5EHDA

Crystal structure of human nucleophosmin-core in complex with cytochrome c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
PQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human nucleophosmin-core in complex with cytochrome c
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Nucleophosmin
total genus 14
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H, I, J, a, b, c, d, e, f, g, h, i, j
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 5ehdA00
4N8MA 3T30A 1XB9A 5EHDA 1NLQA 4CA9A 2P1BA 2VTXJ 1K5JA 2VTXA 1XE0A
chains in the Genus database with same CATH superfamily
1NCRA 1OLQA 2WC2A 4HMZA 2WJSA 1RMU1 3PUHA 4JGZC 3WUDA 5FPBA 3FUQA 5A1FA 2N7GA 1DLLA 5A3MA 4R9DA 5JIAA 3NJYA 5JXGA 4A3ZA 3C7HA 1RJ7A 2J22A 1EPWA 1MQTA 4AI8A 1W2AX 5JUVA 5JWPA 3FHIB 3BKZA 5GLTA 1HN1A 1H9PA 1WCSA 1IG0A 1VIWB 3I2OA 4B7KA 1PO12 2ZGLA 3ZYFA 2XVGA 4AFCA 2AZ5A 3OPZA 3LA3A 5DDJ3 2C0ZA 2IXIA 2HWD2 1S0GA 1GQGA 2DVBA 2WNOA 4W50A 5L9RA 1H2LA 1W6PB 4JHZA 1EV11 1NXD1 1NOVA 4DUVA 1VBC3 2XPJA 1S4CA 4BMEA 4JTNA 2VZOA 5J36A 5LY1A 4OYUA 4YARA 1J84A 2WA4A 4IV3B 4B8EA 1UKRA 1GZ9A 1YC61 2ZEWA 3ZYRA 1O3TA 1NCQB 3MO4A 3TOJA 1KEXA 5FJKA 1LOCA 1NE6A 5A70A 2DVDA 2DUQA 2NPIA 1NCRB 2ZS6B 5HV4A 1XOYA 1PM7A 2DTWA 2ZGUA 4LJHA 4XQ4A 5F39A 5JOWA 5JZGB 1HJFA 1IOAA 2BW8A 1OUSA 1K5MA 1N47A 3AP9A 4LA3A 4LOTA 1AR63 2VZ3A 3S57A 3EBRA 2X29A 1BCXA 1EP0A 4XDOA 5A7QA 3U0ZA 3RFRA 4OHYA 5ANNA 1GNHA 1RMU2 4Q29A 2PQSA 5DQ0A 2D6OX 2VNOA 1POV3 4IEOA 2VUCA 3D0JA 1NT0A 5AVPA 5FQ0A 1YQ6A 1SLCA 4JAAA 1BMV1 3IDEA 3HIFA 1H0BA 3FHQA 3PHMA 2WFPA 2R062 2VZUA 4Z92B 2UYBA 3L2HA 4DUWA 5DG1A 3WG2A 4KL1A 4LXLA 1GOHA 4IV3A 1EAH3 1QJZA 1YFYA 2RS32 3FMGA 2QKDA 1OSGA 1RVF2 5H9PA 1G6NA 2VNRA 2DV9A 1WD4A 5D1IA 2MHFA 3CJIC 5AC92 1U12A 1C1FA 3WNPA 5D21A 3ZR6A 4QX1A 1LHUA 2VTXJ 4BIOA 2WFF1 3I3DA 3ST7A 5EP9A 3BOWA 4MOAA 2EAKA 3CF6E 1E57A 3GHNA 2PLV2 2VMHA 5JPNB 2ZGKA 1QNYA 2OS2A 3AL5A 1GUIA 1O5LA 2XJSA 3IDAA 4A4AA 4CEWC 5JXIA 3SH3A 3WW3A 1SFYA 1FNYA 1YQ5A 2BGCA 4Q4W2 3MIEA 2UURA 1NA1C 2VUAA 4QGMA 5ACA2 2P5BA 1RUC3 2XKPA 1R081 1R091 3WP3A 1W8TA 2ZX2A 3I8TA 4FQZA 5BNPA 1ENXA 3ZPOA 2VOVA 3WW4A 4WBBA 1LR5A 1AYN1 2DCYA 1W0NA 1RIRA 2OW4A 3WDWA 1AX0A 4P5YA 3SH4A 1UL9A 3T30A 2HWF3 2TEPA 2WN2A 4NRQA 4YM2A 5FY4A 5CB7A 4PDWA 3H8XA 1WKYA 1FOD3 3PTRB 5BXXA 3H50A 4GALA 3PMSA 1E5HA 1RGSA 2Q1ZB 1OA2A 3CHXA 5SV5A 4YM1A 5FWEA 4PHZA 2ADEA 1W8HA 3ZFEC 2R49A 4YGCA 1OF4A 2KA3A 4L97A 5JSPA 4X6RB 2QQVA 1QJU3 3IWZA 4K1YA 4CDWB 4XMIA 2W47A 1OURA 3M4FA 1ND3B 4Q8LA 1G9DA 2ID4A 4M3CF 1OLME 4FPKA 4BIFA 2ETEA 1GANA 4EN6B 4XTMA 3KF5A 4B1LA 4PCRA 4CCCA 4LBOA 5IAVA 3GHMA 5LK5A 3SC7X 3WP4A 1RUH2 2VNGA 4BPZA 4DXSA 2HWD3 1G8WA 1IZ3A 2QCSB 3FJSA 1JODA 3J7LA 5BPXA 1M06G 1RL3A 2NM1A 1HV1A 3JD71 4WM7B 1DGRN 4IETA 4OHXA 3N9MA 1QXPA 1CAXA 1YJLA 3ACLA 3HBZA 5FDBA 4MZUA 1QQP2 4NPRA 3T09A 3IMNA 1LTEA 2C6SA 5CEHA 3NV3A 3ZIXA 5FV3A 3WNOA 1TME2 1ND2B 2ZOEB 4DXTA 1BKZA 4YNIA 1IGOA 1UU6A 2XH6A 3I97A 1D0HA 1HQWA 1WLTA 1RHI2 4QHOA 4FP3A 3RS6A 1EYBA 2CGOA 2E7QA 3PURA 1BBT3 4QXKA 3IZOA 2OKXA 3UJQA 3RZJA 5IJRA 4Y26A 3USSA 3VBHB 4RQPB 1G9CA 4O61A 1RMU3 2PHWA 4Y1YA 3RSJA 3EMRA 5IK7A 5DPNA 1G86A 1ND2C 1ZBA1 3MF9A 3I3QA 5FK7A 1SBEA 3AMNA 4WVZA 5LWBA 2FBEA 4GD4A 2XVLA 1GP6A 3ZYHA 4BQ4A 4K7JA 4GB32 2ORZA 3ZVXA 3IT8A 4XTPA 1KITA 1LGNA 4BXFA 5J09A 1N3PA 1OC1A 4Q26A 4WM7A 3U37A 3G6JB 4AAPA 4IEUA 3VN4A 1JU4A 5K8SA 5F32A 2FHRA 4ES9A 4MV2A 3TBDA 4C0BA 5CA6A 2AGSA 3TB0A 1COV1 1AL22 1JOBA 3H3ZA 4XUNA 3WT3A 2Z4FA 4BLIA 3O1VA 2ZGTA 3FUOA 4CDXA 1TG7A 1RUI1 4FAGA 5IVJA 4LIVA 1U5ZA 2GNTA 4N53C 4M3CB 4DPNA 1HXS1 1V6JA 2ZKLA 4OCTA 5IHRA 3AL6A 4KWJA 1WLDA 4LUMA 3HQRA 4DZGA 5KR7A 4CU8A 3N7JA 1RB8G 2J7MA 1UD1A 4H3WA 1YFUA 1MPXA 3WQ7A 2OQ7A 3A22A 4NJ4A 1RYYA 4S2FA 2KD7A 4KU7A 1J1TA 1SQ4A 1DYKA 1DQ1A 3AFKA 5FYZA 1V9U1 1YQCA 1YO8A 3TRSB 1BXHA 2Q8OA 4HKWA 4QM9A 3Q8AA 2BERA 4P9IA 3POIA 2D93A 1VBE2 1LU2A 5E88A 5K0UA 3WDXA 4YZ1A 2GC1A 4Q4V2 3VD7A 4PBOA 2SBAA 3H3LA 2ZXQA 3KZ4C 1CONA 3VBSC 3HNBM 3LDRA 2I74A 2P1BA 1QWRA 2FCTA 1F35A 2PQQA 4CDXB 3K2OA 1K5MB 2WSUA 3NJXA 1GYKA 3RZKA 1PZ8A 4TLFA 1UN1A 2WN3A 5C9AB 4M3CE 1Y3TA 1QEXA 4XXPA 1DYOA 