 3J7LA 1PMJX 1SFPA 1K5MB 3TEWA 4K9SA 2HWB2 2VMIA 3PURA 2GU9A 2J42A 3ITQA 1ZRRA 2G4IA 4XQWA 4NIAA 5K0UC 1CQ9A 5KXCA 5A7WA 5FZMA 4PCRA 1O5LA 3CLPA 2VTFA 4TWTA 4GB33 1RVF2 3PU8A 2BNNA 4HONA 3ZFFC 3KF3A 2W91A 2JIGA 3C7FA 3ZM8A 1IGOA 3UGGA 1LOGA 2ZHLA 4XCBA 4ZKTB 5CEHA 1G9BA 4YVWB 2PMWB 2VO5A 2XJTA 4RYDA 1JU3A 1VPHA 3M2MA 1XC6A 1QJFA 1AYN3 1IS4A 2I2SA 1VBE3 4OHYA 4IQPA 4YVSB 2OA2A 2OIIA 2BV4A 3ETPA 5L9BA 2E9QA 3IDBB 3FBYA 1A8MA 3GHMA 5C70A 5JPNB 3PL0A 4NO4A 1OQ1A 1J1LA 3PLQA 5JXGA 4AL9A 2AYHA 4IEVA 2D6NA 4GH4A 1TZOA 4QGMA 1OA4A 3UYJA 2YY1A 2RV9A 5FYVA 2QE3A 2O8QA 3BIWE 2R063 4X8NA 5C5TA 1PM4A 2VZRA 3PUQA 2E6VA 3M3CA 3Q9OA 2HLEA 4CP0A 1AZDA 4KU7A 4XURA 1ZRFA 4ET7A 3FLPA 5JOXA 4X8PA 3BYWA 4Q4V3 1CVNA 2NQYA 1BK0A 2HH9A 2XJUA 1YWKA 1H6XA 2LRPA 5DDJ2 4HZFA 1GICA 1S0CA 4XBLA 2D5FA 3M3OA 4OI1A 5LBFA 3GZUC 3N36A 2DUOA 1OOPC 1YCIA 1NXMA 3VKMA 4B4RA 2VZPA 1Y4WA 3I3MA 5KR7A 3CBNA 5CU1A 5EJ3A 1F4HA 1UIJA 4XETA 1QKQA 5LBCA 5C9AA 2XB6C 2RM22 3K46A 4A7KA 3O1TA 3FN9A 1QU0A 4AG4A 3RYRA 2ZZJA 4RQPB 2QQIA 3D4KA 3POJA 5FOBB 1FMD2 1ULPA 1LGNA 4PIXA 2D97A 4CDWC 3UKTA 1C5IA 4N90A 5AVPA 3S5QA 1FMD1 4QX0A 1RUI3 4W6WA 2D3SA 4FPCA 3O0VA 3MIEA 1I3HA 4LJHA 4WVMB 4RGKA 4CU6A 2G1MA 1Q8SA 1W04A 2IVIB 3LFIA 1SLBA 3AXEA 1F5FA 5AVAA 3I8TA 5HBAA 5I8TA 5LA9A 5ERLA 4PLOA 1UXXX 4GB32 1G8WA 4RA0A 4FPEA 3U78A 4X6RB 4META 2XJQA 3ACHA 1RUD1 1GNZA 3CJIA 2R1BA 2YBKA 3SNMA 4FQ4A 4JGYB 3VDDA 5B4NA 2PHLA 3V0BA 5FYCA 4CYDA 4Y26A 2DVFA 4A3ZA 4EJRA 5DAQA 4MG2A 4AF9A 3WG4A 1OLRA 1UF2C 2IXLA 2OQ7A 5CNAA 3W58A 5BPXA 3H3ZA 4RGAA 1AYN2 4AVVA 4HVOA 1VBE2 4QQPA 1W99A 1CAXB 1W6MA 3H3LA 4JDOA 3VD4A 4XFGA 5JOWA 1H30A 1JZ5A 3ORJA 3RSJA 4CVUA 2GC2A 1JZ3A 5IK7A 4W65A 1HJFA 1NLQA 5EXOA 4QXHA 3ZYIB 2ENRA 1R093 1O91A 5LW9A 2R6QA 3ZYFA 5F7UA 2N7GA 3PJYA 3ZPYA 4BISA 2RR11 2RHPA 3CL1A 4GJYA 2JIJA 2R0HA 4K21A 1R64A 2ERFA 5HV4A 5C5UA 2R062 3OUIA 1FV2A 4XJWA 1TME3 3SISA 4ARXA 2JE7A 4DXZA 4E8DA 5JCTA 4M4RA 3UT0A 1UX7A 3WX5A 1VBB1 5BNNA 1PGL1 2Q1FA 3LDRA 4HMZA 3URFA 4NVPA 4XF1A 2JX9A 3FUQA 4L8QA 5FBZA 3E6CC 4Q4V2 3MV01 1LEMA 5ABJB 5E88A 5E89A 3KGLA 1JOBA 5GZEA 4N8MA 5JSPA 5JI7A 4FPYA 4COVA 3KD4A 1VP6A 3GGLA 2ARBA 1MVQA 3DF0A 3KT1A 5I0DA 2FDKA 1HRI1 1S0BA 3V0AA 2NP0A 3MFCA 1DGRN 3HJRA 2JE9A 2A1XA 1W8UA 4IV3A 1RC6A 2YMZA 5FZ1A 2NZ9A 4KG0A 4XHBA 3U0ZA 2YU1A 4CPBA 3OCPA 1MS0A 1RITA 2LROA 1VALA 3LEKA 1RUI2 3M3QA 4GWIA 5CA6A 2YU2A 1XB9A 3VDDC 2XKPA 2JD4A 3M7AA 4H55A 1W90A 4EROA 2EIDA 2OQ6A 2PN5A 4TYSA 4ZXKA 5HCHA 5C6CA 5T5JA 4AAPA 2GNTA 1JBCA 2ZGQA 3K2OA 3HOBA 4HOOA 1HIXA 4XPVA 2VH9A 4B1LA 5A1AA 3CHXA 1WW5A 2MPFA 3JQWA 2V5YA 3F2ZA 5BY5A 1UU6A 2AENA 1JS9A 2D93A 2W68A 5I0SA 2JB8A 4DY5A 2HWD3 1TMF1 2GH2A 1RUJ2 4AI2A 4AEJA 1W2UA 1JUIA 1RUJ1 3KT7A 1LKNA 4QB1A 2W9XA 1VB4A 5FMCA 3ATGA 4M4PA 5IVCA 2V5DA 3B5LB 1S2KA 3KHCA 1KQRA 1R092 4CU9A 5BNNC 3TEYA 3KF5A 4HN1A 1R091 1OHFA 4CU7A 2VUAA 1PO23 4C0HA 2B46X 5LEKA 1GWLA 3N9LA 4OHXA 4XUQA 3LIHA 1TME2 4L0PA 4A41A 5A32A 4CEWC 5JIAA 4DQAA 4EN0A 4AW7A 4KI5M 4NAOA 2LS6A 2F4PA 4NWWA 4FQZA 5F3EA 1VAVA 1UYXA 5FPAA 4GMP3 1VBA3 4UYBA 4YGEA 3LFMA 3WCRA 5BV6A 2MHFA 1C4RA 1UXZA 2J1SA 2VZQA 1W28A 4YZ4A 2WWUA 2AH2A 3JXSA 1YFXA 4XC9A 2VL4A 3ZDSA 5FMOL 3BPSA 4DRVA 2YXSA 2QQOA 2HBTA 3PMEA 4XDPA 4RD7A 1QJZA 3RJ2X 3ZIXA 3OGVA 3MLJA 3AXDA 4MVTA 1GP5A 3V56A 2RS31 5H9QA 4AFAA 2JDAA 2PA7A 1KEXA 1V6IA 2OS2A 3VBOA 2V4AA 4AEDB 1KITA 1DDLA 5KC5A 5E6HA 3JB8A 3EBRA 3SHRA 4OFGA 4ATFA 5CZKA 1CPMA 2ARAA 2QQPA 4BOWA 1QQP3 4IEWA 4R9AA 5FQ0B 5F3CA 1LULA 3LZZA 1CZTA 1RUOA 1V9U1 2VUDA 1RUE3 1MS1A 1PVXA 1X7NA 5FXWA 4FPFA 1VMFA 3N9MA 1PX3A 5JSOA 3TBDA 3ZSJA 4WM8B 1DQ6A 1K3IA 2V73A 3WDWA 5HCFA 4A7ZA 1RUH3 2A3YA 4AI0A 4BZ4A 4OUMA 4XCAA 1SACA 4I0WB 1UU4A 3MGUA 2AC1A 1T6GC 1AVBA 1SLTA 1YO8A 4FTSA 2YPDA 4QPGB 4YZ3A 3TRSB 5T54A 3O14A 4FOVA 3HBKA 4EZHA 4FP3A 4D0QA 3NW4A 5E8AA 5T5PA 4H3WA 1QMJA 2CWMA 1EV11 2O0OA 1PO11 5FRAA 1BVP1 3UV9A 3GNEA 2WABA 1S1AA 3NKTA 3UJOA 1XNTA 2PQSA 1W0PA 3BVCA 3KM5A 5AC93 2HWD2 5JOYA 2GC3A 1JHJA 5KHIA 1AR61 2BRTA 4M3CF 1CJPA 5AFBA 2B9VA 2KXLA 1UPSA 3IZOA 4CE8A 5DUVA 5IVVA 2PFWA 1JN2P 3ZLIA 4V2WA 5FPVA 3LWCA 1FXZA 1DQ0A 3MFAA 1MZFA 3TNPB 4AHZA 2ZHKA 5K8SA 5FP7A 4PF1A 2Q8DA 4KBBA 2C26A 2ZGPA 3GBFA 4K8RB 4XMAA 4LE4A 1VAKA 4O61A 3TWIA 5FO8B 4BB3A 4CDQB 3SH5A 1LU2A 1OXCA 1PO22 1V00A 4YVSA 4H7MA 4B4QA 2YGLA 4BJ0A 1PO21 5J36A 1NLSA 3PIGA 3LIGA 1H9WA 4ZY9A 4M0NA 2XDVA 5FDBA 1EPWA 5GZDA 1SLAA 1QY4A 3Q8EA 5H9PA 1X82A 2K0GA 1BBT1 4K3UA 3POFA 4HLTA 1VBA2 3P5BA 3PU3A 5C3SA 3AP6A 1UU5A 1PZ9A 1B09A 3ZFEC 3LB9A 3NWKA 1WCKA 1WMFA 2CDOA 1SBEA 2VOKA 1QIQA 3AP9A 4QT6A 4DS0A 4A6SA 4JKMA 3DYMA 1ND3B 2C9KA 4MGIE 4AQSA 4BCUA 5HI0A 1E57A 4Q4X1 3WCSA 1GQHA 2W92A 3GBWA 4ITCA 1CESA 3NNMA 4E4DX 4CA9A 2ATFA 3R6SA 1JYTA 1ENSA 2HYKA 2W52A 2IXHA 4QM9A 1ONAA 5IAVA 4LO8A 2WIIB 3CQOA 4LTAA 4YG0A 1QQP2 4Z82A 1IS6A 5FKCA 1WWYA 4XABA 1RUE2 4HKWA 1K12A 1U5IA 3WUCA 5FYTA 2JB4A 4JQRA 5FXZA 1IG3A 2FBEA 2IFRA 4P9IA 4IV1A 1W6OB 2W1WA 1L7LA 1RUH2 3AYEA 4RQPA 4Q2FA 4QQHA 4DRRA 1W6NB 2BW8A 3POYA 3LQCA 1O8SA 4YG6A 2OPWA 3S30A 4NOTA 4K20A 3WNMA 3FE5A 3OEAA 4Z1VA 1POV3 1CAVB 2EAKA 1NT0A 2QQWA 4WVMA 3VL8A 1C8M3 4LOSA 4QHOA 3WINE 4A7YA 1O6UA 5AC92 2UWAA 1LU1A 3OY8B 1BK1A 2JD9A 1OD3A 3GCXA 1JZ7A 2JXAA 5CFCB 2FCVA 4HG6B 5FY0A 4YVSC 3M1HA 4F83A 3IB3A 3MIBA 2VCAA 3FFZA 5IFPA 3GZEA 5FK7A 1V6OA 4CUCA 4LO5B 2VZ3A 5FZHA 1Q8PA 1WZXA 4P00B 3L2YA 4ZS2A 1ULGA 3RI8A 4COZA 4E4SA 1HV1A 4P9GA 4TTGA 3LOBA 1CN1A 1OA3A 1PGW1 2Y0IA 5A33B 4IEZA 3ECQA 1CAXA 1AR73 2GN3A 1UOBA 1ENRA 4OZXA 5C3OA 2R072 2VTXA 3RQ0A 1L7QA 2MEV1 1JYIA 3BCWA 2R071 5JMCA 3NQHA 2Z5WA 3VDCA 1HN1A 1BEV3 3I59B 4MOAA 2V4VA 4LKEA 2ZX2A 1BMV2 5DZFA 2P6HA 1NZIA 5J7MA 3DV8A 4EQVA 5J1XA 3O12A 5A7OA 3T3YA 3BU0A 4CUAA 1UKRA 5FYBA 2CGNA 3CU7A 2WS93 5FP8A 2ZEYA 2YBSA 5J48A 2P4EA 2D40A 5FLJA 3NV4A 3J4UH 4JDMA 4JV4A 1H2LA 1JYVA 4KGGA 4A4AA 5LK5A 4R52A 5HCAA 5FJHA 1J1TA 3JB4C 5JXJA 4GAZA 4XIKA 5ABJA 4GIQA 3ZXFA 4DINB 1DZQA 2QKDA 4IV1C 1YI9A 4JVAA 4KGQA 4LXLA 1RTVA 2OKXA 2OT7A 2VU9A 2CGPA 3N9PA 4LLOA 4RHV3 4IXLA 4AVSA 2BJSA 1XOYA 3CF6E 4XFAA 1ZVFA 4D94A 5JZGC 2YC2A 3N9NA 4Y22B 1O59A 2VOWA 4Q0VA 4ZPIA 2CTVA 3VBRB 4BE3A 1NOVA 1XNBA 2XBO3 1FNZA 3EB7A 5JOZA 3JBG3 4OLLA 3LCPA 1XE7A 3IT8A 4YW4A 5EP9A 1ASJ3 3LEIA 5M0TA 3O1SA 1DZRA 2VVDA 4LUKA 2EIGA 5F5IA 1C1FA 2P3KA 4WM7C 1C8M2 3K3NA 4D3WA 3IMNA 2ZGNA 4IDZA 5CFDA 5F1RA 3VHNA 1UZ0A 2EAAA 1GZWB 3EO6A 4CP9B 2EA7A 4Y1ZA 2Y26A 5A6XA 4PF5A 1REDA 4A42A 4JRLA 4XJZA 4HK8A 3PTYA 4RR3C 3OB8A 3BIEA 4K40A 2PLV3 3H7JA 4N53B 5DZEA 5B2GB 5FK8A 1QNWA 3I2KA 3LDKA 3POSA 2VOTA 4PBPA 4YW5A 5FZ7A 3T09A 3VBSB 4E4HA 1KS4A 1O5UA 1UX6A 2JWPA 3D3AA 2UWBA 2VC9A 3O1PA 3BN6A 3JD73 1F15A 1AR72 1NCRB 4FOQA 3K4DA 3OPZA 5C71A 1MACA 5IK4A 4M3CE 1AR71 1QJX1 1UMHA 2JDPA 3EYPA 4HKOA 2W95A 5FFOC 2ZEZA 3KZ4C 2O1QA 4JGZB 5F3IA 5FZKA 5KHHA 4Z2WA 4P5HA 1NKGA 4LA3A 5GLVA 2D44A 1BEV2 