2BZDA 1W0PA 2XJVA 1QJX2 4XDQA 5CAZA 2EXHA 2CGNA 3H42B 3KQ4B 1MS3A 1C28A 3CZJA 4OHZA 2OYZA 3FC0A 3LSEA 2PA7A 3O0WA 1AX1A 3KM5A 5FXWA 1QDOA 3TNQA 1MQTC 5H9RA 3VBFB 4UW5A 2XJPA 2VQ0A 4JGYA 3LFMA 3M3EA 3CJIB 4KGQA 4AWDA 3KLSA 2X5IC 2OUJA 5T54A 4CP9A 2Y6KA 1SG3A 5L7OB 1MS5A 4QHBA 2JDPA 1AR92 5DDJ2 2Y6JA 1KS5A 4IV1B 2HYKA 1QJY2 1GZTA 3TNPB 3K4AA 4RA0A 5L73A 3RZLA 3ZXDA 1VBC2 4WZCA 4AHWA 1R093 2BVBA 2EXKA 1ENQA 1W05A 2RG4A 2HEWF 5KC5A 1LHWA 1PO23 4CDQA 1ZZ7A 2CV6A 5A3TA 1MR5A 1VAMA 2YZ4A 3O0XA 3MW2A 4CCEA 4AEMA 4BWOA 2HWF2 1W3VA 2RVAA 3KV4A 2WS91 4XFAA 3NNJA 1QU0A 1BBT2 1N3QA 1ULFA 3ZXAC 3KVAA 3HOBA 4MGZE 3ZSEA 1PVC3 4QB1A 4Y20A 5FZBA 5BNPB 2C4XA 2RM23 5JZGC 2W68A 2VW0A 4DB5A 3NVCA 3RZZA 1A78A 2R1DA 1WCKA 3V0BB 3LDBA 4YGDA 2C26A 1WLWA 1JN2P 2VW2A 3PUIA 3SNMA 1HRV3 3ELNA 1SEFA 5LA0A 1YIPA 4HBNA 4I0WB 2FDFA 2WZPP 5DN2A 2R072 4LK6A 4LORA 1J3QA 1BLZA 3ZXLA 1POV0 4PQQA 4B29A 5IVFA 3WXPA 2IWGB 4Z8BA 3WF2A 2QJVA 4BCUA 1XSRA 5DG2A 2V4VA 1RUH3 1S0FA 2J1AA 4E9KA 4COWA 3O1MA 2VGDA 3NQHA 3IAQA 3FWEA 2BPA2 2Z69A 3I3BA 3NNMA 2D3PA 2RR11 1LOFA 4UT5A 4FO9A 4XAAA 2BV4A 3E5UA 3N9QA 4HVOA 4Y5Z0 3T08A 3OYWA 4QX7A 1MZFA 2JG8B 4F3JA 2DTYA 4C8DA 5HPOA 5A6QA 2ET1A 5FJHA 3PL0A 1K12A 1ST8A 4NHLA 4QX0A 2W39A 5A7SA 4QPGC 4JGZB 5KC6A 4WV8A 3ZMNA 4Q4V1 2GMPA 3D0SA 1UU4A 3MF6A 5ACA3 4Q4X3 3TEXA 4CU6A 1UYYA 3ZFGB 3WEZA 3ZFFC 1VBE3 1CAWA 2B8MA 1Q3EA 5C3QA 3JQWA 4D69A 2WL1A 2QQJA 1LHOA 4N7UA 2IXLA 1DYPA 3IBMA 1D4M1 1LOFC 2WNUC 1NX9A 4MXVA 3VBRB 4BK5A 4I3PA 4DEQA 3NRUA 1S0JA 4QGLA 4PLNA 1I3HA 1OFSA 4LE4A 4D3WA 2DVGA 5FZFA 3LPGA 4BISA 3WG1A 1O8SA 3ZXKA 1W9YA 1RINA 3KMHA 4RYDA 1DGWX 3CQOA 4CXXA 4XBNA 2X09A 1YXWA 4WM7C 4K21A 1DQ4A 5DAXA 4K40A 1EAH1 3I2KA 2VOTA 4M0NA 4XZUG 5A7NA 1AL21 5C8CC 1AUYA 5LCWL 3J26N 4RR3C 4MGYE 5KHIA 2XJRA 3VUOA 5F5IA 4GXLA 1FPN1 5FR3A 1VMJA 3MLKA 4GAZA 2BEOA 4QWNA 4X6QB 2A3XA 2RJ2A 2VM9A 4ZHNA 4QKDA 1XYNA 2RE9A 4XJZA 1AX2A 1SPPA 2EICA 4OULA 3WR0A 4K9SA 1ODNA 5E8AA 3AJZA 4XC9A 2WWSA 1UYXA 3POSA 4LKFA 3I49A 4MGKE 3ZFEB 1VBB2 5FYYA 3NKGA 4JRAA 3Q8CA 5HV0A 5FYSA 1D2QA 4YM3A 5LZ6A 2ZA9A 2OZJA 3UGFA 1H4HA 1DDLA 1UW8A 1BVP1 3RQ0A 3VD4A 1WMFA 3THTA 4NAMA 1DCSA 3VD9A 3M70A 4YVWC 2W94A 4GH4B 5F2SA 4CXYA 4BZ4A 1UNBA 4DOUA 4XPVA 1YEWA 5GKAC 3C7FA 2WZR1 4CCKA 3ME2A 1VRH2 1ZZ8A 3AP4A 5IT6A 2VZPA 2YGMA 5A7OA 5JOXA 5FZ0A 1IQDC 5FO9B 1PMHX 2XGXA 1KXGA 5C4WA 2E33A 3MEPA 4L8QA 4N8MA 4A7ZA 4CDQC 3IPVA 4UFIA 4CEWB 1HB3A 2ENRA 1L7LA 1ASJ3 1A6CA 2BGPA 4NAOA 5KXEA 3POJA 2DVFA 3ACIA 5F2WA 1E5RA 3WNNA 5FZKA 1X36A 3DEMA 1UOFA 1UYPA 2HBUA 3CMGA 4FP2A 1Q8VA 1PGL1 4DNYA 2GAUA 2NQYA 3V0BA 2V5YA 2A70A 5ISLA 5BV6A 1CN1A 4FQ4A 2QE3A 2RMU1 3ZN4A 2BBVA 3SKJE 4COZA 1YJKA 2W1WA 3VB9A 2QQIA 5J37A 1H1AA 1F5FA 3FLTA 3ILRA 1XNBA 5JIUA 3W9AA 2O1QA 4I09A 5GM0A 5K0UB 3AZYA 1Z78A 4B4PA 4YZ5A 3P6BA 5LB6A 4GJZA 2W3JA 3QH6A 3VBFA 1MEC1 4AAXA 2ZEXA 3Q8EA 1W6QB 2E6VA 4FXKB 4HZFA 2VTFA 4NHYA 3OYWB 1O5UA 1D2SA 4HG6B 3S7EA 1G9FA 2JEMA 1CAXB 4H14A 3N35A 4JTOA 5HCBA 3OGRA 2NMNA 2X8KA 3VV1A 1YIFA 4URAA 1OQ1A 1SCSA 2XDVA 5F1RA 2PMWB 1CAVA 3W20A 5FYHA 3VD5A 1LOEA 2ZACA 3ACFA 3DYPA 4NHKA 4QM8A 4BXSV 3GCWA 4E2SA 2R30A 5K7PA 1ZRCA 1C8M2 1YUDA 1O4TA 2DVAA 1HRV1 2PHUA 4PLMA 4Q8KA 2RMU2 4ZXKA 2WA3A 4NWVA 4YZ2A 3WDTA 5CFCA 1OLRA 4IDZA 3VGIA 1EPZA 5IK8A 1REEA 2YXSA 3LFIA 3OB8A 3R4DB 1CAUA 1PK6B 2AACA 2C5DA 4AOCA 5EPAA 3O1OA 3HT1A 4WM8B 5CADA 1KDMA 3UKNA 2WZEA 3DGTA 1RUJ1 3PLQA 4AEDB 3ZR5A 5FYCA 4AVVA 4HONA 1VBA3 4ZZ5A 1BYHA 4E2GA 4FPHA 1VRH1 4HVRA 2VUJA 1ZZ9A 3ITQA 3AP5A 1PO21 2W0XA 2WZR2 3MIHA 3HEIA 5FZMA 5BYNA 4P5HA 4NPMA 2ES3A 4DEVA 1BMV2 3THPA 4QPIB 5JMOA 4P02B 1AZDA 4PQ9A 4ZXEA 1O91A 4LKSA 5D8AC 3JQXA 2HWB3 2WSVA 3P1IA 4B4RA 4F7ZA 1O3RA 2NLRA 4TZDA 4P9LA 1UYZA 2ZGNA 1Y9GA 1W9TA 3AYEA 3J4UH 2AREA 1Y9MA 4LE3A 2AENA 3N4MA 4HN0A 3OGJA 4LBLA 3OSDA 1JUHA 4PI0A 2A75A 1XPWA 3FBYA 2G9GA 4INDA 4MADA 5LY2A 1WMEA 3C7EA 3FX3A 2O8QA 3BU7A 1D7PM 2C9AA 1GV9A 2LM3A 2X10A 4ZU7A 4OVEA 1RUJ2 1AYM2 3D4KA 5E89A 3VDDA 3ZFGA 4MHRA 5CFDB 1NCQA 5GLWA 4DY3A 3GXUA 3ZMOA 2ZKNA 1YCIA 3OGVA 1A34A 1ZRIA 2BU9A 4QQOA 3ZN6B 1HRI2 5JI9A 3ZPYA 4NIDA 3VZMA 5FXZA 4W4ZA 1EAH2 5FZHA 1W06A 5LASA 1US2A 2H6BA 3POGA 2FQPA 2GNBA 4BA6A 1J3RA 3RYRA 3OUJA 2VMCA 4I30A 3KT1A 4CSWA 4CCDA 5FCCA 5AC93 2R1BA 3BOPA 3I59B 5F9TA 4OHWA 4JC1A 2XL7A 4Z1VA 5G04L 1QDCA 1V00A 1UCXA 3KCYA 3I3MA 3AFGA 2BWCA 2EIGA 1HRI1 3LPFA 5F3GA 1JYVA 3VKOA 1RUE1 2R0HA 4LOSA 4N9HA 1UZ0A 3WZ1A 2VC9A 1RC6A 4QAWA 2R043 5I8SA 4M01A 3C8XA 4FOYA 3ZN5A 3PU3A 4XF4A 2ZX1A 2ZCWA 1VAVA 4BHPA 1EUTA 1S0CA 4AR2A 1JYCA 2ZMNA 1TMF1 3BCWA 3BTAA 3MLLA 1PGW1 2DYCA 1GFF2 5A6YA 5HCFA 2V09A 4LBJA 3H1MA 1C5IA 2ILMA 1X9TA 3NW4A 3IIIA 4ATFA 4HPKB 3BYWA 5JSRA 1ZA4A 2ZHKA 2XB6C 4IE4A 4NRPA 2VQTA 5GALA 1MS8A 5T5PA 3U07A 1J3PA 5K9YA 2RR12 2BNMA 3GZUC 4B7EA 2VUDA 4NPLA 4KWKA 5JAXA 4K1ZA 5J96B 3SEEA 4FT8A 2YU1A 2Y60A 4XF0A 1ZRRA 2OX0A 4AGVA 1QIQA 4RS5C 1FPN3 2MEV3 5FTTC 3AKPA 2FMDA 3ATGA 4KG0A 3ZO0B 4LBQA 5ABJC 3LIHA 2QBXA 5BNNB 4Q1RA 4Q0QA 3ENRA 1JZ5A 2UY8A 3AKTA 4SLIA 4K8FA 4Q0SA 3M7AA 2W5FA 3P3PA 2Y8KA 2PHXA 1AR81 1RUD1 1REFA 3D8CA 5FZ6A 5FPUA 2XLGA 1PO13 5GJ6A 1OOPA 2XBO1 4MXWA 1T6GC 3J8F2 4JRLA 1V6OA 1F15A 1VMHA 4DMIA 2JKBA 3CIHA 3BIWE 5CVRA 1FMD3 4AK3A 2WQ8A 4GH4A 2Q8DA 5A1AA 2Y38A 4G4FA 3N7MA 4V2WA 4OMDA 3I2GA 2G9ZA 4LLFA 4LT5A 2RS52 1S2KA 2G4IA 5FZGA 2R0FA 2JE8A 1X50A 4Q2FA 5KHGA 1GZWB 2A7AA 3POWA 2RS11 4Z2AA 2JG8A 1HB4A 2RDQA 2BOJA 2WT2A 4HFSA 4GKYA 1PK6A 1RHI3 3SCHA 3WUCA 1VLNA 2JIJA 5A32A 5IATA 3FFQA 2VVFA 2BTVC 3BODA 1AR62 2WLPA 3M3OA 4GJYA 3C7GA 5LBBA 3WHTA 2FDKA 3VBSA 4L2NA 3M2MA 3SEPA 2A6YA 2O14A 2QFEA 3BALA 2C1FA 4XDPA 2V5DA 2ADDA 4UXAA 1FAYA 4IE6A 3PMEA 2H0VA 1DHKB 2VCCA 3Q8FA 3MIFA 2IVIB 1VJ2A 4EROA 2DFCA 2FD8A 4FXGB 4UF0A 4CVUA 4QPGA 4YPJA 3NKTA 4OI1A 1IS3A 2DBNA 4WZFA 4HKLA 1QY4A 2RJKA 2XMLA 1LOBA 2XR4A 3MGUA 1ZREA 1AL23 2YPJA 1PX4A 5DAWA 2OZ6A 1H2NA 1KQRA 1RVF3 1W6QA 1WCQA 2ZABA 4HN1A 5JVVA 4EN7B 4NR1A 5DAVA 2PAKA 2L9LA 2YBPA 3E6DA 3VBOA 3UGHA 1H1IA 4DS0A 3RJRA 2P2KA 1WW4A 4MYEA 4CDUA 3OGSA 4XVHA 3RNSA 2QVSB 2Y6HA 5FFOC 3U4XA 1YNAA 3R6SA 2VJXA 1BJQA 1QNWA 1V9U3 2EIBA 4YW5A 1UXZA 2WZ8A 4L99A 4XHXA 1W99A 4HL0A 4DRRA 1F4AA 5IFTA 4UFMA 1UXXX 1ULGA 1H30A 4ARXA 3WW2A 3MPPG 5JSOA 2QQWA 4MO3M 4EZ4A 4R4XA 4ZKTB 3V0AA 2XJQA 3N9PA 4LPLA 4QPGB 2WINB 4LITA 1DZTA 5KXCA 2I2SA 5CKNA 2VZ1A 2Q8EA 2OA2A 4UFKA 5IW0A 1GZCA 4NHMA 1UMIA 5DZEA 3KCXA 2VAUA 5EQUA 4Y5SA 3JBG1 4AXOA 3APBA 1VBB1 2ZX3A 1UZWA 4GQ7A 3BGAA 1C1LA 1W6MA 4PI2A 2XWBB 4LBQD 3B7MA 5FP4A 5FPZA 4M0HA 3AKQA 3VHNA 4QQ2A 2PHLA 1UU5A 2QQUA 4W6XA 5FKBA 2ZBJA 4OUSA 2YC0A 3DUIA 2D6NA 3LDKA 4XF1A 5CFCB 4CXWA 2VBPA 3D82A 1LHNA 3T0DA 1W0OA 1OI6A 1RXGA 2YY1A 4M4RA 4WVMB 5DABA 4A2UA 4C1WA 1GQHA 1VB4A 3HWJA 5FUPA 1WZXA 3D5OA 3ZN6A 4CA9A 5L9VA 5L36A 2P6HA 4AGGA 3K77A 2ET7A 3POYA 3WV6A 2Y0IA 2WO3A 4AFDA 4CP9B 2VZQA 3JBG2 1VAKA 1IQAA 3X29B 3OBRA 4MSVA 2RHPA 4UBGA 1OOPB 3I3EA 1TNRA 4RFRB 4DIQA 3D6EA 3M3CA 4FFIA 4IUGA 1BK0A 1Y7BA 1PX3A 1XNCA 2UWCA 4YG3A 1MACA 2RS53 5FXXA 3H8OA 4QDRA 2E53A 3RI8A 4EV0A 4RGAA 4META 1XB9A 3MV11 3NNFA 2JDAA 2WLQA 1O3SA 3WINE 5D8AB 2R32A 4QPIC 5IVYA 5DZFA 3J8F1 3GBWA 2FZ1A 1RUC2 1URXA 2DBIA 3JD72 1ZNPA 4BQ1A 1OD5A 2CY6A 4AQ2A 3I2IA 3VLBB 3WCSA 2GP3A 1X8MA 3PU8A 1JYXA 2FZ2A 3CL1A 2MEV1 4FCAA 2GC2A 1XNDA 2B9VA 3L2YA 1LNSA 2QZ2A 3CU7A 5J98B 5I8TA 2GN3A 1O59A 1L3JA 5JXJA 4R9BA 2CAVA 3IAPA 3ES4A 2Q5TA 5GZDA 5HCHA 1PK6C 3K3OA 5JDBA 3QACA 3CJXA 4LUKA 1RUG1 5T5JA 3ZKUA 2RDSA 1K45A 4HT1T 3EO6A 1DZRA 4XUTA 4A3XA 4YGBA 1XE0A 2R071 3HMYA 4UFHA 5IK4A 2YBSA 1J83A 4M3CA 4XURA 3MLJA 4Q4Y2 3VKNA 2AEZA 2WNVA 3WQBA 1MEC3 1OVPA 2VQAA 1PGW2 5A7WA 5I0RA 3W5MA 3I59A 2ZHMA 1TMF2 2K46A 4QHZA 1WA6X 5FAXA 1F9KA 5KHHA 3PIJA 1UZZA 3VDDC 1N1VA 5FZ3A 1BEV3 3VBSB 4HPKA 1R083 1AR61 2R16A 3S7IA 4JVAA 2QTWB 1WMDA 4YVWB 3VBOB 4D6QA 2RS13 1ZA7A 2Y64A 1W6NA 1MVEA 1NLSA 3O1RA 2EF6A 5CISA 2VW1A 1R092 1K3IA 5C6CA 3P5BA 2HWF1 5ACA1 1STMA 2OPWA 2XJUA 1G9BA 5A3WA 3ACHA 1MS4A 3LSDA 4NIGA 3AP6A 5BNOA 4Z07A 2JDHA 1ASJ1 1B35B 1SDDB 3B3QE 3N36A 4H7MA 4BJ0A 4BH9A 4RGKA 4E4DX 1TME3 2D6KA 4AVSA 2PAEA 4J25A 4G9SB 5JXHA 5L7OA 2WFF2 1LULA 1QXRA 4AFAA 2BNOA 1ULOA 2JG9B 5HCAA 1US3A 5A32B 2VU9A 1GNYA 1NQDA 4KH9A 5DDJ1 1CQ9A 5BNNC 2YHJA 2P3IA 3ACGA 1OBNA 1Q8SA 3BVCA 2D7FA 2VECA 3VBUA 5C8CB 1AF9A 2GNDA 1A8DA 3AP7A 4FFHA 3ORJA 2VQUA 2ZZJA 4O65A 