3O0XA 3A22A 1MPXA 3I97A 4FSJA 4QHZA 2BQPA 2OZJA 2P6CA 3Q8AA 3TB0A 4AI8A 3P1IA 1AUYA 1LTEA 4LK7A 4COUA 1C1LA 3PUHA 3ETQA 3IWZA 4N9HA 4LHLA 3AP4A 2WS92 4KH9A 5L36A 2ORZA 4UW5A 4XFFA 5F2SA 2PHFA 5FZBA 2A71A 3RNSA 1UY2A 4D6SA 5AFEA 3R4SA 5A80A 3I2JA 1W06A 4AFMA 4CCOA 3A23A 5DPNA 2WN3A 4NHLA 2VVFA 3PTRB 4CSWA 4XFBA 4NR1A 2EVXA 3KB5A 3O1VA 2P3IA 1GWMA 1PMHX 5EPAA 3AP5A 4KMQA 2VZUA 4BQYA 4D69A 5GLWA 2RDSA 3AFKA 3J9SA 1PM7A 4HFSA 3RZZA 1JZ2A 4JZRA 4HSLA 3ASIA 1DU3D 4DXTA 3RVHA 1NY72 3MW3A 4JHTA 4JTOA 1W3XA 4UFLA 4RHV2 4I0AA 3TYJA 4BIFA 4CCDA 2ILMA 2KR2A 3OTFA 4W50A 1HW5A 2FZ2A 5FPXA 1RGSA 3JQXA 4QB2A 2WR9A 3UJQA 5CFDC 2DF7A 5LWBA 1QJEA 4P9LA 3WW4A 2XBO2 4FAHA 4XVHA 3HQUA 1UMIA 3JBG2 1WUVA 1V0AA 1FPN2 2LUWA 2W87A 1BXHA 1ASJ2 1NE4A 4R9BA 5F6KA 4K1ZA 1FPN1 3BU7A 2DTYA 3ZOIA 1I9RA 1YQ2A 3TEZA 4WM8A 1SLCA 1XYOA 4C90A 5A3WA 4I30A 4XF0A 1HN0A 2B42B 1W8TA 2RS12 3DUIA 4E9KA 2WT1A 3ZXJA 2VZSA 2OXBA 2JJ6A 2RS11 3IN9A 3O1UA 5FMOS 3VUOA 2E7AA 1J58A 2WT2A 4YSFA 4AOCA 2PLV2 2B4KA 3AKPA 3E97A 5EV7A 5KXDA 4FPLA 1LHNA 4IW3A 4D6RA 3HBZA 4LBQB 4ZZ8A 1YXWA 4HL0A 3SCFA 2WN2A 3USUB 3JD72 1LAJA 3DGTA 1JH5A 3QLQA 4KL1A 3VKFC 5IAXA 1VRH1 4W8JA 1CAWB 5IVFA 3NL1A 4CZSA 3RZJA 3THCA 4B4PA 5T52A 2DFCA 3F95A 1XPWA 5A1FA 2Q1MA 4MGZE 2BVBA 3CEWA 2P3JA 1OH4A 1PX4A 1STMA 2BERA 4QB6A 3AB0A 1ODMA 3EMRA 4HANA 4IL7A 4CDQA 1QOSA 3I3EA 4QDQA 1QWRA 2VBPA 2F6BA 1YRZA 2IZWA 3NNFA 5BNPA 4KG8A 3VD9A 1MS4A 1LHVA 1DZTA 2QCSB 3WDXA 3ACGA 4PDWB 2VUCA 4RN5A 4KWUA 4F8AA 1QXPA 5FPBA 1NG0A 3K75B 4FPOB 1FMD3 3NJYA 3ZYBA 1WLTA 1MS3A 2ET7A 3KQ4B 4NWVA 3QH7A 4QPIB 5KWRA 3NMBA 3NAPC 4NHKA 1NZCA 1OUXA 3HMYA 5SV8A 5DUWA 4BPZA 4XJ9A 4YW6A 1O7FA 5FREA 2YYOA 3KLSA 5CAZA 2RVAA 1ZX5A 2WFF2 2R49A 4YZ5A 5L7OB 3N4MA 3B00A 2WFF1 3W59A 1ZBA2 4C8DA 1W9TA 1AF9A 1RUD3 4MHRA 1YQCA 4Q26A 4CRQA 1ZBA1 1URXA 1DLLA 2ARCA 2GNDA 2WZR1 4NHYA 3TEXA 1LODA 1C57A 5I91A 4S2DA 1HKDA 3ZXAC 1H4HA 4LLFA 5C8CC 2W46A 1LNSA 1WBFA 1YI7A 2GP3A 2VY0A 4XTPA 3V65A 3TOJA 1W6PB 1QOOA 4BYYA 1UOGA 3WF1A 1VBD2 1RHI1 5CBLA 1IOAA 4QGLA 1FNYA 4QPWA 3OD0A 1E5SA 1VBD1 1OSGA 1TQ5A 1QF3A 5A3TA 1W6OA 1LOEA 2C6SA 3PVOA 5FYYA 1B35B 3P3NA 1W6NA 4AVTA 5JPMB 4PBOA 5A7QA 5J3UA 5JIUA 2RR13 4XYXA 2FDHA 1IG0A 1CAVA 5HXMA 4N43B 1ZA4A 1CJDA 4UBGA 4QXKA 1AYM1 1FV3A 1SDWA 4S2FA 3T08A 5JDBA 5FY1A 1NA1B 1U5XA 5C4WA 1OI6A 1VBB3 2SBAA 2SLIA 4E8CA 3OY8A 4RS5B 5FAXA 2VTXJ 1GKBA 4Y20B 4CDQC 5CFCA 3BALA 3WG1A 4LHNA 4FOWA 4ORFA 2H6BA 1ND2A 2YC4A 1H6YA 1V6LA 4A45A 4A6OA 3WP5A 5BNPC 1XE8A 1XJAA 2XHKA 1ULCA 3PVEA 3ZXKA 2CHHA 3AZWA 1JZ8A 5D1IA 5JXIA 2FDJA 1UO9A 5FYMA 2E7QA 4P9JA 5GM0A 1H8TB 1JYWA 5A33A 1RUF1 2RMU2 3NJXA 4Y33A 3FBMA 3UGHA 1HRI3 4KNCA 3O1OA 1X36A 1LESA 2RMU1 4PT6A 1HRV1 1QXRA 3PUAA 1N3OA 2IXJA 3GDBA 2YHJA 1UZVA 5D8AB 2ADDA 5IT6A 1FI2A 4FPGA 5FP3A 4AHYA 3I59A 1LR5A 1UQXA 4CDUA 1GP4A 1S2EA 2A6WA 2GSYA 1OVSA 2YB7A 2WBKA 4MO3M 3THDA 1IPSA 1JI6A 2W3JA 3AJZA 5JLVA 3C3VA 4XOGA 4E2GA 2UYBA 1GLHA 1S4CA 1AR91 5LA1A 3I2IA 2IFWA 3R05A 3WDUA 5CISA 5FZDA 3AKRA 1REEA 1IPJA 4HSJA 2H6CA 3ZFGA 1LHUA 1ZZ6A 3BTZA 3WDVA 1RUD2 2XG3A 2Y6JA 5FYSA 5FZFA 2BYVE 1BJQA 1XU2A 3I4IA 1S0IA 2HEWF 2J1RA 1T2XA 2ES3A 3P3PA 4BIOA 1JZ6A 1NCQA 3PNAA 4AVCA 5FZ4A 1TMF3 5FZIA 1H4GA 2D7FA 3Q8BA 1LENA 2QUOA 4CU8A 5HV0A 4D7SA 1RUJ3 4GH4C 1VRBA 2W39A 4FFFA 1F5JA 3I2FA 1WMXA 1U12A 3LEMA 5T55A 5LCWL 2ZX4A 3OPWA 3ZMOA 4Q4Y1 3HD8B 3ACIA 4P9XA 3MIHA 3VBRA 5C4WC 4NIGA 2GDFA 2RR12 4QMAA 4CUBA 1W2OA 4LQRA 3WNPA 1HB4A 3UL2A 3P6BA 5K9YA 1ND2C 4AFCA 1M4WA 1Q56A 4D7YA 4P5YA 4Y5TA 4E2QA 4EV0A 4CCMA 4LA2A 4DEVA 3NKGA 4HETA 5T5OA 5APAA 2PQQA 1J83A 4IE5A 3HQXA 4ZS3A 1MQTB 4F3JA 4GWJA 2JG8B 1VBB2 4WVWA 5ACA1 1PGL2 2WL1A 3LDBA 3PJQA 5FIXA 4XFIA 4LNVA 1X8EA 2QNKA 1W2TA 3HEIA 2HEVF 4P9WA 3AZVA 3GJAA 4UW3A 4UWDA 5LBEA 3VBHB 1UN1A 3ACFA 4BXFA 2VNVA 1SCRA 2BBAA 1W39A 4AEKA 3WDTA 2PYTA 2QQNA 1WD4A 3VZLA 4BK4A 5C9AC 3VBSA 5A7PA 1OFNA 4CDUC 1YIPA 1OLMA 1MS5A 2GALA 2WQ4A 1NCRA 2RS33 2YPJA 1HRI2 5KBFA 1Z0HA 3W5NA 4MGTA 4JGZA 2DVDA 3PIJA 4MX3A 4QD2A 4LKSA 4Q1PA 4CDXA 4XFHA 3ZFGC 4ZXEA 4YW2A 3U4XA 1V9U3 4C1XA 4CCLA 2JENA 4AXOA 2JDYA 4LHSA 3AM2A 2QQMA 1OUSA 3CJIC 2XL7A 1N1TA 5J96B 1RJ8A 2X5IB 1CIWA 1NCQC 4NIDA 5I0RA 2B8MA 4CP1A 3AC0A 4L2NA 4PIYA 4ASKA 1W2NA 4BQXA 3WW3A 5IVEA 3HNBM 2DTWA 4QM8A 1KFUL 2OPKA 4C0BA 3GZAA 4TZDA 3I2OA 2CY6A 3WW1A 4AI9A 3BTXA 1EV13 1PO13 1TVGA 4OCTA 2GC1A 2QQLA 1H1AA 5LRSA 1RIRA 1WMDA 2NYYA 3KHBA 1F8VA 4FVVA 5F5AA 1AR63 1TMF2 2Q0AA 3SH3A 3T30A 2WO7A 4PI2A 1W05A 1TEIA 5CADA 5JI9A 5DUUA 1UY3A 2V09A 3LA7A 4O7XA 1N47A 3KCCA 3N9OA 3NSTA 5FZCA 3RMXA 3WF0A 3ZKUA 2A3XA 1IQDC 4HN0A 4HXCA 4S2HA 4G9SB 1Y9MA 2HWC1 1PIV1 2WQZC 1DQ2A 2ORXA 4OHWA 2B45X 1E5HA 1QJU3 2ZGMA 4J25A 3RRDA 4JQTA 1GANA 4KBZA 4EN6B 1H9PA 2QQUA 5KHGA 4QKNA 1GYKA 1WMEA 1DLCA 3AL5A 1YUDA 4QGNA 3LE0A 5FZEA 5DMYA 1PVC1 1VLNA 1WCUA 3SKVA 2F17A 2C0ZA 1AXYA 1UIKA 2DCKA 2E32A 3T0AA 2QDRA 1BBT3 3IIIA 3SITA 4CEYA 2I45A 4AEMA 1LEDA 1OH3A 3POBA 2GNBA 2BFUL 3WR0A 1CD3G 1ODNA 1XYNA 1BHGA 3B3QE 4NAMA 2WNVB 1OA2A 5JR7B 1GMMA 1OLQA 2OUHA 4IE0A 4LBQA 4XW3A 4EE2A 2G9FA 5J37A 4GZ9A 4R9DA 3GJBA 2JG9B 4IV3C 4CDXC 2XVLA 2ZMLA 3HVDA 3MBWA 3VBFA 4Q4X3 3E6BA 5J09A 5FXVA 3WNKA 2VZTA 3RS6A 1SFYA 1QOTA 2RS32 3I54A 1UMZA 1AR81 5FKBA 3SXWA 1G7YA 5FBJA 3WZ1A 1DP0A 1CAWA 1W9SA 2A7AA 4PIZA 2XLGA 1EY2A 5FP9A 3U1XA 3SKJE 4JX0A 1QJY1 5FZ9A 2DURA 3BKZA 4I0BA 2E26A 2VBBA 1V9U2 3SH4A 3ZXGA 4NE9A 1REFA 1QHDA 1RYYA 4RFT0 4P02B 2VZOA 4DZGA 3I3BA 4ZHNA 1ULFA 1H2NA 2UURA 2X05A 2WLPA 3VBUB 3FX3A 4DB5A 3BGAA 3LOIA 4PDWA 1PK6B 3HQRA 2KD7A 3AZXA 5EYYA 4H7LA 4AK3A 1AXZA 3E5XA 4K8FA 3VLBB 3RDIA 3AP7A 2XJPA 3GF6A 2UU8A 4GKYA 3S5AA 3ZMNA 4IGOA 4QPIA 2RDNA 4MLOA 3OGSA 3TNQA 5EYXA 4AQ2A 1HQLA 1TNFA 1EV12 1W9YA 1PO12 4UFKA 1K5MA 2B5HA 2D6KA 2FMYA 3VZJA 5K0UB 2W47A 1ST8A 3MIGA 4YGDA 2C5DA 4R8HA 1O3TA 1V6MA 5KXEA 2P17A 2A6YA 2VNRA 5L7OA 3WLUA 1AR62 3USSA 3DYOA 3POWA 1F31A 4HVRA 4YM1A 4HKLA 3RWKX 4HVQA 1G6NA 2BGOA 1D2QA 4TN7A 5DG2A 2VD7A 5A3LA 5IVBA 1RUC2 3JUUA 2B9UA 4MXWB 1RUC1 5JVVA 1JU4A 1GFF2 3KV9A 4QX5A 1HB2A 4IEQA 2ZACA 3J8F1 4YVWA 4MYEA 2D43A 4LBQD 1QJU2 1W6PA 4B7EA 2GMMA 3ZYJB 4CEYC 3HNYM 4I3GA 4AGVA 3AVSA 4BQ1A 1QJU1 5C3PA 1H1MA 1ENQA 1ZZ8A 2BU9A 4DEQA 2TUNA 3B93A 3EHKA 3HR9A 3ABZA 3WF3A 3U75A 2BWCA 1CWPA 2MEV3 4XUPA 4JDNA 1B35A 1S0EA 2WSVA 2R073 3AMPA 4FXKB 2R30A 4ZU7A 3K4AA 1UOJA 3VBFC 3ACLA 3ZYRA 2YGMA 1BBT2 4OHZA 3WVJA 4DIQA 3D6EA 1YJKA 4N43A 3B9CA 4BDVB 3RJRA 1DBNA 3AMMA 1PZ7A 4RFRB 3VBOC 1NA1A 3H8XA 4ISRA 2YV8A 2W0XA 2Y6FA 3H1MA 2B39A 3OJBA 4RS5A 4Y20A 1MZ5A 3LF7A 2P34A 3NJVA 4BQ5A 4FFGA 4K1YA 1F2NA 4Q4X2 4QDSA 2G19A 2VAUA 2WAOA 1UPIA 3QACA 1EUUA 3ZXDA 4FTBA 1SZBA 1XNKA 5T5LA 1XYPA 3DXUA 4MZUA 1UWWA 2NPIA 2QBXA 2OUJA 3JCIA 1EAH1 2VVEA 2ZEWA 1H8TA 1KJLA 4LITA 3AYDA 2ZAHA 5FTTC 2BBVA 2VJXA 2A6ZA 4L92A 4IEYA 1OOPB 5LBBA 1AX0A 5FXXA 3WOGA 3FHAA 2NMOA 1S2BA 4QPIC 4FFIA 1YYNA 1K5MC 3APBA 1A3KA 4BQ2A 3N3HA 5D8AA 5LY2A 1NE6A 1C5HA 4R9CA 1HB3A 3LPGA 3KQRA 4Y3OA 2X29A 2OYZA 2ZA9A 4R4XA 3BPZA 4CDWB 1UZZA 5DQ0A 3MHZA 2RS51 1E5IA 2R32A 3GHNA 4BA6A 2Q30A 5KC6A 4CXXA 3ZYGA 3NO8A 1RUNA 5LY1A 2WO3A 3CNAA 4FPKA 1P8JA 3VD5A 3N7MA 1Y43B 5A3NA 2WWJA 4YVWC 4P14A 1GOHA 3T0BA 1IS5A 2X8KA 4Z2AA 1W03A 1A34A 3C2UA 3T2TA 1FOD1 1RXGA 5LA0A 2WSUA 1RJ7A 5TSWA 4AHXA 5IYYA 1YQ8A 2PHTA 1T6BX 3MW2A 4NUBA 4GQ7A 3KV5A 1OT5A 4U2AA 2FMDA 3NV3A 1COV1 2IXCA 2HWE1 4JGYA 2QQKA 2L9LA 3ZN6B 1AL21 2PHXA 3POEA 1IQAA 1PGW2 3WNXA 3RZLA 1US2A 2WLQA 4BQ3A 5LASA 4N43C 2NM1A 4MHUA 1QJX3 3GALA 4I2OA 3ELNA 5FMBA 4JC1A 2MEV2 2VCCA 3ZPOA 3MYXA 2VECA 3T2OA 2DBIA 2YZ4A 3VV1A 1O3QA 2MNGA 3HN3A 5LB6A 3HIFA 5JXHA 4ZZ5A 2C24A 3RYPA 5F32A 5FLIA 2ZGLA 3E6DA 1VE0A 1OLME 1ACCA 3WUDA 1PGSA 3HPNA 5FZOB 1BVVA 5FZAA 1MZEA 3NNLA 2CWSA 2G9GA 5A3UA 3VBHA 2OW4A 3U10A 1GUIA 3VKNA 2FCUA 4OQ8A 1OFSA 3FMGA 4UF0B 3NNGA 2WYFA 2J1AA 3CZJA 2A6VA 5GLUA 1H2MA 3LEGA 1AX2A 2E33A 4AWDA 2AGSA 1UZYA 3KV6A 4HT1T 2VBDA 1G9CA 4RQPC 2ID4A 4YRDA 1W8OA 3PDQA 1W2AX 3DN7A 1S0GA 2DCZA 4XUTA 5DAPA 4YARA 4GA9A 5A6YA 5JUVA 4MH0E 4FI9A 3LSDA 1D4M1 2PAKA 4XF9A 1GQPA 1S0FA 1XSRA 2IWGB 2W1QA 3ES1A 3ZN5A 5JWPA 1HDKA 3ILNA 2HYXA 5FUIA 4J1WA 2ZXQA 4L11A 1U5ZA 1FPN3 1GNYA 2JEMA 1W8HA 4YPJA 2IXKA 3HN1A 5CB7A 4OUSA 3DCQA 3VDDB 4YZ1A 1WCQA 3G6JB 2HBUA 2WA3A 4JGYC 4OZOA 3V0BB 2FDGA 5CIRA 4Y5Z0 5FOJB 3DXTA 2VMGA 4YFZA 2QJVA 2J1VA 2VOXA 2WA4A 1WCSA 5IHRA 3DECA 2RS13 5CKMA
chains in the Genus database with same CATH topology
5EHDA 1NLQA 4CA9A 1XE0A 2VTXJ 2P1BA 4N8MA 3T30A 1XB9A 2VTXA 1K5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EHD A;  1NLQ A;  4CA9 A;  1XE0 A;  2VTX J;  2P1B A;  4N8M A;  3T30 A;  1XB9 A;  2VTX A;  1K5J A; 
#chains in the Genus database with same CATH topology
 2W1S A;  2BUK A;  1W6M B;  4RGG A;  3BOW A;  3WF4 A;  3FL7 A;  3OGG A;  1DGW X;  1SFN A;  2FQP A;  2GMP A;  3KVB A;  3AK0 A;  1J3R A;  3LD8 A;  1DYP A;  3G7D A;  3AYC A;  4A2U A;  1UY4 A;  4GMP 0;  4Z07 A;  2DYC A;  4L9B A;  4WVV A;  5L9R A;  3FZ3 A;  4OQ9 A;  4CCK A;  3WHU A;  2KA3 A;  1VRH 3;  4ASL A;  2P1B A;  3O5S A;  3WHT A;  2BOI A;  1QJX 2;  4Y4R A;  4O9G A;  1UY1 A;  1VIW B;  1O4Z A;  1R08 1;  1UNB A;  4AYU A;  1L7R A;  1IKP A;  2VOV A;  1YIF A;  1I5P A;  3VL9 A;  4COY A;  5FYH A;  4D7T A;  2R1D A;  5A7S A;  2VW0 A;  2YDE A;  2ZS6 B;  3W20 A;  4COW A;  4DUV A;  5ABJ C;  5FLH A;  3WSO A;  3AX4 A;  1J84 A;  5K7P A;  4Y1Y A;  4FOY A;  4OVE A;  4CEW B;  1Q8O A;  3PUI A;  4Q8L A;  1UAI A;  1Z78 A;  3I3Q A;  1Q8V A;  3KSC A;  1MEC 1;  3CDZ B;  2DVG A;  2Y0O A;  4D8M A;  3DEM A;  1O3R A;  4SBV A;  4P08 A;  1SDD B;  2XOM A;  3N7K A;  4J1X A;  4YYO A;  2V72 A;  1FAY A;  2WNV A;  2DVA A;  4BQW A;  1QXJ A;  1YLL A;  5IVY A;  3AMH A;  3D8C A;  4UOJ A;  2JG9 A;  2CNA A;  4LUL A;  5DG1 A;  3M3E A;  1XRU A;  2WFF 3;  4EYU A;  3AZY A;  4E27 A;  2D3R A;  2I74 A;  5FPL A;  2D6P A;  3SEE A;  1ZBA 3;  1RMU 2;  1ZRE A;  5E1R A;  2GZW A;  2WZR 3;  4YW3 A;  5FV3 A;  1RMU 1;  1SLL A;  3KVA A;  2D5H A;  4YW7 A;  4PQ9 A;  3ZYP A;  3LSE A;  1JMU B;  4AED A;  2WT0 A;  4GWN A;  1R1Z A;  5E16 A;  3S6P A;  2PAE A;  2GNM A;  2PXJ A;  3X29 B;  5FQ0 A;  1HXS 3;  1POQ A;  2DBN A;  1QEX A;  3H42 B;  2ZTN A;  4I02 A;  5LAT A;  3WD5 A;  4IGP A;  5FY4 A;  1RHI 3;  1JXN A;  3FHQ A;  1VBD 3;  1K5J A;  2Q1Z B;  4ZU5 A;  4YG3 A;  3PMS A;  4JRA A;  2YG0 A;  3UKV A;  1CON A;  2FHR A;  3ZSL A;  2CDP A;  5FY7 A;  1JOD A;  1LGC A;  1WA6 X;  2BFU S;  3UGF A;  1MS9 A;  1HX6 A;  4AGR A;  4QQ2 A;  1LOF A;  3CZU A;  4QKD A;  1CZS A;  4MGY E;  3KS7 A;  2FDI A;  1K42 A;  4QPG A;  1NYW A;  5ISL A;  2GP5 A;  3VHR A;  4DXS A;  3H9A A;  1UOF A;  4JHZ A;  1AYM 3;  4PLM A;  1LB2 A;  1XND A;  2QZ2 A;  2Q4S A;  2XGX A;  3OD4 A;  4YZ2 A;  1VBC 1;  3IKW A;  3LPF A;  3WG2 A;  4FP2 A;  3AZZ A;  1C8N A;  2GAU A;  3WXP A;  4BLI A;  5FO9 B;  3LKJ A;  1R1A 1;  2JDH A;  2J1T A;  2P37 A;  2R04 1;  4X6Q B;  1X33 A;  1VRH 2;  2ZGS A;  2E53 A;  5K4L A;  5JMO A;  2WDB A;  2IXI A;  2ZPX A;  4MXW A;  2JDN A;  4WZC A;  4XUN A;  5KXB A;  2ET1 A;  1YQ5 A;  4QKB A;  3VDB A;  4XIO A;  3OGR A;  3C7E A;  3RZK A;  4M3C B;  1RUF 3;  3H8U A;  4LKF A;  1EPZ A;  2Y38 A;  2CAV A;  2RG4 A;  1ZBE 1;  3JZV A;  2RMU 3;  4BXS V;  2AZ5 A;  4AFB A;  1HRV 3;  1CX1 A;  2PAM A;  2ADE A;  1UYP A;  1EP0 A;  3E5U A;  3NJZ A;  4XUO A;  1KS5 A;  2WC2 A;  3FHI B;  3OYW B;  5DAX A;  1S0D A;  5FO7 B;  3RGB A;  3ZIW A;  4L97 A;  2XVK A;  3WNN A;  4BMB A;  2VMD A;  1E5R A;  3B69 A;  4MXV A;  4LMF A;  3TN9 1;  3ZDV A;  5A3P A;  4Q4W 1;  3AL6 A;  1JW6 A;  5F39 A;  1AXK A;  1G9D A;  3D0S A;  1AR9 3;  2VQ0 A;  5ANQ A;  4EN9 B;  2J1E A;  3ZFE B;  3A0K A;  4XF4 A;  3MID A;  4AED C;  5A1L A;  1SQ4 A;  5FZ8 A;  1N3Q A;  2A73 B;  2P5B A;  4BHP A;  3WG3 A;  3S0M A;  1POV 0;  1OQD A;  1ND3 A;  4KWJ A;  4R4Z A;  5FP4 A;  2D6L X;  3FLT A;  1ZRC A;  1XBF A;  5F2W A;  2R7E B;  4NPR A;  2WZR 2;  3OF1 A;  3ZR5 A;  2C1F A;  4DNY A;  4CXY A;  3NV2 A;  2QQV A;  1DYK A;  2EXI A;  2XL9 A;  1WBL A;  1QNY A;  2ZBJ A;  4WM8 C;  2HJI A;  3KWV A;  4Y24 A;  2VMC A;  2ETE A;  1PZ8 A;  3O7O A;  3S7I A;  4B3N A;  2AAC A;  3KT4 A;  1Z7S 1;  4F7Z A;  1HXS 2;  1OOP A;  5BYN A;  1AX1 A;  1YFU A;  4QPG C;  4AE2 A;  1RHI 2;  4UFJ A;  1HXS 1;  4XQD A;  4AGG A;  3TAY A;  2VPV A;  2DU1 A;  4UFM A;  2BGC A;  2RE9 A;  4Q4Y 3;  3KV4 A;  5CYY A;  2HWB 1;  1H1I A;  3W9A A;  3VKL A;  4CDW A;  5F3G A;  1WW7 A;  4KWL A;  3BOP A;  4S2G A;  4AAX A;  1XQN A;  1RVF 1;  5G04 L;  1ZRI A;  2PHR A;  2WZP P;  1MVE A;  1AYM 2;  1W9F A;  1S55 A;  1ZM1 A;  5CKN A;  1W9W A;  3VZO A;  4BU2 A;  3D5O A;  5ACA 3;  3I7D A;  1D0G A;  4Q5O A;  1JTZ X;  4Q8K A;  1F4A A;  2VNG A;  4K6B A;  4LIV A;  2BZD A;  2BGP A;  2WAA A;  4YFW A;  4XHX A;  4FCA A;  4ATE A;  2IC1 A;  3U14 A;  1ZA7 A;  1I6X A;  4NMI A;  1YQ6 A;  1CAU B;  4Y5S A;  5LEJ A;  1VMJ A;  5FPU A;  2ZEX A;  1A8D A;  4LBJ A;  5FYU A;  3ZN6 A;  3VB9 A;  2Y8K A;  4G3Y C;  1WGP A;  2VE1 A;  1RUF 2;  4GJZ A;  5GLZ A;  1GZC A;  3SC7 X;  2D3P A;  2AR6 A;  2WNO A;  4NRQ A;  4Z8B A;  1HQW A;  2CL2 A;  2XJS A;  3AKS A;  3T2P A;  1DFQ A;  5JSR A;  2F4L A;  3ENR A;  3Q8F A;  3RZM A;  4MUV A;  5C8W A;  4OUE A;  1HRV 2;  1KXG A;  1WCD J;  3HWJ A;  2WZE A;  1ZZ7 A;  3MF6 A;  4IEU A;  5A7N A;  2QTW B;  2O14 A;  1F35 A;  1GSL A;  2K2S A;  2Q8C A;  1LOA A;  1ND3 C;  1X9T A;  3RZG A;  1O3S A;  1WW6 A;  5FUN A;  2YFZ A;  3IDA A;  5CG8 A;  2JEC A;  2VXR A;  1YC6 1;  2ZHN A;  2LTN A;  5IVJ A;  1AR9 2;  1NUK A;  1Y7B A;  4QQO A;  5FZO A;  1MS8 A;  5DZG A;  4V1P A;  4XFC A;  5DDJ 1;  3BOD A;  5IW0 A;  1OF3 A;  1S0J A;  4UF0 A;  5EFU A;  5G05 L;  1VMH A;  4LBM A;  4EWE A;  4ZON A;  3K4Z A;  1RUG 2;  3AJY A;  1GP6 A;  2JE8 A;  4OMC A;  