4QXHA 2YDEA 3ETPA 4C1XA 5A3NA 2CWMA 4OHVA 4JKLA 4Z82A 4CDQB 4D6RA 1X7NA 3HNYM 1W6NB 3MPBA 5AVAA 1YFXA 1OPOA 1Q56A 2BP6A 2JIGA 2GZWA 2R073 5JI7A 1W03A 1WA4A 5EYYA 3A7QA 1XBFA 1VP6A 1SMVA 4D8MA 1PZ9A 1ONAA 2VZVA 2YMZA 3KVBA 1JZ4A 3OD0A 4BQWA 5EJ3A 2HJIA 2WRAA 2XG3A 1CWPA 2TUNA 2WDBA 1AYN3 1CZVA 3NNGA 2JB8A 3UESA 3WCRA 4KBBA 4XUQA 3A0KA 1LOGA 4C91A 3WNKA 2IVJA 2QQMA 3J7MA 1NY72 2WWJA 1N1TA 5IK5A 1Q8QA 4QT6A 5L19A 3KB5A 3RYPA 1C5HA 1PO22 4FPJA 4CEYB 1VBE1 2CL2A 4JGZA 3RZMA 2BFUS 4QKNA 2XOMA 2DCTA 4ISRA 2JG8C 5DAPA 1PZ7A 4D94A 4ET7A 3SISA 4EWEA 3KV9A 5FY0A 1DGLA 4Y33A 1ZRFA 3MIDA 4HK9A 3R4SA 5LBEA 5E16A 1UQXA 1I5ZA 5FMBA 5FYVA 4YW7A 3VZLA 2XQXA 3LIGA 3AK0A 4IW3A 5FZ1A 1SACA 1W39A 5FYBA 4D7TA 3AMMA 1TNFA 2V72A 4EJRA 5JOYA 2J1EA 1PMJX 1JZ6A 4RSUA 1QH6A 4CCMA 3MDPA 1HRV2 4QDSA 4QXBA 3OBTA 1ND3C 2OVUA 1JMUB 3USUA 1JYWA 2WR9A 1JYNA 3HVDA 1QJX3 1HW5A 4YVSC 2VVDA 3QCWA 5FP8A 4BMBA 1WD3A 4CUCA 5LA2A 4MH0E 4GWNA 2EXIA 3DYOA 3ZIWA 2E26A 4JGYB 2YFUA 3CJIA 3BPSA 4XJ9A 4A41A 3CEWA 4IEVA 2VZRA 5FKCA 1FATA 4ARYA 5T50A 2D98A 2NMOA 3WY6A 1UY3A 4P9JA 4QPWA 2JDNA 2RS12 2YC4A 2P6CA 3IIAA 5FZ8A 4CRQA 5EJ1B 1LESA 5TSWA 3I2DA 4P9YA 4YZ3A 1VBB3 3IKWA 2CYFA 2BBAA 2UWBA 4RR3A 1IS5A 1MS9A 2ERFA 3JUUA 4PIYA 5F6KA 3VKFC 2WQ4A 4UBHA 1Q8PA 3WNLA 5JMCA 1TME1 4Q4X2 2HWE3 2A73B 4LHLA 4PT6A 5FZEA 3OBZA 3U78A 4LBNA 4CPBD 2XXZA 1OA4A 3PNAA 5F3CA 5IFPA 2A1XA 3E6BA 1WCUA 2XBO2 1PGL2 1LHVA 1ZM1A 2WNVC 4ISQA 5AC91 2WFF3 1M4WA 3ZXGA 1AR82 4CUBA 5BNOB 5LEJA 2Y6GA 1MQTB 3B9CA 3CO2A 4AVAA 4AQTA 4DO0A 1JI6A 2WKKA 1NA1A 2W9XA 4NWWA 2J1SA 5EWSA 1UY0A 2A6WA 4KI5M 4KG8A 2DFBA 1HIXA 4ZONA 2GH2A 4H2AA 1DGRA 1Y4WA 2GC3A 4XUOA 4HXCA 1QXJA 3OJBA 5C8CA 1RUOA 2LTNA 3B93A 4BDVB 4JHTA 3NV1A 1G7YA 1ENRA 2WO1A 4FFGA 4W6WA 1OQDA 3QBQA 4Q4X1 4XFBA 5FQ0B 3ZDVA 2WO7A 3DV8A 1ZX5A 1C8M1 1TMF3 2XWJB 1NYWA 2YBKA 3I2JA 1SPPB 2AH2A 1W2NA 5D2AA 1HX6A 1W2UA 2JXAA 3GGLA 3KHCA 3WOGA 1QMJA 2PHTA 5CNAA 1AJKA 4IEXA 1YRZA 4JDOA 2HWB2 3MFCA 3THDA 1YWKA 1HN0A 2UU8A 1DIWA 4BE3A 1GWKA 1JTZX 3ETQA 4TTGA 4XBLA 1H8TA 2ARAA 2VXRA 3SQOA 2BOIA 2GMEA 5EZWA 3J9SA 5KWRA 4P9WA 3VBUB 5EV7A 3FBMA 1NCRC 3I2HA 3VDBA 4H7LA 5GZEA 4UFJA 1TE1B 5FO8B 1RUE2 3ILNA 3OTFA 4IV1C 2W92A 5KHKA 4R52A 2D3RA 3FL7A 1RITA 5CU1A 4YWAA 2OQ6A 4XF9A 3H7YA 3T2TA 4DXRA 5H9SA 3VBRA 5CIRA 1COV3 3T4HB 1UMZA 2VNVA 4N53B 4ZS3A 5GLVA 3WW1A 3VBFC 2ARXA 2CDPA 1NAEA 1XRUA 2VBBA 2WNVB 1HRI3 4AZZA 4UOJA 2P3KA 4MX3A 1LGCA 2Q1MA 4JV4A 2JB4A 4C90A 2RMU3 1PNFA 3K48A 1TQ5A 4Y1XA 4Y24A 3I2FA 1DFQA 1DZQA 3SCGA 3DECA 1L7QA 1AYM1 4W8JA 1UWWA 4COYA 1JHNA 4GULA 4ASMB 1OUXA 1R1A3 3LE0A 2EAAA 3SITA 4Q5OA 1QF3A 2B7YA 1SZBA 4AHXA 3WDUA 1UIKA 4CCOA 4LO5B 2KR2A 2CWSA 4ITCA 5BUVA 4GH4C 1V6NA 1V6LA 3VBHC 4DQAA 3AX4A 3N9LA 3BUCA 1QHDA 4KWUA 2GH8A 5DUXA 2FCVA 1JZ7A 2H0BA 2BNNA 4OZOA 4EYUA 2VCAA 1ND3A 4LIUA 2P17A 3AMQA 1SBDA 2MPFA 1HQLA 2ORXA 3LOIA 3BI3A 4XCAA 4YVSB 2WABA 2XUMA 3VDCA 3JB8A 1KFUL 4FPGA 4Q4W3 3ECQA 1ZBE3 1Y43B 5GZFA 3ZYJB 2B39A 5JR2A 5I8YA 3MV01 1GQPA 3U4SA 4SBVA 3VHRA 3BPZA 2GN7A 3WQ0A 4GA9A 1CR7A 1WBLA 4IEPA 4NIAA 5KXBA 4K8RB 3GZTB 3VL9A 1F4HA 1Q43A 2PN5A 3LD8A 5E1RA 4CCNA 4S2GA 3ILFA 4CCJA 1UX6A 1FPN2 2ZPXA 4DFSA 3VZJA 3N7LA 4JKMA 1W04A 1NLQA 1YI9A 1EV12 4ASKA 4YFZA 3NO8A 2A3WA 1CAUB 2XL9A 1IG3A 3IPVB 4CEWA 3MW4A 5A33B 1NLRA 5BNNA 1GU3A 1OFNA 1H2KA 2VMGA 2Q8CA 4I0AA 1E5IA 2E63A 1JZ2A 3UNPA 1XQNA 4FPFA 4Y1UA 2WS92 3AZXA 4E4SA 1ASJ2 5LBFA 3ZYIB 3ZYPA 3I7DA 3RVHA 1HQNA 1X8EA 2GDFA 4OFGA 4ORFA 1JXNA 2BDRA 3ZFFB 1CZTA 1GICA 1D4M2 2IZWA 2WT0A 1APNA 4O9EA 1CJDA 4QDQA 3T0BA 5HXVA 2BGOA 3K75B 2Y26A 1ACCA 2F17A 2QUOA 1H2MA 1MS0A 3NNLA 1YYNA 3AVRA 5A7WB 2Q1FA 3ZSKA 1B09A 4LO6B 4AI9A 4MG2A 3L9JT 4Y4YA 1NA1B 1NZCA 4FOQA 4YFWA 3W58A 4D6SA 4YVWA 1W8OA 1ZZCA 3LEGA 2J42A 2O8OA 3AYDA 1JBCA 4OI2A 4W65A 3AB0A 3WLUA 4E4ZA 3OG2A 5FZAA 3KSCA 3KT4A 3SCFA 1ZZ6A 1GBGA 5FIXA 2ZZQA 3LEKA 3M3QA 3GZEA 1OF3A 3HT2A 2KM2A 1RUG2 4M4PA 1VBA1 5FREA 1T2XA 4AYUA 3FN9A 5EJZB 1H6XA 3E5XA 4JQRA 3LZZA 4YRDA 3RGBA 5BY5A 1JYTA 4EZHA 1QJX1 4BOWA 1NUKA 2LUWA 3W59A 1W9SA 1AL0G 4HSLA 4BQ3A 3TEWA 5CZKA 4ONUA 5FYIA 5FPLA 5G05L 4HANA 1FV3A 1R64A 4XJUA 4CP2A 1B35C 1PVXA 