2Q8E A;  1HQN A;  3QH6 A;  1QH7 A;  3ST7 A;  2DFB A;  1RUG 1;  4LK6 A;  1GU3 A;  4IV1 B;  4B7K A;  1DQ4 A;  2RDQ A;  1OPO A;  2RM2 1;  2Y64 A;  3DPR B;  2BTV C;  5DAW A;  5FY8 A;  5C3R A;  4NRO A;  1GWK A;  1N1V A;  2QFE A;  3BTA A;  1GNH A;  2IVJ A;  5FR3 A;  4UI9 L;  2AEZ A;  2WO1 A;  5BNO B;  3A7Q A;  2VXJ A;  2ZGU A;  4Q4Y 2;  5H9R A;  5JZG B;  2ZJC A;  4QQL A;  2HWC 3;  4Q0U A;  3VN4 A;  1PIV 3;  5EIY B;  1DGW A;  1LEC A;  2DUQ A;  2WIN B;  4Y22 A;  1KJR A;  2VR4 A;  2ZGO A;  2ZX0 A;  3ZXE A;  3IIA A;  3SQO A;  1RIN A;  3EJK A;  5CFC C;  1DGL A;  4GB3 1;  4XDO A;  2E51 A;  4YGB A;  4DO0 A;  2Y6K A;  2XR4 A;  2YC0 A;  4IE6 A;  1PVC 3;  4W6X A;  3PVB B;  2HKX A;  4QX1 A;  4WM7 B;  2XQR A;  2JDU A;  4AVA A;  3VHP A;  4Q27 A;  4YM3 A;  5ACA 2;  2WNU B;  3VHO A;  1CGP A;  1DF0 A;  4OI0 A;  4AVB A;  1GZW A;  2XML A;  4CP9 A;  4SLI A;  4LT5 A;  1APN A;  4JKK A;  1GZT A;  5GZF A;  1FT9 A;  4LOR A;  4GD4 A;  4RR3 B;  1AYN 1;  1SBF A;  1VBE 1;  4IEP A;  4MGK E;  3GYD A;  4N53 A;  5LZ6 A;  2H0V A;  3DYP A;  4AR2 A;  1UY0 A;  4YLZ A;  3HNM A;  5DN2 A;  5FZ3 A;  4AQ6 A;  1OVP A;  1MR5 A;  2PHD A;  3D82 A;  1OQE A;  2XXZ A;  3SCH A;  2BWA A;  4E2S A;  1W3V A;  4NRM A;  4A44 A;  5L19 A;  2EAL A;  1AR8 3;  1UD1 A;  2PHU A;  3AMN A;  3VKO A;  5C7G A;  2XPJ A;  3VD7 A;  4QX3 A;  3OPT A;  1MZ6 A;  4Q1R A;  1QJY 3;  3FLR A;  2R06 1;  3M4F A;  1W8F A;  2WWS A;  2Z4F A;  3J26 N;  2UWC A;  1CZV A;  3MEP A;  2LW8 A;  2BNM A;  3NVC A;  2VQT A;  3ZX7 A;  1FAT A;  2JKB A;  4XMI A;  1LHO A;  4GWM A;  5LRR A;  4B29 A;  4BME A;  4ISQ A;  1J3Q A;  3RZH A;  2QDN A;  4Q4V 1;  2XVG A;  4LKD A;  1DYO A;  4JCK A;  3Q8C A;  4CEW A;  4QX7 A;  3RI9 A;  1JUH A;  3MDP A;  4LR4 A;  4EN7 B;  3S57 A;  3ZN4 A;  4LE3 A;  2VZ1 A;  1BCX A;  2A3W A;  5FY5 A;  3U07 A;  2C4X A;  2QZ3 A;  4QXB A;  2D6M A;  3I3D A;  4PJY A;  2A5Z A;  3BI3 A;  5T50 A;  3THT A;  2EXH A;  3R4D B;  1IPK A;  2JDK A;  2JDM A;  3PUS A;  3KCY A;  3VBR C;  3DKW A;  2DWR A;  4M0H A;  3ON7 A;  4Q0Q A;  1YFW A;  2XON A;  5ANN A;  5EHD A;  1GQG A;  1UYZ A;  1UW8 A;  3UES A;  3WP3 A;  4ONU A;  5FJK A;  2VNO A;  3E5Q A;  1RUI 1;  4O9E A;  1RUC 3;  4JAA A;  4Y1V A;  1AJK A;  1KDK A;  1YFY A;  1ZZB A;  2TNF A;  2WYS A;  4LIU A;  5EWS A;  5FMD A;  2HWC 2;  3J8F 3;  1HV0 A;  1PIV 2;  4GKX A;  5DAB A;  3W5M A;  3BTY A;  2B7Y A;  2ZAA A;  3ZXL A;  2Z2S B;  2WKK A;  4KQ7 A;  2VMF A;  1A6C A;  3IPV B;  2W08 A;  5H9S A;  5A3M A;  1H0B A;  1N1S A;  1LGB A;  3PHM A;  1PVC 2;  3OBR A;  4FXG B;  4N53 C;  3R0R A;  3I2H A;  2TEP A;  1GBG A;  4JTN A;  1UL9 A;  4XAA A;  4BWO A;  2DVB A;  3VBS C;  1G86 A;  1HJG A;  1WW4 A;  4LPL A;  3IMM A;  5B4X A;  4Q0P A;  1M06 G;  1QH6 A;  3WDY A;  1ULO A;  1WA4 A;  2GME A;  1NCR C;  4IE4 A;  4OHV A;  1GOF A;  3FFQ A;  3LGR A;  1K45 A;  4HPK B;  4LBN A;  2CV6 A;  2Y33 A;  3CKH A;  4JGZ C;  3AKQ A;  1L3J A;  1ZNP A;  4W6Y A;  4NII A;  3S7E A;  1X50 A;  2D6O X;  4DXR A;  2CU5 A;  5FZG A;  5I8Y A;  1G9A A;  5GAL A;  5HPO A;  3WEZ A;  5IK5 A;  2BPA 2;  4Y1U A;  3USU A;  4YNI A;  4M00 A;  1AR8 2;  4IUG A;  4M01 A;  2ZAB A;  2LAL A;  3FWE A;  3H1W A;  3ZSK A;  1EAH 3;  5KHJ A;  1QJY 2;  3MZH A;  2Y60 A;  3O0W A;  2A6X A;  1TME 1;  4YM2 A;  3GXU A;  3POG A;  1AHS A;  4M3C A;  5T3N A;  4LOT A;  4CPB D;  4KWK A;  4FPJ A;  1BQP A;  2HEY F;  1U0A A;  4XEZ A;  4IEX A;  3VZK A;  5A3O A;  3SEP A;  1NLR A;  1I5Z A;  2BNO A;  4OMD A;  1EUT A;  1CR7 A;  3HAG A;  1C3H A;  1Q43 A;  3OYW A;  4EZ4 A;  1QGL A;  2X09 A;  2ZGR A;  3IM0 A;  4AFD A;  3T4H B;  2AEY A;  3AKT A;  3CIH A;  1ZZC A;  2UYA A;  3W21 A;  4AZZ A;  1EYB A;  2RS5 3;  4B8E A;  2W94 A;  1J3P A;  2BDR A;  1D7P M;  2XWB B;  3H1Y A;  3J7H A;  4FT8 A;  1JOP A;  4XQ4 A;  3ZO0 B;  5I0T A;  2ZMK A;  3NAP B;  4H14 A;  3ZFE A;  4CXW A;  2XUE A;  3NRU A;  2YRO A;  3MO4 A;  2VUL A;  5IUQ A;  5SV5 A;  4N7U A;  2GN7 A;  2XWJ B;  2K46 A;  5FYZ A;  1CPN A;  3GM8 A;  3RFR A;  1GOG A;  4XF3 A;  1FOD 3;  3I2D A;  1WLC A;  2CAU A;  5L73 A;  1SLI A;  4MGS A;  3ZFF B;  1W6Q B;  5BNQ A;  3UET A;  1COV 3;  2WQ8 A;  2HWE 3;  1D2S A;  1Q3E A;  1LOB A;  4XZP A;  1SMV A;  3B7M A;  3A21 A;  3J8F 2;  1AL2 3;  4E4Z A;  5C8C B;  1BYH A;  2FDF A;  2OZ6 A;  1SPP B;  2DUP A;  3K3O A;  4LEJ A;  4XXP A;  4CCN A;  1NAE A;  2P2K A;  5FWJ A;  3K77 A;  1BLZ A;  2GH8 A;  5I8S A;  5GZC A;  4GUL A;  4QHB A;  4TLF A;  2G9Z A;  4FO9 A;  2ZCW A;  4OI2 A;  3RG0 A;  2UY9 A;  3FUO A;  1AL0 G;  3OBA A;  4Y1X A;  1WLW A;  3OUJ A;  3WF2 A;  3JU9 A;  2ZOE B;  2AUY A;  4QPY A;  2HWD 1;  2ZHM A;  3M3I A;  1W8N A;  2Z42 A;  1IKQ A;  2Y6G A;  2J1U A;  4EN8 B;  1NX9 A;  1W8W A;  3GBG A;  2XLA A;  1GR3 A;  3RPQ A;  2XLF A;  2ZX3 A;  2PHW A;  4LUM A;  1Q5O A;  3MW4 A;  2E63 A;  3MV1 1;  2NN8 A;  3MUY 1;  3WQ1 A;  2W1U A;  3H50 A;  1WLD A;  1CAU A;  3AVR A;  1PMI A;  4DUX A;  5BNP B;  3I49 A;  1EAH 2;  1VAM A;  1DCS A;  5FWE A;  1XU1 A;  4AQT A;  1N3P A;  5JAX A;  1J59 A;  4PDW C;  5D2A A;  4ES8 A;  4BH9 A;  2JIC A;  3OEB A;  4OI4 A;  2DV9 A;  4WVZ A;  1O4Y A;  4PLN A;  2J7M A;  2VM9 A;  4ZU4 A;  1XNA A;  2DDU A;  5IJR A;  4IET A;  4PQQ A;  3MIC A;  4D6Q A;  1GZ9 A;  2P3Y A;  4IGQ A;  3UKN A;  1KFX L;  4BK5 A;  3QCW A;  2WZ8 A;  1D4M 3;  4GMP 1;  4TLG A;  1VBA 1;  4LO7 A;  5F5Q A;  4CCJ A;  3FC0 A;  1X8M A;  4PHZ A;  1SEF A;  4N9I A;  4TXW A;  5FZ6 A;  4LO6 B;  3ZYH A;  2Y34 A;  4XAE A;  4NIH A;  3N7J A;  3WW2 A;  5A7W B;  4QX2 A;  1TE1 B;  3L9J T;  5DAV A;  3OOX A;  4K7J A;  4V2V A;  3WP4 A;  2O8O A;  3ZSM A;  5L7O C;  4UFI A;  1H8V A;  2NMN A;  2RS5 2;  1VR3 A;  3AFG A;  2NLR A;  4L99 A;  1RL3 A;  4QDR A;  4TSV A;  3ZKY A;  1Y9G A;  4CCE A;  3ES4 A;  1IHM A;  4BLJ A;  2WO2 A;  4YM0 A;  1IS3 A;  5F37 A;  1LCL A;  1ZRD A;  2C9A A;  3SLI A;  4XJ8 A;  1FOD 2;  1QQP 1;  1V6J A;  2Y6H A;  3WNO A;  2PTM A;  2UY8 A;  1UKG A;  1FX5 A;  2XJR A;  1RUE 1;  3WQ0 A;  2WRA A;  5DXD A;  5A70 A;  1COV 2;  1ENX A;  2HWE 2;  5C3Q A;  3J7M A;  2I07 B;  3DPR A;  5GJ6 A;  1AL2 2;  1B35 C;  1QDC A;  4H2A A;  1RUH 1;  2E7T A;  4BM8 A;  4CTE A;  4UXA A;  5BNO A;  1DHK B;  5FZL A;  4LO4 B;  4GH4 B;  5CFD B;  2XH6 A;  1R08 3;  3WT3 A;  1TG7 A;  1TNR A;  4JKL A;  5JZG A;  2VMH A;  5C4W B;  1NA1 C;  3DL3 A;  1SG3 A;  2VZV A;  3QOP A;  2LM3 A;  4RS5 C;  4EWA A;  5AC9 1;  4NHX A;  3H8R A;  4C1W A;  4NJ4 A;  5JR2 A;  3CMG A;  2VW2 A;  3RYK A;  4YWA A;  1ND2 B;  3BB6 A;  2VW1 A;  4GAL A;  2WNE A;  2Y6L A;  4WM7 A;  2WJS A;  4EWD A;  3QD6 A;  1ULE A;  1X9P A;  2D98 A;  1UZW A;  2WNU A;  1MQT A;  4DY3 A;  4Q29 A;  2JG8 A;  5FY9 A;  3VD3 A;  1H8T C;  1MEC 3;  2E31 A;  1WKY A;  2ZGK A;  2CGO A;  3ILF A;  1JYC A;  4UAP A;  3DKQ A;  4N7I A;  2H0B A;  4RR3 A;  2PEL A;  3L2H A;  2VGD A;  5D21 A;  5GLT A;  5GKA C;  1XE0 A;  2DCJ A;  4NPM A;  1OC1 A;  1WD3 A;  1VB2 A;  3CO2 A;  3OBZ A;  5CKQ A;  3WY6 A;  2IUW A;  4LHK A;  4A3X A;  2FCT A;  5IAT A;  1NQD A;  5C9A B;  1ULD A;  3ALQ A;  1JOJ A;  4QXC A;  2DCT A;  3HT1 A;  4XXA A;  5D8A C;  5FPZ A;  4Q0S A;  4CDU B;  1OUR A;  2XQX A;  3A0N A;  5L9V A;  2ZMN A;  4LBL A;  1YEW A;  4PI0 A;  4IND A;  3NNJ A;  5LA2 A;  1OMI A;  3E1F 1;  2R16 A;  2XHN A;  4I01 A;  3MLK A;  4FBF A;  1BMV 1;  4XJA A;  1D4M 2;  1RMU 3;  2WFP A;  3MIF A;  3CJX A;  4FPH A;  2YBP A;  2RJ2 A;  4WBB A;  3ZR6 A;  1V6N A;  2OX0 A;  4URT A;  3T1M A;  4QWN A;  4GXL A;  4XJU A;  3AMQ A;  3LAG A;  1YNA A;  3HT2 A;  5CG9 A;  1KGY A;  2KM2 A;  1IZ3 A;  3ZFG B;  3WQ7 A;  3U37 A;  1Y9Q A;  2VCB A;  4XIL A;  1D0H A;  1OKO A;  3CJI B;  3EQE A;  2K9Z A;  3SMH A;  2X5I A;  3DPR C;  1NCQ B;  1PNF A;  1JHN A;  3C7H A;  3N35 A;  4XBQ A;  3T2Q A;  4XBN A;  3KCX A;  4QU2 A;  3MPB A;  3VZM A;  5A6Q A;  1F9K A;  2BEO A;  4C91 A;  2RJK A;  3OSD A;  4HK9 A;  1NXD 1;  1V6K A;  5F8P A;  4DFS A;  5BNO C;  2RJL A;  3GCW A;  2YFU A;  3KMH A;  5EJZ B;  2VQU A;  1VBC 3;  5BXX A;  3GZT B;  5KHK A;  1D4V B;  1SBD A;  1A78 A;  3C8X A;  4U36 A;  3H8O A;  1R1A 3;  1DIW A;  3PVN A;  2R04 3;  4XE9 A;  1FYU A;  3C7O A;  4XAC A;  5HCB A;  3IDE A;  3H7Y A;  1I1E A;  1R08 2;  2TBV A;  1POV 1;  1YJL A;  3INA A;  1W0O A;  1KD7 A;  4RSU A;  1DQ1 A;  2WNU C;  1C8M 1;  3B9I A;  4CUG A;  1MQT C;  2ZGT A;  2JG8 C;  3ME2 A;  4IES A;  1US3 A;  4OYU A;  1JYX A;  3U4S A;  1ZZ9 A;  4UFH A;  5BNN B;  3VBH C;  1RB8 G;  1SHW B;  1UYY A;  3IPV A;  2HWF 3;  1ZBE 3;  2DCY A;  3K48 A;  1W8Z A;  4DPN A;  4O65 A;  5FZ0 A;  5F9T A;  3M8L A;  1CX4 A;  4DUW A;  5EZW A;  2RDR A;  5BUV A;  4IEO A;  2BVV A;  3WQB A;  3B02 A;  3T0D A;  2Z79 A;  5IK8 A;  5I93 A;  3TN9 3;  1MEC 2;  4Q4W 3;  2EXK A;  3MF9 A;  5A6Z A;  1UCX A;  1H2K A;  3WV6 A;  2VME A;  4HPK A;  4KU8 A;  3V0A B;  4MAD A;  1N1Y A;  4HBN A;  1HB1 A;  4XZU G;  3N7L A;  1KDM A;  1Y3T A;  4NN0 A;  4DMI A;  5IFT A;  4NPL A;  4CDX B;  3M70 A;  4IV3 B;  3B94 A;  5FUP A;  4CCC A;  2XUM A;  3B01 A;  1BEV 1;  5F5C A;  1BZW A;  5EJ1 B;  4RL7 A;  3U11 A;  2Q8O A;  3THP A;  1VJ2 A;  1DGR A;  1XNC A;  4OUL A;  1JZ4 A;  3H0O A;  3MUZ 1;  4WZF A;  4WV8 A;  2X5I C;  3MLL A;  1OKQ A;  1HLC A;  1XSQ A;  2X10 A;  1Z7S 3;  2JDZ A;  5CVR A;  5FYI A;  2WS9 1;  4UW4 A;  3IAQ A;  4Z92 B;  3NV1 A;  4FAG A;  3O1R A;  3QBQ A;  5DUX A;  4QU1 A;  3IBM A;  4W4Z A;  3AYA A;  3VZN A;  5LK7 B;  3ZSE A;  4AI1 A;  1KRI A;  4QX8 A;  4YW1 A;  2OVU A;  3I2G A;  3ROU A;  3OBT A;  4QAW A;  2HWB 3;  3VBU A;  4P9Y A;  3UK9 A;  4LBK A;  1PK6 A;  1DQ5 A;  2J22 A;  2FZ1 A;  3A4U A;  4MSV A;  3J7N A;  3WNL A;  2ARE A;  1AJO A;  3C7G A;  2DU0 A;  1LRH A;  1RVF 3;  3N9Q A;  1NY7 1;  1PHM A;  3NAP A;  4RHV 1;  2BP6 A;  3LA2 A;  3OUH A;  4NHM A;  2W5F A;  1VBC 2;  3EXU A;  5EQU A;  3RMY A;  1OF4 A;  1SCS A;  2VUJ A;  2EF6 A;  4I3P A;  1OBN A;  4UW6 A;  5K0U A;  3RWN A;  1PNG A;  2QVS B;  4FFH A;  3UNP A;  3FJS A;  5FCC A;  5IWF A;  2EIB A;  4UBH A;  1YHF A;  4J6G A;  2XBO 1;  4AHW A;  1R1A 2;  4I09 A;  1OD5 A;  2R04 2;  3JBG 1;  1W0N A;  1ZYB A;  3H3U A;  3ZFF A;  3T4V A;  1W6Q A;  1ASJ 1;  1RXF A;  4B1M A;  1JYN A;  2ZZQ A;  2ZKL A;  4MGQ A;  4ARY A;  2Z69 A;  2ARX A;  3ILR A;  1G9F A;  5C8C A;  3KGZ A;  4CP2 A;  4XTM A;  1SPP A;  2VG9 A;  4QKF A;  5A32 B;  4BQ4 A;  4NRP A;  1LJ7 A;  1OPM A;  3WP6 A;  4CEY B;  2HWF 2;  3MI8 A;  1ZBE 2;  3OGJ A;  2VCM A;  3R4U A;  2HWF 1;  4LBO A;  4IER A;  1QDO A;  3V64 A;  3LA3 A;  3POI A;  2PLV 1;  5F6L B;  2WNV C;  1U5Y A;  3O1M A;  1V70 A;  5C33 A;  2XKO A;  2ZX1 A;  2VQA A;  4IE7 A;  5I0U A;  2JG9 C;  5J98 B;  3VBF B;  4FTE A;  3TN9 2;  4URA A;  4DOU A;  1C28 A;  2W2I A;  2Q5T A;  4Q4W 2;  3JD7 1;  2BOJ A;  1BKZ A;  5GZG A;  3K51 A;  2A70 A;  1O4T A;  2A75 A;  3VBO B;  3VGI A;  2FD8 A;  5DDJ 3;  1LOC A;  2EXJ A;  4ES9 A;  1GV9 A;  4XDQ A;  2CYF A;  3T1L A;  1LHW A;  2R0F A;  4UT5 A;  2QQJ A;  2XJV A;  3IDC B;  2CSG A;  1CIY A;  3ZVX A;  5HXV A;  2GC0 A;  1RUG 3;  2EIE A;  2YUE A;  4MV2 A;  3VDA A;  3VBU C;  4Y4Y A;  1PK6 C;  1Q8Q A;  2RM2 3;  4G4F A;  4AI3 A;  1DG6 A;  3D0J A;  1Z7S 2;  3MPP G;  2WUH A;  1XXN A;  1LOF C;  3IAP A;  1ALY A;  4YGC A;  3BUC A;  1O8P A;  2EIC A;  2X53 S;  1NQJ A;  2ZKN A;  3OG2 A;  4ASM B;  2JKX A;  3SCG A;  3J7L A;  1PMJ X;  1SFP A;  1K5M B;  3TEW A;  4K9S A;  2HWB 2;  2VMI A;  3PUR A;  2GU9 A;  2J42 A;  3ITQ A;  1ZRR A;  2G4I A;  4XQW A;  4NIA A;  5K0U C;  1CQ9 A;  5KXC A;  5A7W A;  5FZM A;  4PCR A;  1O5L A;  3CLP A;  2VTF A;  4TWT A;  4GB3 3;  1RVF 2;  3PU8 A;  2BNN A;  4HON A;  3ZFF C;  3KF3 A;  2W91 A;  2JIG A;  3C7F A;  3ZM8 A;  1IGO A;  3UGG A;  1LOG A;  2ZHL A;  4XCB A;  4ZKT B;  5CEH A;  1G9B A;  4YVW B;  2PMW B;  2VO5 A;  2XJT A;  4RYD A;  1JU3 A;  1VPH A;  3M2M A;  1XC6 A;  1QJF A;  1AYN 3;  1IS4 A;  2I2S A;  1VBE 3;  4OHY A;  4IQP A;  4YVS B;  2OA2 A;  2OII A;  2BV4 A;  3ETP A;  5L9B A;  2E9Q A;  3IDB B;  3FBY A;  1A8M A;  3GHM A;  5C70 A;  5JPN B;  3PL0 A;  4NO4 A;  1OQ1 A;  1J1L A;  3PLQ A;  5JXG A;  4AL9 A;  2AYH A;  4IEV A;  2D6N A;  4GH4 A;  1TZO A;  4QGM A;  1OA4 A;  3UYJ A;  2YY1 A;  2RV9 A;  5FYV A;  2QE3 A;  2O8Q A;  3BIW E;  2R06 3;  4X8N A;  5C5T A;  1PM4 A;  2VZR A;  3PUQ A;  2E6V A;  3M3C A;  3Q9O A;  2HLE A;  4CP0 A;  1AZD A;  4KU7 A;  4XUR A;  1ZRF A;  4ET7 A;  3FLP A;  5JOX A;  4X8P A;  3BYW A;  4Q4V 3;  1CVN A;  2NQY A;  1BK0 A;  2HH9 A;  2XJU A;  1YWK A;  1H6X A;  2LRP A;  5DDJ 2;  4HZF A;  1GIC A;  1S0C A;  4XBL A;  2D5F A;  3M3O A;  4OI1 A;  5LBF A;  3GZU C;  3N36 A;  2DUO A;  1OOP C;  1YCI A;  1NXM A;  3VKM A;  4B4R A;  2VZP A;  1Y4W A;  3I3M A;  5KR7 A;  3CBN A;  5CU1 A;  5EJ3 A;  1F4H A;  1UIJ A;  4XET A;  1QKQ A;  5LBC A;  5C9A A;  2XB6 C;  2RM2 2;  3K46 A;  4A7K A;  3O1T A;  3FN9 A;  1QU0 A;  4AG4 A;  3RYR A;  2ZZJ A;  4RQP B;  2QQI A;  3D4K A;  3POJ A;  5FOB B;  1FMD 2;  1ULP A;  1LGN A;  4PIX A;  2D97 A;  4CDW C;  3UKT A;  1C5I A;  4N90 A;  5AVP A;  3S5Q A;  1FMD 1;  4QX0 A;  1RUI 3;  4W6W A;  2D3S A;  4FPC A;  3O0V A;  3MIE A;  1I3H A;  4LJH A;  4WVM B;  4RGK A;  4CU6 A;  2G1M A;  1Q8S A;  1W04 A;  2IVI B;  3LFI A;  1SLB A;  3AXE A;  1F5F A;  5AVA A;  3I8T A;  5HBA A;  5I8T A;  5LA9 A;  5ERL A;  4PLO A;  1UXX X;  4GB3 2;  1G8W A;  4RA0 A;  4FPE A;  3U78 A;  4X6R B;  4MET A;  2XJQ A;  3ACH A;  1RUD 1;  1GNZ A;  3CJI A;  2R1B A;  2YBK A;  3SNM A;  4FQ4 A;  4JGY B;  3VDD A;  5B4N A;  2PHL A;  3V0B A;  5FYC A;  4CYD A;  4Y26 A;  2DVF A;  4A3Z A;  4EJR A;  5DAQ A;  4MG2 A;  4AF9 A;  3WG4 A;  1OLR A;  1UF2 C;  2IXL A;  2OQ7 A;  5CNA A;  3W58 A;  5BPX A;  3H3Z A;  4RGA A;  1AYN 2;  4AVV A;  4HVO A;  1VBE 2;  4QQP A;  1W99 A;  1CAX B;  1W6M A;  3H3L A;  4JDO