1WLCA 2MEV2 2Q4SA 4YG0A 3OOXA 3LEIA 1RUD3 5B4XA 3VBUC 3LWCA 4LBQB 4AI1A 4FBFA 2VE1A 4N43A 3ZSJA 2XHKA 4U36A 2IXCA 1AR72 3HN1A 1F2NA 3MHZA 4RHV2 4ZU5A 3ZKYA 5J3UA 2OXBA 5SV8A 4BQ5A 2IC1A 5LA1A 2D43A 3E1F1 3LOBA 1NKGA 2Y33A 4HK8A 5CKMA 3JCIA 2JECA 2K9ZA 4UWDA 1R1ZA 3T1MA 1BBT1 3J8F3 4YW4A 4LQRA 2IFRA 5T55A 5FZIA 3R4UA 1JHJA 1PGSA 4P08A 1LEMA 2R042 5A7PA 2HYXA 1V6IA 4P00B 4XF3A 4Y22A 5C3RA 3C7OA 2WZR3 1UPIA 4GWJA 3RJ2X 3LB9A 4J1WA 4LEJA 2A71A 1SHWB 4EWDA 5APAA 1QKQA 2B42B 2F6BA 4LLOA 1GZWA 1Z0HA 3HQUA 2GP5A 2LRPA 1RUNA 3RMXA 5EHDA 1KD7A 1HXS2 4QQHA 1XSQA 5LA9A 1VBC1 4QB2A 1RUI2 2X5IB 1WW7A 2B45X 3HAGA 3G7DA 1QJY1 5B4NA 1Z7S1 2DU1A 1WCDJ 5FZOB 1WGPA 1WW5A 3AYAA 2Z2SB 3UETA 2GMMA 4FPCA 1WWYA 4MGTA 1BZWA 3MW3A 1FT9A 4FI9A 3VKLA 2VY0A 3POEA 3PJQA 2KXLA 5GLUA 2W91A 1JYIA 5FY5A 4DUXA 3WNMA 3FE5A 5M0TA 5LRRA 3Q8BA 3QLQA 4IE5A 1AR83 4PIZA 4XUPA 4NMIA 2V73A 2DURA 3GZAA 3PUAA 1RUJ3 5FZ4A 4NUBA 4X8PA 1AYM3 4P9GA 5A3LA 4HVQA 4LNVA 1VE0A 3DXTA 2YFZA 1VALA 4O9GA 2AR6A 3ES1A 1H9WA 4R8HA 3RWNA 3TN93 4YW3A 4LR4A 5FUNA 5FWJA 3RYKA 4XW3A 2JD9A 4MUVA 3WP5A 1DP0A 4DINB 3TEYA 1D4M3 1H6YA 1NE4A 1VR3A 1XU1A 2JICA 5LEKA 5I0DA 4ZY9A 4JGYC 3RPQA 2B4KA 2YG0A 4NVPA 5J7MA 3S5QA 4D7SA 5F5AA 2Y34A 2SLIA 2FDJA 1A3KA 1N1YA 3NAPA 4HSJA 2JWPA 4MGSA 1V9U2 3OPTA 1I9RA 5A80A 2ZEYA 3LAGA 1ZYBA 2VBDA 1H8VA 5LK7B 5D8AA 1VBD2 3UKVA 4IV3C 2VPVA 2R7EB 1Z7S2 1N1SA 2PHRA 4XJ8A 3PJYA 4FPEA 2WBKA 3AYCA 1KRIA 4XFGA 5F5CA 2PHFA 3GNEA 3O5SA 4ZU4A 2WNUA 4B4QA 4YW6A 1UAIA 4JQTA 4PBPA 1EV13 1QH7A 3M3IA 1FMD1 2XHNA 4GZ9A 1COV2 4BB3A 5JOZA 4RN5A 5IVBA 2QDRA 1BEV1 1UY4A 1DQ2A 1V6KA 3WDYA 4TSVA 2X05A 2BUKA 4FFFA 5FBZA 5FMOS 5LBCA 4ZZ8A 3GJAA 3R05A 4NE9A 4XILA 4GB31 3ZYBA 1GWLA 4FPOB 1LOAA 5JR7B 5C70A 3VHPA 1XNTA 3U10A 4NIIA 4BQ2A 3NAPB 2ZGOA 4IV1A 5C9AA 1XE8A 3OD4A 3KD4A 3PDQA 2UY9A 3DKQA 1S0IA 3WSOA 1GOFA 1R082 3A23A 1ZVFA 1PIV1 4E2QA 1PM4A 3J7HA 4JDMA 1XYPA 3NSTA 4Q4W1 4QKFA 1PVC1 3S6PA 3HPNA 2IXJA 2P34A 1CAWB 2JE9A 5DUWA 3QD6A 4RS5A 1O7FA 1A8MA 4FTSA 4NIHA 2PYTA 2AYHA 3NV2A 3DXUA 3QOPA 3ZSLA 3ZXJA 1V0AA 1W9WA 2O0OA 3V0AB 4QB6A 1XC6A 2J1RA 2W1SA 5F37A 3AMHA 5A33A 3N9NA 2ZGQA 3C2UA 4TLGA 1AR91 2ZJCA 4GMP1 2JENA 3N7KA 3O12A 1RVF1 4FAHA 2CGPA 1O6UA 2DCJA 2D44A 4IL7A 2FCUA 4PJYA 5AFEA 2E9QA 2PXJA 2GC0A 1UZYA 4MLOA 4O7XA 1RUH1 4R9AA 1XNKA 4BM8A 5J1XA 2Y0OA 3ABZA 3KV5A 2K0GA 2XLAA 4PDWB 3NWKA 2YPDA 1V6MA 3EQEA 4KQ7A 4CDWC 3E5QA 3WDVA 1MZ5A 3I54A 1S2EA 1O3QA 2FMYA 3OF1A 1IKQA 1OH4A 1QJU2 5C71A 2ZEZA 2HWC3 3V64A 1BK1A 4LO4B 5F5QA 3FLRA 1UKGA 1O4YA 5FOBB 3DF0A 3UJOA 1CVNA 1R1A1 1SFNA 1LENA 5EYXA 4AEJA 5JCTA 5KBFA 3Q9OA 1JOPA 2VVEA 1NZIA 4H55A 2CAUA 2JG9A 3T3YA 3JBG3 4XFFA 4QX3A 2AEYA 1TZOA 2LALA 3A21A 1GP5A 2HBTA 1C8NA 2IFWA 5EXOA 1CX4A 4IEQA 4RFT0 1S0DA 3NL1A 1H1MA 2A3YA 1SLAA 3LGRA 3VZKA 4AEDA 2K2SA 3ZOIA 5A6XA 4Y1VA 1S0BA 3BTXA 1FYUA 2QZ3A 2XJTA 5CG8A 4CEYA 1ULCA 1HXS3 2VMDA 1GSLA 3OGGA 5FUIA 1SCRA 1QJFA 4AG4A 1LCLA 2XVKA 3U14A 2RV9A 3K3NA 1ODMA 3O14A 2OUHA 3RWKX 5DMYA 1HB1A 2PLV1 1L7RA 3WF4A 4CP0A 2G1MA 2JDKA 4NOTA 2CU5A 2JG9C 1GR3A 2CDOA 2DDUA 3T1LA 1W8NA 1JOJA 5H9QA 3GALA 4AI2A 1LECA 2X5IA 1GNZA 3I4IA 3MFAA 4MHUA 4A6SA 4QU2A 1UPSA 5JPMB 1I5PA 3B94A 3SHRA 2R063 1FXZA 3IN9A 2D6MA 4QGNA 4Y3OA 3T2OA 2AC1A 4KGGA 3ZXEA 3D3AA 4MGQA 1YQ8A 3KQRA 4LA2A 2RS33 4Y22B 1ZBA2 5FY1A 2OIIA 3O7OA 5I0TA 1VMFA 3B02A 5GLZA 1QGLA 3MIBA 3VBOC 3PVBB 2XUEA 3HNMA 2ZGPA 4FPYA 1H4GA 1JUIA 3LA7A 1AR73 4RHV3 5FZCA 3KWVA 2VMIA 1RJ8A 3LA2A 4CTEA 5C5TA 5I91A 4F83A 1MS1A 2P3JA 3AZVA 5B2GB 2DUOA 1PNGA 1IPKA 1OHFA 4L92A 1RHI1 5DUVA 5FMDA 2DU0A 2TBVA 3U75A 4F8AA 1UOGA 2I07B 2WIIB 4FOWA 4IEYA 4WVWA 1XU2A 2XLFA 4EN8B 5IYYA 1F8VA 3WVJA 3ZLIA 4KNCA 4WM8A 3H3UA 1EY2A 1LJ7A 2GSYA 2RJLA 3DL3A 4GWMA 4JDNA 4CUGA 1I1EA 1NCQC 2EA7A 3M1HA 3OUIA 4XBQA 3WX5A 4PF1A 2GNMA 2W1QA 5E6HA 3TYJA 5KXDA 3S5AA 2Z5WA 1OMIA 3FLPA 4XIKA 1QQP3 3ZXFA 1OKQA 2VTXA 3O1SA 2HWE2 3SH5A 1LAJA 1LGBA 1C3HA 1QOOA 4AL9A 1KDKA 4AVTA 1J59A 1H8TC 5BNOC 4Y4RA 5IWFA 1MZ6A 1UY2A 3INAA 2W52A 2MNGA 2VD7A 2EXJA 4QPYA 3ZSMA 4OQ8A 1RUI3 3BU0A 2QQOA 2ZGRA 3POFA 3V56A 5CFDC 3AJYA 2UYAA 4LBKA 1PO11 3AM2A 4YW1A 4AFMA 2WT1A 1GOGA 1CJPA 3TN91 2CTVA 3CDZB 3SXWA 3HR9A 5T5OA 3B00A 1OPMA 1ULDA 2PFWA 3H0OA 2E31A 2A6XA 2BQPA 4GIQA 3OUHA 3K46A 4XOGA 1POV1 2HWC2 2VOWA 2CNAA 3DPRC 4QQPA 3ZYGA 5GZGA 3RZHA 4EE2A 1LU1A 2VMFA 1X9PA 1IS4A 5F3EA 4UAPA 1S55A 1WW6A 2P37A 4QPIA 5C4WB 3RZGA 5DXDA 1OOPC 2JDZA 3AZWA 4ES8A 4YGEA 1IS6A 4AQ6A 1CIYA 3TN92 4UI9L 4AW7A 4RGGA 1XXNA 2VR4A 4YG6A 1F5JA 4HLTA 1Y9QA 1UO9A 1AYN2 2Q0AA 2QDNA 4XFCA 5C8WA 3GBGA 1MEC2 4AE2A 3CZUA 3CKHA 1JZ8A 5F7UA 4XJAA 4AI0A 5JLVA 3NJVA 5C3SA 4IGPA 1FV2A 2WO2A 4XHBA 1D0GA 4AEDC 1CPMA 2HWE1 1CZSA 2PLV3 3KV6A 4OUEA 3CNAA 1PMIA 3WP6A 5CKQA 4DY5A 4IESA 2E32A 1UOBA 3NMBA 2Z42A 4D0QA 4I2OA 1W2TA 2JX9A 4QKBA 2W46A 2BYVE 5GZCA 5LW9A 3KS7A 2I45A 2G19A 3EJKA 3OCPA 4G3YC 1PVC2 1HLCA 1LB2A 3IB3A 3VBHA 4RQPA 4QX8A 4E8DA 1U5IA 1YHFA 1DGWA 1PIV2 5K4LA 4LO8A 3KGZA 5FZOA 4A44A 3WG4A 2EVXA 3OEAA 4XCBA 4NROA 3TWIA 4CEYC 3F95A 4L9BA 4AVBA 5DUUA 1F31A 4CCLA 4OZXA 4UW4A 4XJWA 2YC2A 2WAOA 1ZRDA 3EYPA 2RDRA 3HD8B 1OXCA 2P3YA 3LQCA 3THCA 2HLEA 1W90A 1LRHA 4XAEA 3E6CC 4K6BA 4YLZA 3ROUA 3U11A 4XIOA 4CYDA 4LKDA 5FMCA 2WNEA 1TVGA 3NJZA 3FHAA 3LF7A 4R4ZA 1XE7A 1QJEA 2BRTA 2EIEA 1AXZA 3PUSA 1FMD2 5HXMA 4BU2A 2VULA 2RDNA 4XQWA 3UGGA 5K0UC 4LO7A 5FZLA 1OH3A 1YI7A 2CHHA 2VMEA 4KU8A 4RL7A 1AR93 1GLHA 1RTVA 2PAMA 4N90A 2Y6FA 4A6OA 2BJSA 2E7TA 2YU2A 1QJY3 1OA3A 2ZMLA 4NO4A 3URFA 2HEVF 4B3NA 5A6ZA 1K5JA 1QOSA 1KFXL 2ZAAA 3GJBA 1ULEA 5FYMA 5C3OA 2GU9A 2YGLA 4Q0UA 2WAAA 4ASLA 1Q8OA 1VBD1 4XACA 1LODA 1U5XA 4NHXA 4R9CA 1JS9A 2BFUL 2D97A 1XJAA 2HWD1 3OY8A 4AVCA 3UL2A 4TXWA 4Y5TA 1G9AA 4AGRA 5FY7A 2XONA 4COVA 2PTMA 3RMYA 1HDKA 1WUVA 3GDBA 4QMAA 1GMMA 4IE0A 5ERLA 3ZX7A 1AHSA 3RDIA 1IPJA 1NY71 4A7KA 1NQJA 5C3PA 2G9FA 3RRDA 5FYUA 3FZ3A 3H1YA 5FBJA 3OPWA 2B9UA 5EFUA 2X53S 4N43C 4CDWA 4PLOA 3USUB 3SLIA 2WS93 1ZBA3 2YUEA 4FVVA 1UOJA 5I0UA 1UF2C 4CZSA 4UW6A 3WF0A 5A3PA 5A1LA 2EIDA 2BVVA 2ZX0A 1AJOA 5ANQA 3VDDB 5CFDA 3AMPA 5F3IA 2ZGMA 4Q0VA 5FOJB 1BHGA 4FSJA 4MGIE 1FOD1 1W6PA 2YV8A 1NG0A 2XKOA 3MYXA 1ALYA 2IXHA 2YYOA 4E8CA 3AZZA 3ON7A 1C4RA 4XETA 2ZX4A 2WYFA 3JB4C 3S30A 3WD5A 3TAYA 4QX5A 2YB7A 3WNXA 1CX1A 3DPRA 3O1TA 4K3UA 3FFZA 5DZGA 3O1UA 1W6OB 5FZ9A 2F4PA 2JDMA 4AF9A 4I3GA 5JZGA 1E5SA 3TEZA 2LS6A 4RR3B 1X82A 5ABJB 5FXVA 2YROA 1U5YA 3RG0A 3DN7A 3LEMA 3VZOA 5EIYB 4URTA 3JXSA 4RS5B 3W5NA 4CDUB 1UMHA 1T6BX 3HQXA 1SFPA 3HN3A 2FDGA 3UKTA 4QD2A 2XQRA 1RUG3 2ZGSA 3H7JA 5FLJA 4Z2WA 4N53A 4U2AA 2W87A 3OEBA 2W1UA 5FPVA 4QXCA 4Y20B 1S2BA 4Q4V3 1IHMA 2RM22 3T2QA 3VHOA 3ASIA 4BLJA 4FTEA 3F2ZA 2EALA 2VCBA 2DWRA 5FMOL 2QNKA 3KHBA 2V4AA 2NN8A 3K51A 3DKWA 3PTYA 4IGOA 3LCPA 3WF1A 3IMMA 4P9XA 1O4ZA 2DUPA 2A6VA 3GF6A 4YVSA 4DRVA 2RM21 3NAPC 5FPAA 1BQPA 3DPRB 4HKOA 1AXYA 4JZRA 3PIGA 4Q4Y1 1R1A2 4GMP0 3BTZA 4CU7A 4XFHA 4XFIA 4LBMA 4BQYA 2TNFA 3PVOA 5CYYA 2JDUA 5FLHA 5KHJA 2VH9A 3AXEA 4AQSA 5A3UA 1J1LA 1PHMA 3R0RA 2H6CA 1DQ5A 1QJU1 4YZ4A 5FP3A 4GKXA 2B46X 1OQEA 4M00A 4V1PA 2C9KA 2VZTA 1KJRA 2Q30A 4IERA 3EB7A 5CFCC 4YSFA 3H9AA 4MXWB 4OQ9A 2VXJA 1H8TB 4WM8C 2VOKA 1RUF2 2W2IA 3GCXA 4L11A 4LULA 4ZPIA 1DBNA 4C0HA 5IAXA 5FZDA 3ZFEA 1RUF1 2P4EA 1ZBE2 1ZZBA 2ZAHA 1RUC1 5FO7B 3UK9A 3KT7A 3N3HA 4CU9A 1CPNA 3JD73 4HETA 2ATFA 2OT7A 3ZM8A 2FDIA 2J1TA 1KS4A 1W2OA 2J1VA 4BK4A 2NP0A 3T2PA 1RUE3 2WQZC 2LROA 4DXZA 4QU1A 4D7YA 1OT5A 5BNPC 1KGYA 3VZNA 3BIEA 2VG9A 5IVEA 4KMQA 3MIGA 3WHUA 1POQA 3WQ1A 1MVQA 4IQPA 3SKVA 3DYMA 3HJRA 1DLCA 4JKKA 3VKMA 3K4DA 5IVCA 3BTYA 4XQDA 5DAQA 4EN9B 2ZHLA 3AKRA 3S0MA 1GWMA 1SBFA 3WG3A 4IE7A 2OPKA 4Q4Y3 1W28A 3MZHA 2NZ9A 4Q0PA 2AUYA 4OI0A 4E4HA 3IM0A 3MBWA 4UF0B 4XABA 4OUMA 4COUA 4A7YA 1AVBA 1JH5A 3EXUA 4YW2A 3LKJA 4HOOA 2C24A 2D40A 1BEV2 2D3SA 1OD3A 2QQKA 4KWLA 5LATA 4K20A 2JDYA 4CDUC 1YLLA 4RD7A 5L7OC 5T5LA 4MVTA 4WVVA 2VOXA 3IDCB 4IXLA 2E51A 3VL8A 1NXMA 2ZTNA 3A0NA 4J6GA 3GBFA 4V2VA 5FK8A 1QOTA 2WWUA 4N9IA 4OLLA 1OVSA 1ND2A 2DCKA 2JJ6A 3E97A 1HKDA 1SLBA 4UYBA 1AXKA 2VCMA 3MI8A 1UIJA 3B01A 1Z7S3 4JCKA 4PIXA 4Q1PA 4YM0A 5FZ7A 2JD4A 5FP9A 1CESA 4B1MA 3H1WA 3HBKA 1W6OA 1W6MB 3W21A 4I02A 2JE7A 2Y6LA 3OBAA 2QQPA 2R041 3AXDA 1XNAA 5C5UA 4CUAA 2D5FA 4L0PA 3RI9A 5C9AC 3PVNA 1K5MC 2WYSA 1VRH3 4J1XA 5FY9A 4CDXC 1KJLA 1W8WA 3CBNA 1EUUA 4IGQA 