A;  3VD4 A;  4XFG A;  5JOW A;  1H30 A;  1JZ5 A;  3ORJ A;  3RSJ A;  4CVU A;  2GC2 A;  1JZ3 A;  5IK7 A;  4W65 A;  1HJF A;  1NLQ A;  5EXO A;  4QXH A;  3ZYI B;  2ENR A;  1R09 3;  1O91 A;  5LW9 A;  2R6Q A;  3ZYF A;  5F7U A;  2N7G A;  3PJY A;  3ZPY A;  4BIS A;  2RR1 1;  2RHP A;  3CL1 A;  4GJY A;  2JIJ A;  2R0H A;  4K21 A;  1R64 A;  2ERF A;  5HV4 A;  5C5U A;  2R06 2;  3OUI A;  1FV2 A;  4XJW A;  1TME 3;  3SIS A;  4ARX A;  2JE7 A;  4DXZ A;  4E8D A;  5JCT A;  4M4R A;  3UT0 A;  1UX7 A;  3WX5 A;  1VBB 1;  5BNN A;  1PGL 1;  2Q1F A;  3LDR A;  4HMZ A;  3URF A;  4NVP A;  4XF1 A;  2JX9 A;  3FUQ A;  4L8Q A;  5FBZ A;  3E6C C;  4Q4V 2;  3MV0 1;  1LEM A;  5ABJ B;  5E88 A;  5E89 A;  3KGL A;  1JOB A;  5GZE A;  4N8M A;  5JSP A;  5JI7 A;  4FPY A;  4COV A;  3KD4 A;  1VP6 A;  3GGL A;  2ARB A;  1MVQ A;  3DF0 A;  3KT1 A;  5I0D A;  2FDK A;  1HRI 1;  1S0B A;  3V0A A;  2NP0 A;  3MFC A;  1DGR N;  3HJR A;  2JE9 A;  2A1X A;  1W8U A;  4IV3 A;  1RC6 A;  2YMZ A;  5FZ1 A;  2NZ9 A;  4KG0 A;  4XHB A;  3U0Z A;  2YU1 A;  4CPB A;  3OCP A;  1MS0 A;  1RIT A;  2LRO A;  1VAL A;  3LEK A;  1RUI 2;  3M3Q A;  4GWI A;  5CA6 A;  2YU2 A;  1XB9 A;  3VDD C;  2XKP A;  2JD4 A;  3M7A A;  4H55 A;  1W90 A;  4ERO A;  2EID A;  2OQ6 A;  2PN5 A;  4TYS A;  4ZXK A;  5HCH A;  5C6C A;  5T5J A;  4AAP A;  2GNT A;  1JBC A;  2ZGQ A;  3K2O A;  3HOB A;  4HOO A;  1HIX A;  4XPV A;  2VH9 A;  4B1L A;  5A1A A;  3CHX A;  1WW5 A;  2MPF A;  3JQW A;  2V5Y A;  3F2Z A;  5BY5 A;  1UU6 A;  2AEN A;  1JS9 A;  2D93 A;  2W68 A;  5I0S A;  2JB8 A;  4DY5 A;  2HWD 3;  1TMF 1;  2GH2 A;  1RUJ 2;  4AI2 A;  4AEJ A;  1W2U A;  1JUI A;  1RUJ 1;  3KT7 A;  1LKN A;  4QB1 A;  2W9X A;  1VB4 A;  5FMC A;  3ATG A;  4M4P A;  5IVC A;  2V5D A;  3B5L B;  1S2K A;  3KHC A;  1KQR A;  1R09 2;  4CU9 A;  5BNN C;  3TEY A;  3KF5 A;  4HN1 A;  1R09 1;  1OHF A;  4CU7 A;  2VUA A;  1PO2 3;  4C0H A;  2B46 X;  5LEK A;  1GWL A;  3N9L A;  4OHX A;  4XUQ A;  3LIH A;  1TME 2;  4L0P A;  4A41 A;  5A32 A;  4CEW C;  5JIA A;  4DQA A;  4EN0 A;  4AW7 A;  4KI5 M;  4NAO A;  2LS6 A;  2F4P A;  4NWW A;  4FQZ A;  5F3E A;  1VAV A;  1UYX A;  5FPA A;  4GMP 3;  1VBA 3;  4UYB A;  4YGE A;  3LFM A;  3WCR A;  5BV6 A;  2MHF A;  1C4R A;  1UXZ A;  2J1S A;  2VZQ A;  1W28 A;  4YZ4 A;  2WWU A;  2AH2 A;  3JXS A;  1YFX A;  4XC9 A;  2VL4 A;  3ZDS A;  5FMO L;  3BPS A;  4DRV A;  2YXS A;  2QQO A;  2HBT A;  3PME A;  4XDP A;  4RD7 A;  1QJZ A;  3RJ2 X;  3ZIX A;  3OGV A;  3MLJ A;  3AXD A;  4MVT A;  1GP5 A;  3V56 A;  2RS3 1;  5H9Q A;  4AFA A;  2JDA A;  2PA7 A;  1KEX A;  1V6I A;  2OS2 A;  3VBO A;  2V4A A;  4AED B;  1KIT A;  1DDL A;  5KC5 A;  5E6H A;  3JB8 A;  3EBR A;  3SHR A;  4OFG A;  4ATF A;  5CZK A;  1CPM A;  2ARA A;  2QQP A;  4BOW A;  1QQP 3;  4IEW A;  4R9A A;  5FQ0 B;  5F3C A;  1LUL A;  3LZZ A;  1CZT A;  1RUO A;  1V9U 1;  2VUD A;  1RUE 3;  1MS1 A;  1PVX A;  1X7N A;  5FXW A;  4FPF A;  1VMF A;  3N9M A;  1PX3 A;  5JSO A;  3TBD A;  3ZSJ A;  4WM8 B;  1DQ6 A;  1K3I A;  2V73 A;  3WDW A;  5HCF A;  4A7Z A;  1RUH 3;  2A3Y A;  4AI0 A;  4BZ4 A;  4OUM A;  4XCA A;  1SAC A;  4I0W B;  1UU4 A;  3MGU A;  2AC1 A;  1T6G C;  1AVB A;  1SLT A;  1YO8 A;  4FTS A;  2YPD A;  4QPG B;  4YZ3 A;  3TRS B;  5T54 A;  3O14 A;  4FOV A;  3HBK A;  4EZH A;  4FP3 A;  4D0Q A;  3NW4 A;  5E8A A;  5T5P A;  4H3W A;  1QMJ A;  2CWM A;  1EV1 1;  2O0O A;  1PO1 1;  5FRA A;  1BVP 1;  3UV9 A;  3GNE A;  2WAB A;  1S1A A;  3NKT A;  3UJO A;  1XNT A;  2PQS A;  1W0P A;  3BVC A;  3KM5 A;  5AC9 3;  2HWD 2;  5JOY A;  2GC3 A;  1JHJ A;  5KHI A;  1AR6 1;  2BRT A;  4M3C F;  1CJP A;  5AFB A;  2B9V A;  2KXL A;  1UPS A;  3IZO A;  4CE8 A;  5DUV A;  5IVV A;  2PFW A;  1JN2 P;  3ZLI A;  4V2W A;  5FPV A;  3LWC A;  1FXZ A;  1DQ0 A;  3MFA A;  1MZF A;  3TNP B;  4AHZ A;  2ZHK A;  5K8S A;  5FP7 A;  4PF1 A;  2Q8D A;  4KBB A;  2C26 A;  2ZGP A;  3GBF A;  4K8R B;  4XMA A;  4LE4 A;  1VAK A;  4O61 A;  3TWI A;  5FO8 B;  4BB3 A;  4CDQ B;  3SH5 A;  1LU2 A;  1OXC A;  1PO2 2;  1V00 A;  4YVS A;  4H7M A;  4B4Q A;  2YGL A;  4BJ0 A;  1PO2 1;  5J36 A;  1NLS A;  3PIG A;  3LIG A;  1H9W A;  4ZY9 A;  4M0N A;  2XDV A;  5FDB A;  1EPW A;  5GZD A;  1SLA A;  1QY4 A;  3Q8E A;  5H9P A;  1X82 A;  2K0G A;  1BBT 1;  4K3U A;  3POF A;  4HLT A;  1VBA 2;  3P5B A;  3PU3 A;  5C3S A;  3AP6 A;  1UU5 A;  1PZ9 A;  1B09 A;  3ZFE C;  3LB9 A;  3NWK A;  1WCK A;  1WMF A;  2CDO A;  1SBE A;  2VOK A;  1QIQ A;  3AP9 A;  4QT6 A;  4DS0 A;  4A6S A;  4JKM A;  3DYM A;  1ND3 B;  2C9K A;  4MGI E;  4AQS A;  4BCU A;  5HI0 A;  1E57 A;  4Q4X 1;  3WCS A;  1GQH A;  2W92 A;  3GBW A;  4ITC A;  1CES A;  3NNM A;  4E4D X;  4CA9 A;  2ATF A;  3R6S A;  1JYT A;  1ENS A;  2HYK A;  2W52 A;  2IXH A;  4QM9 A;  1ONA A;  5IAV A;  4LO8 A;  2WII B;  3CQO A;  4LTA A;  4YG0 A;  1QQP 2;  4Z82 A;  1IS6 A;  5FKC A;  1WWY A;  4XAB A;  1RUE 2;  4HKW A;  1K12 A;  1U5I A;  3WUC A;  5FYT A;  2JB4 A;  4JQR A;  5FXZ A;  1IG3 A;  2FBE A;  2IFR A;  4P9I A;  4IV1 A;  1W6O B;  2W1W A;  1L7L A;  1RUH 2;  3AYE A;  4RQP A;  4Q2F A;  4QQH A;  4DRR A;  1W6N B;  2BW8 A;  3POY A;  3LQC A;  1O8S A;  4YG6 A;  2OPW A;  3S30 A;  4NOT A;  4K20 A;  3WNM A;  3FE5 A;  3OEA A;  4Z1V A;  1POV 3;  1CAV B;  2EAK A;  1NT0 A;  2QQW A;  4WVM A;  3VL8 A;  1C8M 3;  4LOS A;  4QHO A;  3WIN E;  4A7Y A;  1O6U A;  5AC9 2;  2UWA A;  1LU1 A;  3OY8 B;  1BK1 A;  2JD9 A;  1OD3 A;  3GCX A;  1JZ7 A;  2JXA A;  5CFC B;  2FCV A;  4HG6 B;  5FY0 A;  4YVS C;  3M1H A;  4F83 A;  3IB3 A;  3MIB A;  2VCA A;  3FFZ A;  5IFP A;  3GZE A;  5FK7 A;  1V6O A;  4CUC A;  4LO5 B;  2VZ3 A;  5FZH A;  1Q8P A;  1WZX A;  4P00 B;  3L2Y A;  4ZS2 A;  1ULG A;  3RI8 A;  4COZ A;  4E4S A;  1HV1 A;  4P9G A;  4TTG A;  3LOB A;  1CN1 A;  1OA3 A;  1PGW 1;  2Y0I A;  5A33 B;  4IEZ A;  3ECQ A;  1CAX A;  1AR7 3;  2GN3 A;  1UOB A;  1ENR A;  4OZX A;  5C3O A;  2R07 2;  2VTX A;  3RQ0 A;  1L7Q A;  2MEV 1;  1JYI A;  3BCW A;  2R07 1;  5JMC A;  3NQH A;  2Z5W A;  3VDC A;  1HN1 A;  1BEV 3;  3I59 B;  4MOA A;  2V4V A;  4LKE A;  2ZX2 A;  1BMV 2;  5DZF A;  2P6H A;  1NZI A;  5J7M A;  3DV8 A;  4EQV A;  5J1X A;  3O12 A;  5A7O A;  3T3Y A;  3BU0 A;  4CUA A;  1UKR A;  5FYB A;  2CGN A;  3CU7 A;  2WS9 3;  5FP8 A;  2ZEY A;  2YBS A;  5J48 A;  2P4E A;  2D40 A;  5FLJ A;  3NV4 A;  3J4U H;  4JDM A;  4JV4 A;  1H2L A;  1JYV A;  4KGG A;  4A4A A;  5LK5 A;  4R52 A;  5HCA A;  5FJH A;  1J1T A;  3JB4 C;  5JXJ A;  4GAZ A;  4XIK A;  5ABJ A;  4GIQ A;  3ZXF A;  4DIN B;  1DZQ A;  2QKD A;  4IV1 C;  1YI9 A;  4JVA A;  4KGQ A;  4LXL A;  1RTV A;  2OKX A;  2OT7 A;  2VU9 A;  2CGP A;  3N9P A;  4LLO A;  4RHV 3;  4IXL A;  4AVS A;  2BJS A;  1XOY A;  3CF6 E;  4XFA A;  1ZVF A;  4D94 A;  5JZG C;  2YC2 A;  3N9N A;  4Y22 B;  1O59 A;  2VOW A;  4Q0V A;  4ZPI A;  2CTV A;  3VBR B;  4BE3 A;  1NOV A;  1XNB A;  2XBO 3;  1FNZ A;  3EB7 A;  5JOZ A;  3JBG 3;  4OLL A;  3LCP A;  1XE7 A;  3IT8 A;  4YW4 A;  5EP9 A;  1ASJ 3;  3LEI A;  5M0T A;  3O1S A;  1DZR A;  2VVD A;  4LUK A;  2EIG A;  5F5I A;  1C1F A;  2P3K A;  4WM7 C;  1C8M 2;  3K3N A;  4D3W A;  3IMN A;  2ZGN A;  4IDZ A;  5CFD A;  5F1R A;  3VHN A;  1UZ0 A;  2EAA A;  1GZW B;  3EO6 A;  4CP9 B;  2EA7 A;  4Y1Z A;  2Y26 A;  5A6X A;  4PF5 A;  1RED A;  4A42 A;  4JRL A;  4XJZ A;  4HK8 A;  3PTY A;  4RR3 C;  3OB8 A;  3BIE A;  4K40 A;  2PLV 3;  3H7J A;  4N53 B;  5DZE A;  5B2G B;  5FK8 A;  1QNW A;  3I2K A;  3LDK A;  3POS A;  2VOT A;  4PBP A;  4YW5 A;  5FZ7 A;  3T09 A;  3VBS B;  4E4H A;  1KS4 A;  1O5U A;  1UX6 A;  2JWP A;  3D3A A;  2UWB A;  2VC9 A;  3O1P A;  3BN6 A;  3JD7 3;  1F15 A;  1AR7 2;  1NCR B;  4FOQ A;  3K4D A;  3OPZ A;  5C71 A;  1MAC A;  5IK4 A;  4M3C E;  1AR7 1;  1QJX 1;  1UMH A;  2JDP A;  3EYP A;  4HKO A;  2W95 A;  5FFO C;  2ZEZ A;  3KZ4 C;  2O1Q A;  4JGZ B;  5F3I A;  5FZK A;  5KHH A;  4Z2W A;  4P5H A;  1NKG A;  4LA3 A;  5GLV A;  2D44 A;  1BEV 2;  3O0X A;  3A22 A;  1MPX A;  3I97 A;  4FSJ A;  4QHZ A;  2BQP A;  2OZJ A;  2P6C A;  3Q8A A;  3TB0 A;  4AI8 A;  3P1I A;  1AUY A;  1LTE A;  4LK7 A;  4COU A;  1C1L A;  3PUH A;  3ETQ A;  3IWZ A;  4N9H A;  4LHL A;  3AP4 A;  2WS9 2;  4KH9 A;  5L36 A;  2ORZ A;  4UW5 A;  4XFF A;  5F2S A;  2PHF A;  5FZB A;  2A71 A;  3RNS A;  1UY2 A;  4D6S A;  5AFE A;  3R4S A;  5A80 A;  3I2J A;  1W06 A;  4AFM A;  4CCO A;  3A23 A;  5DPN A;  2WN3 A;  4NHL A;  2VVF A;  3PTR B;  4CSW A;  4XFB A;  4NR1 A;  2EVX A;  3KB5 A;  3O1V A;  2P3I A;  1GWM A;  1PMH X;  5EPA A;  3AP5 A;  4KMQ A;  2VZU A;  4BQY A;  4D69 A;  5GLW A;  2RDS A;  3AFK A;  3J9S A;  1PM7 A;  4HFS A;  3RZZ A;  1JZ2 A;  4JZR A;  4HSL A;  3ASI A;  1DU3 D;  4DXT A;  3RVH A;  1NY7 2;  3MW3 A;  4JHT A;  4JTO A;  1W3X A;  4UFL A;  4RHV 2;  4I0A A;  3TYJ A;  4BIF A;  4CCD A;  2ILM A;  2KR2 A;  3OTF A;  4W50 A;  1HW5 A;  2FZ2 A;  5FPX A;  1RGS A;  3JQX A;  4QB2 A;  2WR9 A;  3UJQ A;  5CFD C;  2DF7 A;  5LWB A;  1QJE A;  4P9L A;  3WW4 A;  2XBO 2;  4FAH A;  4XVH A;  3HQU A;  1UMI A;  3JBG 2;  1WUV A;  1V0A A;  1FPN 2;  2LUW A;  2W87 A;  1BXH A;  1ASJ 2;  1NE4 A;  4R9B A;  5F6K A;  4K1Z A;  1FPN 1;  3BU7 A;  2DTY A;  3ZOI A;  1I9R A;  1YQ2 A;  3TEZ A;  4WM8 A;  1SLC A;  1XYO A;  4C90 A;  5A3W A;  4I30 A;  4XF0 A;  1HN0 A;  2B42 B;  1W8T A;  2RS1 2;  3DUI A;  4E9K A;  2WT1 A;  3ZXJ A;  2VZS A;  2OXB A;  2JJ6 A;  2RS1 1;  3IN9 A;  3O1U A;  5FMO S;  3VUO A;  2E7A A;  1J58 A;  2WT2 A;  4YSF A;  4AOC A;  2PLV 2;  2B4K A;  3AKP A;  3E97 A;  5EV7 A;  5KXD A;  4FPL A;  1LHN A;  4IW3 A;  4D6R A;  3HBZ A;  4LBQ B;  4ZZ8 A;  1YXW A;  4HL0 A;  3SCF A;  2WN2 A;  3USU B;  3JD7 2;  1LAJ A;  3DGT A;  1JH5 A;  3QLQ A;  4KL1 A;  3VKF C;  5IAX A;  1VRH 1;  4W8J A;  1CAW B;  5IVF A;  3NL1 A;  4CZS A;  3RZJ A;  3THC A;  4B4P A;  5T52 A;  2DFC A;  3F95 A;  1XPW A;  5A1F A;  2Q1M A;  4MGZ E;  2BVB A;  3CEW A;  2P3J A;  1OH4 A;  1PX4 A;  1STM A;  2BER A;  4QB6 A;  3AB0 A;  1ODM A;  3EMR A;  4HAN A;  4IL7 A;  4CDQ A;  1QOS A;  3I3E A;  4QDQ A;  1QWR A;  2VBP A;  2F6B A;  1YRZ A;  2IZW A;  3NNF A;  5BNP A;  4KG8 A;  3VD9 A;  1MS4 A;  1LHV A;  1DZT A;  2QCS B;  3WDX A;  3ACG A;  4PDW B;  2VUC A;  4RN5 A;  4KWU A;  4F8A A;  1QXP A;  5FPB A;  1NG0 A;  3K75 B;  4FPO B;  1FMD 3;  3NJY A;  3ZYB A;  1WLT A;  1MS3 A;  2ET7 A;  3KQ4 B;  4NWV A;  3QH7 A;  4QPI B;  5KWR A;  3NMB A;  3NAP C;  4NHK A;  1NZC A;  1OUX A;  3HMY A;  5SV8 A;  5DUW A;  4BPZ A;  4XJ9 A;  4YW6 A;  1O7F A;  5FRE A;  2YYO A;  3KLS A;  5CAZ A;  2RVA A;  1ZX5 A;  2WFF 2;  2R49 A;  4YZ5 A;  5L7O B;  3N4M A;  3B00 A;  2WFF 1;  3W59 A;  1ZBA 2;  4C8D A;  1W9T A;  1AF9 A;  1RUD 3;  4MHR A;  1YQC A;  4Q26 A;  4CRQ A;  1ZBA 1;  1URX A;  1DLL A;  2ARC A;  2GND A;  2WZR 1;  4NHY A;  3TEX A;  1LOD A;  1C57 A;  5I91 A;  4S2D A;  1HKD A;  3ZXA C;  1H4H A;  4LLF A;  5C8C C;  2W46 A;  1LNS A;  1WBF A;  1YI7 A;  2GP3 A;  2VY0 A;  4XTP A;  3V65 A;  3TOJ A;  1W6P B;  1QOO A;  4BYY A;  1UOG A;  3WF1 A;  1VBD 2;  1RHI 1;  5CBL A;  1IOA A;  4QGL A;  1FNY A;  4QPW A;  3OD0 A;  1E5S A;  1VBD 1;  1OSG A;  1TQ5 A;  1QF3 A;  5A3T A;  1W6O A;  1LOE A;  2C6S A;  3PVO A;  5FYY A;  1B35 B;  3P3N A;  1W6N A;  4AVT A;  5JPM B;  4PBO A;  5A7Q A;  5J3U A;  5JIU A;  2RR1 3;  4XYX A;  2FDH A;  1IG0 A;  1CAV A;  5HXM A;  4N43 B;  1ZA4 A;  1CJD A;  4UBG A;  4QXK A;  1AYM 1;  1FV3 A;  1SDW A;  4S2F A;  3T08 A;  5JDB A;  5FY1 A;  1NA1 B;  1U5X A;  5C4W A;  1OI6 A;  1VBB 3;  2SBA A;  2SLI A;  4E8C A;  3OY8 A;  4RS5 B;  5FAX A;  2VTX J;  1GKB A;  4Y20 B;  4CDQ C;  5CFC A;  3BAL A;  3WG1 A;  4LHN A;  4FOW A;  4ORF A;  2H6B A;  1ND2 A;  2YC4 A;  1H6Y A;  1V6L A;  4A45 A;  4A6O A;  3WP5 A;  5BNP C;  1XE8 A;  1XJA A;  2XHK A;  1ULC A;  3PVE A;  3ZXK A;  2CHH A;  3AZW A;  1JZ8 A;  5D1I A;  5JXI A;  2FDJ A;  1UO9 A;  5FYM A;  2E7Q A;  4P9J A;  5GM0 A;  1H8T B;  1JYW A;  5A33 A;  1RUF 1;  2RMU 2;  3NJX A;  4Y33 A;  3FBM A;  3UGH A;  1HRI 3;  4KNC A;  3O1O A;  1X36 A;  1LES A;  2RMU 1;  4PT6 A;  1HRV 1;  1QXR A;  3PUA A;  1N3O A;  2IXJ A;  3GDB A;  2YHJ A;  1UZV A;  5D8A B;  2ADD A;  5IT6 A;  1FI2 A;  4FPG A;  5FP3 A;  4AHY A;  3I59 A;  1LR5 A;  1UQX A;  4CDU A;  1GP4 A;  1S2E A;  2A6W A;  2GSY A;  1OVS A;  2YB7 A;  2WBK A;  4MO3 M;  3THD A;  1IPS A;  1JI6 A;  2W3J A;  3AJZ A;  5JLV A;  3C3V A;  4XOG A;  4E2G A;  2UYB A;  1GLH A;  1S4C A;  1AR9 1;  5LA1 A;  3I2I A;  2IFW A;  3R05 A;  3WDU A;  5CIS A;  5FZD A;  3AKR A;  1REE A;  1IPJ A;  4HSJ A;  2H6C A;  3ZFG A;  1LHU A;  1ZZ6 A;  3BTZ A;  3WDV A;  1RUD 2;  2XG3 A;  2Y6J A;  5FYS A;  5FZF A;  2BYV E;  1BJQ A;  1XU2 A;  3I4I A;  1S0I A;  2HEW F;  2J1R A;  1T2X A;  2ES3 A;  3P3P A;  4BIO A;  1JZ6 A;  1NCQ A;  3PNA A;  4AVC A;  5FZ4 A;  1TMF 3;  5FZI A;  1H4G A;  2D7F A;  3Q8B A;  1LEN A;  2QUO A;  4CU8 A;  5HV0 A;  4D7S A;  1RUJ 3;  4GH4 C;  1VRB A;  2W39 A;  4FFF A;  1F5J A;  3I2F A;  1WMX A;  1U12 A;  3LEM A;  5T55 A;  5LCW L;  2ZX4 A;  3OPW A;  3ZMO A;  4Q4Y 1;  3HD8 B;  3ACI A;  4P9X A;  3MIH A;  3VBR A;  5C4W C;  4NIG A;  2GDF A;  2RR1 2;  4QMA A;  4CUB A;  1W2O A;  4LQR A;  3WNP A;  1HB4 A;  3UL2 A;  3P6B A;  5K9Y A;  1ND2 C;  4AFC A;  1M4W A;  1Q56 A;  4D7Y A;  4P5Y A;  4Y5T A;  4E2Q A;  4EV0 A;  4CCM A;  4LA2 A;  4DEV A;  3NKG A;  4HET A;  5T5O A;  5APA A;  2PQQ A;  1J83 A;  4IE5 A;  3HQX A;  4ZS3 A;  1MQT B;  4F3J A;  4GWJ A;  2JG8 B;  1VBB 2;  4WVW A;  5ACA 1;  1PGL 2;  2WL1 A;  3LDB A;  3PJQ A;  5FIX A;  4XFI A;  4LNV A;  1X8E A;  2QNK A;  1W2T A;  3HEI A;  2HEV F;  4P9W A;  3AZV A;  3GJA A;  4UW3 A;  4UWD A;  5LBE A;  3VBH B;  1UN1 A;  3ACF A;  4BXF A;  2VNV A;  1SCR A;  2BBA A;  1W39 A;  4AEK A;  3WDT A;  2PYT A;  2QQN A;  1WD4 A;  3VZL A;  4BK4 A;  5C9A C;  3VBS A;  5A7P A;  1OFN A;  4CDU C;  1YIP A;  1OLM A;  1MS5 A;  2GAL