5CBLA 5FPXA 4QQLA 4JX0A 4XE9A 5I0SA 1C8M3 2GALA 4AFBA 4WVMA 1CGPA 2R6QA 1PIV3 1I6XA 3CLPA 3OY8B 1S0EA 2QQLA 2ARCA 1AR71 4RHV1 1B35A 4N43B 2D6PA 4LHKA 1REDA 1VRBA 2HH9A 3T0AA 4EQVA 5IUQA 5IVVA 5ABJA 1TEIA 3KGLA 1D4VB 2PELA 4LK7A 2UWAA 4A45A 2DCZA 3AC0A 4CPBA 1ULPA 5C33A 1GKBA 3KCCA 3ZFFA 5F8PA 1UX7A 3M8LA 4TYSA 2VL4A 5FRAA 1J58A 3NV4A 4GMP3 3J7NA 2HKXA 1VBA2 1X33A 2DF7A 5FY8A 3KF3A 1QQP1 5BNQA 1YQ2A 4I01A 2J1UA 4AI3A 4OMCA 4A42A 2F4LA 4EWAA 4E27A 1HJGA 1HV0A 1W8ZA 1ZBE1 2ZMKA 3AVSA 4P14A 3PUQA 1DU3D 2WUHA 3ZDSA 3PVEA 2A5ZA 3POBA 1V70A 1VB2A 5L9BA 3O1PA 1DQ6A 3V65A 1FX5A 3B69A 2HEYF 1ENSA 1GP4A 1HB2A 1W3XA 1LKNA 3DCQA 4YYOA 3H8RA 3QH7A 1BVVA 1O8PA 2JKXA 4LHNA 2D5HA 2RR13 3MUZ1 2NYYA 3H8UA 1DQ0A 3BN6A 3O0VA 1JU3A 1S1AA 4XMAA 2A6ZA 2HWB1 4I0BA 2B5HA 2WNUB 4BQXA 4LHSA 5I93A 3AKSA 2D6LX 4XYXA 3BB6A 4RQPC 2RS51 4TWTA 2HWC1 5FP7A 1WBFA 4IEWA 5HI0A 4PF5A 1W9FA 1RXFA 1CIWA 4GB33 4CP1A 2FDHA 4UW3A 5HBAA 3T4VA 5CG9A 4BYYA 1N3OA 4IEZA 3VDAA 2PHDA 4NN0A 4QX2A 3GYDA 3GM8A 4X8NA 4XEZA 3WF3A 1U0AA 3VD3A 3IDBB 4AHYA 4XZPA 1IKPA 1IPSA 3N9OA 4OI4A 1RUD2 3A4UA 1DF0A 3B9IA 3JU9A 2ZHNA 5FLIA 4FOVA 5C7GA 2W95A 4PDWC 1UZVA 4ATEA 3MICA 1JW6A 4FPLA 4UFLA 4KBZA 5T3NA 2Z79A 4NRMA 4ZS2A 3UYJA 5J48A 1C57A 4TN7A 1CAVB 3SMHA 4XXAA 4LMFA 3UV9A 1OLMA 3UT0A 5LRSA 1LEDA 1RUF3 1Q5OA 2VZSA 3MUY1 4LTAA 1SDWA 3P3NA 1WMXA 2IXKA 3U1XA 5F6LB 2VO5A 1OKOA 1SLTA 4CE8A 1VBD3 3K4ZA 5FYTA 4Q27A 4EN0A 2CSGA 4AHZA 1MZEA 2LW8A 1XYOA 1W8UA 4W6YA 3B5LB 3JZVA 1FI2A 2ARBA 4N7IA 2W08A 4FTBA 1SLLA 2RS31 4LKEA 5T52A 2XBO3 1UY1A 1SLIA 3VBRC 3C3VA 1K42A 4GWIA 2IUWA 4S2HA 4Y1ZA 5C4WC 1FOD2 1P8JA 3EHKA 1JZ3A 1CD3G 2R061 4AEKA 5A3OA 5AFBA 4S2DA 3ALQA 3ZFGC 1VPHA 1YFWA 2QQNA 1DG6A 2E7AA 1FNZA 1W8FA 2BWAA
chains in the Genus database with same CATH topology
4N8MA 3T30A 1XB9A 5EHDA 1NLQA 4CA9A 2P1BA 2VTXJ 1K5JA 2VTXA 1XE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8M A;  3T30 A;  1XB9 A;  5EHD A;  1NLQ A;  4CA9 A;  2P1B A;  2VTX J;  1K5J A;  2VTX A;  1XE0 A; 
#chains in the Genus database with same CATH topology
 1NCR A;  1OLQ A;  2WC2 A;  4HMZ A;  2WJS A;  1RMU 1;  3PUH A;  4JGZ C;  3WUD A;  5FPB A;  3FUQ A;  5A1F A;  2N7G A;  1DLL A;  5A3M A;  4R9D A;  5JIA A;  3NJY A;  5JXG A;  4A3Z A;  3C7H A;  1RJ7 A;  2J22 A;  1EPW A;  1MQT A;  4AI8 A;  1W2A X;  5JUV A;  5JWP A;  3FHI B;  3BKZ A;  5GLT A;  1HN1 A;  1H9P A;  1WCS A;  1IG0 A;  1VIW B;  3I2O A;  4B7K A;  1PO1 2;  2ZGL A;  3ZYF A;  2XVG A;  4AFC A;  2AZ5 A;  3OPZ A;  3LA3 A;  5DDJ 3;  2C0Z A;  2IXI A;  2HWD 2;  1S0G A;  1GQG A;  2DVB A;  2WNO A;  4W50 A;  5L9R A;  1H2L A;  1W6P B;  4JHZ A;  1EV1 1;  1NXD 1;  1NOV A;  4DUV A;  1VBC 3;  2XPJ A;  1S4C A;  4BME A;  4JTN A;  2VZO A;  5J36 A;  5LY1 A;  4OYU A;  4YAR A;  1J84 A;  2WA4 A;  4IV3 B;  4B8E A;  1UKR A;  1GZ9 A;  1YC6 1;  2ZEW A;  3ZYR A;  1O3T A;  1NCQ B;  3MO4 A;  3TOJ A;  1KEX A;  5FJK A;  1LOC A;  1NE6 A;  5A70 A;  2DVD A;  2DUQ A;  2NPI A;  1NCR B;  2ZS6 B;  5HV4 A;  1XOY A;  1PM7 A;  2DTW A;  2ZGU A;  4LJH A;  4XQ4 A;  5F39 A;  5JOW A;  5JZG B;  1HJF A;  1IOA A;  2BW8 A;  1OUS A;  1K5M A;  1N47 A;  3AP9 A;  4LA3 A;  4LOT A;  1AR6 3;  2VZ3 A;  3S57 A;  3EBR A;  2X29 A;  1BCX A;  1EP0 A;  4XDO A;  5A7Q A;  3U0Z A;  3RFR A;  4OHY A;  5ANN A;  1GNH A;  1RMU 2;  4Q29 A;  2PQS A;  5DQ0 A;  2D6O X;  2VNO A;  1POV 3;  4IEO A;  2VUC A;  3D0J A;  1NT0 A;  5AVP A;  5FQ0 A;  1YQ6 A;  1SLC A;  4JAA A;  1BMV 1;  3IDE A;  3HIF A;  1H0B A;  3FHQ A;  3PHM A;  2WFP A;  2R06 2;  2VZU A;  4Z92 B;  2UYB A;  3L2H A;  4DUW A;  5DG1 A;  3WG2 A;  4KL1 A;  4LXL A;  1GOH A;  4IV3 A;  1EAH 3;  1QJZ A;  1YFY A;  2RS3 2;  3FMG A;  2QKD A;  1OSG A;  1RVF 2;  5H9P A;  1G6N A;  2VNR A;  2DV9 A;  1WD4 A;  5D1I A;  2MHF A;  3CJI C;  5AC9 2;  1U12 A;  1C1F A;  3WNP A;  5D21 A;  3ZR6 A;  4QX1 A;  1LHU A;  2VTX J;  4BIO A;  2WFF 1;  3I3D A;  3ST7 A;  5EP9 A;  3BOW A;  4MOA A;  2EAK A;  3CF6 E;  1E57 A;  3GHN A;  2PLV 2;  2VMH A;  5JPN B;  2ZGK A;  1QNY A;  2OS2 A;  3AL5 A;  1GUI A;  1O5L A;  2XJS A;  3IDA A;  4A4A A;  4CEW C;  5JXI A;  3SH3 A;  3WW3 A;  1SFY A;  1FNY A;  