A;  2WQ4 A;  1NCR A;  2RS3 3;  2YPJ A;  1HRI 2;  5KBF A;  1Z0H A;  3W5N A;  4MGT A;  4JGZ A;  2DVD A;  3PIJ A;  4MX3 A;  4QD2 A;  4LKS A;  4Q1P A;  4CDX A;  4XFH A;  3ZFG C;  4ZXE A;  4YW2 A;  3U4X A;  1V9U 3;  4C1X A;  4CCL A;  2JEN A;  4AXO A;  2JDY A;  4LHS A;  3AM2 A;  2QQM A;  1OUS A;  3CJI C;  2XL7 A;  1N1T A;  5J96 B;  1RJ8 A;  2X5I B;  1CIW A;  1NCQ C;  4NID A;  5I0R A;  2B8M A;  4CP1 A;  3AC0 A;  4L2N A;  4PIY A;  4ASK A;  1W2N A;  4BQX A;  3WW3 A;  5IVE A;  3HNB M;  2DTW A;  4QM8 A;  1KFU L;  2OPK A;  4C0B A;  3GZA A;  4TZD A;  3I2O A;  2CY6 A;  3WW1 A;  4AI9 A;  3BTX A;  1EV1 3;  1PO1 3;  1TVG A;  4OCT A;  2GC1 A;  2QQL A;  1H1A A;  5LRS A;  1RIR A;  1WMD A;  2NYY A;  3KHB A;  1F8V A;  4FVV A;  5F5A A;  1AR6 3;  1TMF 2;  2Q0A A;  3SH3 A;  3T30 A;  2WO7 A;  4PI2 A;  1W05 A;  1TEI A;  5CAD A;  5JI9 A;  5DUU A;  1UY3 A;  2V09 A;  3LA7 A;  4O7X A;  1N47 A;  3KCC A;  3N9O A;  3NST A;  5FZC A;  3RMX A;  3WF0 A;  3ZKU A;  2A3X A;  1IQD C;  4HN0 A;  4HXC A;  4S2H A;  4G9S B;  1Y9M A;  2HWC 1;  1PIV 1;  2WQZ C;  1DQ2 A;  2ORX A;  4OHW A;  2B45 X;  1E5H A;  1QJU 3;  2ZGM A;  4J25 A;  3RRD A;  4JQT A;  1GAN A;  4KBZ A;  4EN6 B;  1H9P A;  2QQU A;  5KHG A;  4QKN A;  1GYK A;  1WME A;  1DLC A;  3AL5 A;  1YUD A;  4QGN A;  3LE0 A;  5FZE A;  5DMY A;  1PVC 1;  1VLN A;  1WCU A;  3SKV A;  2F17 A;  2C0Z A;  1AXY A;  1UIK A;  2DCK A;  2E32 A;  3T0A A;  2QDR A;  1BBT 3;  3III A;  3SIT A;  4CEY A;  2I45 A;  4AEM A;  1LED A;  1OH3 A;  3POB A;  2GNB A;  2BFU L;  3WR0 A;  1CD3 G;  1ODN A;  1XYN A;  1BHG A;  3B3Q E;  4NAM A;  2WNV B;  1OA2 A;  5JR7 B;  1GMM A;  1OLQ A;  2OUH A;  4IE0 A;  4LBQ A;  4XW3 A;  4EE2 A;  2G9F A;  5J37 A;  4GZ9 A;  4R9D A;  3GJB A;  2JG9 B;  4IV3 C;  4CDX C;  2XVL A;  2ZML A;  3HVD A;  3MBW A;  3VBF A;  4Q4X 3;  3E6B A;  5J09 A;  5FXV A;  3WNK A;  2VZT A;  3RS6 A;  1SFY A;  1QOT A;  2RS3 2;  3I54 A;  1UMZ A;  1AR8 1;  5FKB A;  3SXW A;  1G7Y A;  5FBJ A;  3WZ1 A;  1DP0 A;  1CAW A;  1W9S A;  2A7A A;  4PIZ A;  2XLG A;  1EY2 A;  5FP9 A;  3U1X A;  3SKJ E;  4JX0 A;  1QJY 1;  5FZ9 A;  2DUR A;  3BKZ A;  4I0B A;  2E26 A;  2VBB A;  1V9U 2;  3SH4 A;  3ZXG A;  4NE9 A;  1REF A;  1QHD A;  1RYY A;  4RFT 0;  4P02 B;  2VZO A;  4DZG A;  3I3B A;  4ZHN A;  1ULF A;  1H2N A;  2UUR A;  2X05 A;  2WLP A;  3VBU B;  3FX3 A;  4DB5 A;  3BGA A;  3LOI A;  4PDW A;  1PK6 B;  3HQR A;  2KD7 A;  3AZX A;  5EYY A;  4H7L A;  4AK3 A;  1AXZ A;  3E5X A;  4K8F A;  3VLB B;  3RDI A;  3AP7 A;  2XJP A;  3GF6 A;  2UU8 A;  4GKY A;  3S5A A;  3ZMN A;  4IGO A;  4QPI A;  2RDN A;  4MLO A;  3OGS A;  3TNQ A;  5EYX A;  4AQ2 A;  1HQL A;  1TNF A;  1EV1 2;  1W9Y A;  1PO1 2;  4UFK A;  1K5M A;  2B5H A;  2D6K A;  2FMY A;  3VZJ A;  5K0U B;  2W47 A;  1ST8 A;  3MIG A;  4YGD A;  2C5D A;  4R8H A;  1O3T A;  1V6M A;  5KXE A;  2P17 A;  2A6Y A;  2VNR A;  5L7O A;  3WLU A;  1AR6 2;  3USS A;  3DYO A;  3POW A;  1F31 A;  4HVR A;  4YM1 A;  4HKL A;  3RWK X;  4HVQ A;  1G6N A;  2BGO A;  1D2Q A;  4TN7 A;  5DG2 A;  2VD7 A;  5A3L A;  5IVB A;  1RUC 2;  3JUU A;  2B9U A;  4MXW B;  1RUC 1;  5JVV A;  1JU4 A;  1GFF 2;  3KV9 A;  4QX5 A;  1HB2 A;  4IEQ A;  2ZAC A;  3J8F 1;  4YVW A;  4MYE A;  2D43 A;  4LBQ D;  1QJU 2;  1W6P A;  4B7E A;  2GMM A;  3ZYJ B;  4CEY C;  3HNY M;  4I3G A;  4AGV A;  3AVS A;  4BQ1 A;  1QJU 1;  5C3P A;  1H1M A;  1ENQ A;  1ZZ8 A;  2BU9 A;  4DEQ A;  2TUN A;  3B93 A;  3EHK A;  3HR9 A;  3ABZ A;  3WF3 A;  3U75 A;  2BWC A;  1CWP A;  2MEV 3;  4XUP A;  4JDN A;  1B35 A;  1S0E A;  2WSV A;  2R07 3;  3AMP A;  4FXK B;  2R30 A;  4ZU7 A;  3K4A A;  1UOJ A;  3VBF C;  3ACL A;  3ZYR A;  2YGM A;  1BBT 2;  4OHZ A;  3WVJ A;  4DIQ A;  3D6E A;  1YJK A;  4N43 A;  3B9C A;  4BDV B;  3RJR A;  1DBN A;  3AMM A;  1PZ7 A;  4RFR B;  3VBO C;  1NA1 A;  3H8X A;  4ISR A;  2YV8 A;  2W0X A;  2Y6F A;  3H1M A;  2B39 A;  3OJB A;  4RS5 A;  4Y20 A;  1MZ5 A;  3LF7 A;  2P34 A;  3NJV A;  4BQ5 A;  4FFG A;  4K1Y A;  1F2N A;  4Q4X 2;  4QDS A;  2G19 A;  2VAU A;  2WAO A;  1UPI A;  3QAC A;  1EUU A;  3ZXD A;  4FTB A;  1SZB A;  1XNK A;  5T5L A;  1XYP A;  3DXU A;  4MZU A;  1UWW A;  2NPI A;  2QBX A;  2OUJ A;  3JCI A;  1EAH 1;  2VVE A;  2ZEW A;  1H8T A;  1KJL A;  4LIT A;  3AYD A;  2ZAH A;  5FTT C;  2BBV A;  2VJX A;  2A6Z A;  4L92 A;  4IEY A;  1OOP B;  5LBB A;  1AX0 A;  5FXX A;  3WOG A;  3FHA A;  2NMO A;  1S2B A;  4QPI C;  4FFI A;  1YYN A;  1K5M C;  3APB A;  1A3K A;  4BQ2 A;  3N3H A;  5D8A A;  5LY2 A;  1NE6 A;  1C5H A;  4R9C A;  1HB3 A;  3LPG A;  3KQR A;  4Y3O A;  2X29 A;  2OYZ A;  2ZA9 A;  4R4X A;  3BPZ A;  4CDW B;  1UZZ A;  5DQ0 A;  3MHZ A;  2RS5 1;  1E5I A;  2R32 A;  3GHN A;  4BA6 A;  2Q30 A;  5KC6 A;  4CXX A;  3ZYG A;  3NO8 A;  1RUN A;  5LY1 A;  2WO3 A;  3CNA A;  4FPK A;  1P8J A;  3VD5 A;  3N7M A;  1Y43 B;  5A3N A;  2WWJ A;  4YVW C;  4P14 A;  1GOH A;  3T0B A;  1IS5 A;  2X8K A;  4Z2A A;  1W03 A;  1A34 A;  3C2U A;  3T2T A;  1FOD 1;  1RXG A;  5LA0 A;  2WSU A;  1RJ7 A;  5TSW A;  4AHX A;  5IYY A;  1YQ8 A;  2PHT A;  1T6B X;  3MW2 A;  4NUB A;  4GQ7 A;  3KV5 A;  1OT5 A;  4U2A A;  2FMD A;  3NV3 A;  1COV 1;  2IXC A;  2HWE 1;  4JGY A;  2QQK A;  2L9L A;  3ZN6 B;  1AL2 1;  2PHX A;  3POE A;  1IQA A;  1PGW 2;  3WNX A;  3RZL A;  1US2 A;  2WLQ A;  4BQ3 A;  5LAS A;  4N43 C;  2NM1 A;  4MHU A;  1QJX 3;  3GAL A;  4I2O A;  3ELN A;  5FMB A;  4JC1 A;  2MEV 2;  2VCC A;  3ZPO A;  3MYX A;  2VEC A;  3T2O A;  2DBI A;  2YZ4 A;  3VV1 A;  1O3Q A;  2MNG A;  3HN3 A;  5LB6 A;  3HIF A;  5JXH A;  4ZZ5 A;  2C24 A;  3RYP A;  5F32 A;  5FLI A;  2ZGL A;  3E6D A;  1VE0 A;  1OLM E;  1ACC A;  3WUD A;  1PGS A;  3HPN A;  5FZO B;  1BVV A;  5FZA A;  1MZE A;  3NNL A;  2CWS A;  2G9G A;  5A3U A;  3VBH A;  2OW4 A;  3U10 A;  1GUI A;  3VKN A;  2FCU A;  4OQ8 A;  1OFS A;  3FMG A;  4UF0 B;  3NNG A;  2WYF A;  2J1A A;  3CZJ A;  2A6V A;  5GLU A;  1H2M A;  3LEG A;  1AX2 A;  2E33 A;  4AWD A;  2AGS A;  1UZY A;  3KV6 A;  4HT1 T;  2VBD A;  1G9C A;  4RQP C;  2ID4 A;  4YRD A;  1W8O A;  3PDQ A;  1W2A X;  3DN7 A;  1S0G A;  2DCZ A;  4XUT A;  5DAP A;  4YAR A;  4GA9 A;  5A6Y A;  5JUV A;  4MH0 E;  4FI9 A;  3LSD A;  1D4M 1;  2PAK A;  4XF9 A;  1GQP A;  1S0F A;  1XSR A;  2IWG B;  2W1Q A;  3ES1 A;  3ZN5 A;  5JWP A;  1HDK A;  3ILN A;  2HYX A;  5FUI A;  4J1W A;  2ZXQ A;  4L11 A;  1U5Z A;  1FPN 3;  1GNY A;  2JEM A;  1W8H A;  4YPJ A;  2IXK A;  3HN1 A;  5CB7 A;  4OUS A;  3DCQ A;  3VDD B;  4YZ1 A;  1WCQ A;  3G6J B;  2HBU A;  2WA3 A;  4JGY C;  4OZO A;  3V0B B;  2FDG A;  5CIR A;  4Y5Z 0;  5FOJ B;  3DXT A;  2VMG A;  4YFZ A;  2QJV A;  2J1V A;  2VOX A;  2WA4 A;  1WCS A;  5IHR A;  3DEC A;  2RS1 3;  5CKM A; 
#chains in the Genus database with same CATH homology
 5EHD A;  1NLQ A;  4CA9 A;  1XE0 A;  2VTX J;  2P1B A;  4N8M A;  3T30 A;  1XB9 A;  2VTX A;  1K5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...