1YQ5 A;  2BGC A;  4Q4W 2;  3MIE A;  2UUR A;  1NA1 C;  2VUA A;  4QGM A;  5ACA 2;  2P5B A;  1RUC 3;  2XKP A;  1R08 1;  1R09 1;  3WP3 A;  1W8T A;  2ZX2 A;  3I8T A;  4FQZ A;  5BNP A;  1ENX A;  3ZPO A;  2VOV A;  3WW4 A;  4WBB A;  1LR5 A;  1AYN 1;  2DCY A;  1W0N A;  1RIR A;  2OW4 A;  3WDW A;  1AX0 A;  4P5Y A;  3SH4 A;  1UL9 A;  3T30 A;  2HWF 3;  2TEP A;  2WN2 A;  4NRQ A;  4YM2 A;  5FY4 A;  5CB7 A;  4PDW A;  3H8X A;  1WKY A;  1FOD 3;  3PTR B;  5BXX A;  3H50 A;  4GAL A;  3PMS A;  1E5H A;  1RGS A;  2Q1Z B;  1OA2 A;  3CHX A;  5SV5 A;  4YM1 A;  5FWE A;  4PHZ A;  2ADE A;  1W8H A;  3ZFE C;  2R49 A;  4YGC A;  1OF4 A;  2KA3 A;  4L97 A;  5JSP A;  4X6R B;  2QQV A;  1QJU 3;  3IWZ A;  4K1Y A;  4CDW B;  4XMI A;  2W47 A;  1OUR A;  3M4F A;  1ND3 B;  4Q8L A;  1G9D A;  2ID4 A;  4M3C F;  1OLM E;  4FPK A;  4BIF A;  2ETE A;  1GAN A;  4EN6 B;  4XTM A;  3KF5 A;  4B1L A;  4PCR A;  4CCC A;  4LBO A;  5IAV A;  3GHM A;  5LK5 A;  3SC7 X;  3WP4 A;  1RUH 2;  2VNG A;  4BPZ A;  4DXS A;  2HWD 3;  1G8W A;  1IZ3 A;  2QCS B;  3FJS A;  1JOD A;  3J7L A;  5BPX A;  1M06 G;  1RL3 A;  2NM1 A;  1HV1 A;  3JD7 1;  4WM7 B;  1DGR N;  4IET A;  4OHX A;  3N9M A;  1QXP A;  1CAX A;  1YJL A;  3ACL A;  3HBZ A;  5FDB A;  4MZU A;  1QQP 2;  4NPR A;  3T09 A;  3IMN A;  1LTE A;  2C6S A;  5CEH A;  3NV3 A;  3ZIX A;  5FV3 A;  3WNO A;  1TME 2;  1ND2 B;  2ZOE B;  4DXT A;  1BKZ A;  4YNI A;  1IGO A;  1UU6 A;  2XH6 A;  3I97 A;  1D0H A;  1HQW A;  1WLT A;  1RHI 2;  4QHO A;  4FP3 A;  3RS6 A;  1EYB A;  2CGO A;  2E7Q A;  3PUR A;  1BBT 3;  4QXK A;  3IZO A;  2OKX A;  3UJQ A;  3RZJ A;  5IJR A;  4Y26 A;  3USS A;  3VBH B;  4RQP B;  1G9C A;  4O61 A;  1RMU 3;  2PHW A;  4Y1Y A;  3RSJ A;  3EMR A;  5IK7 A;  5DPN A;  1G86 A;  1ND2 C;  1ZBA 1;  3MF9 A;  3I3Q A;  5FK7 A;  1SBE A;  3AMN A;  4WVZ A;  5LWB A;  2FBE A;  4GD4 A;  2XVL A;  1GP6 A;  3ZYH A;  4BQ4 A;  4K7J A;  4GB3 2;  2ORZ A;  3ZVX A;  3IT8 A;  4XTP A;  1KIT A;  1LGN A;  4BXF A;  5J09 A;  1N3P A;  1OC1 A;  4Q26 A;  4WM7 A;  3U37 A;  3G6J B;  4AAP A;  4IEU A;  3VN4 A;  1JU4 A;  5K8S A;  5F32 A;  2FHR A;  4ES9 A;  4MV2 A;  3TBD A;  4C0B A;  5CA6 A;  2AGS A;  3TB0 A;  1COV 1;  1AL2 2;  1JOB A;  3H3Z A;  4XUN A;  3WT3 A;  2Z4F A;  4BLI A;  3O1V A;  2ZGT A;  3FUO A;  4CDX A;  1TG7 A;  1RUI 1;  4FAG A;  5IVJ A;  4LIV A;  1U5Z A;  2GNT A;  4N53 C;  4M3C B;  4DPN A;  1HXS 1;  1V6J A;  2ZKL A;  4OCT A;  5IHR A;  3AL6 A;  4KWJ A;  1WLD A;  4LUM A;  3HQR A;  4DZG A;  5KR7 A;  4CU8 A;  3N7J A;  1RB8 G;  2J7M A;  1UD1 A;  4H3W A;  1YFU A;  1MPX A;  3WQ7 A;  2OQ7 A;  3A22 A;  4NJ4 A;  1RYY A;  4S2F A;  2KD7 A;  4KU7 A;  1J1T A;  1SQ4 A;  1DYK A;  1DQ1 A;  3AFK A;  5FYZ A;  1V9U 1;  1YQC A;  1YO8 A;  3TRS B;  1BXH A;  2Q8O A;  4HKW A;  4QM9 A;  3Q8A A;  2BER A;  4P9I A;  3POI A;  2D93 A;  1VBE 2;  1LU2 A;  5E88 A;  5K0U A;  3WDX A;  4YZ1 A;  2GC1 A;  4Q4V 2;  3VD7 A;  4PBO A;  2SBA A;  3H3L A;  2ZXQ A;  3KZ4 C;  1CON A;  3VBS C;  3HNB M;  3LDR A;  2I74 A;  2P1B A;  1QWR A;  2FCT A;  1F35 A;  2PQQ A;  4CDX B;  3K2O A;  1K5M B;  2WSU A;  3NJX A;  1GYK A;  3RZK A;  1PZ8 A;  4TLF A;  1UN1 A;  2WN3 A;  5C9A B;  4M3C E;  1Y3T A;  1QEX A;  4XXP A;  1DYO A;  2BZD A;  1W0P A;  2XJV A;  1QJX 2;  4XDQ A;  5CAZ A;  2EXH A;  2CGN A;  3H42 B;  3KQ4 B;  1MS3 A;  1C28 A;  3CZJ A;  4OHZ A;  2OYZ A;  3FC0 A;  3LSE A;  2PA7 A;  3O0W A;  1AX1 A;  3KM5 A;  5FXW A;  1QDO A;  3TNQ A;  1MQT C;  5H9R A;  3VBF B;  4UW5 A;  2XJP A;  2VQ0 A;  4JGY A;  3LFM A;  3M3E A;  3CJI B;  4KGQ A;  4AWD A;  3KLS A;  2X5I C;  2OUJ A;  5T54 A;  4CP9 A;  2Y6K A;  1SG3 A;  5L7O B;  1MS5 A;  4QHB A;  2JDP A;  1AR9 2;  5DDJ 2;  2Y6J A;  1KS5 A;  4IV1 B;  2HYK A;  1QJY 2;  1GZT A;  3TNP B;  3K4A A;  4RA0 A;  5L73 A;  3RZL A;  3ZXD A;  1VBC 2;  4WZC A;  4AHW A;  1R09 3;  2BVB A;  2EXK A;  1ENQ A;  1W05 A;  2RG4 A;  2HEW F;  5KC5 A;  1LHW A;  1PO2 3;  4CDQ A;  1ZZ7 A;  2CV6 A;  5A3T A;  1MR5 A;  1VAM A;  2YZ4 A;  3O0X A;  3MW2 A;  4CCE A;  4AEM A;  4BWO A;  2HWF 2;  1W3V A;  2RVA A;  3KV4 A;  2WS9 1;  4XFA A;  3NNJ A;  1QU0 A;  1BBT 2;  1N3Q A;  1ULF A;  3ZXA C;  3KVA A;  3HOB A;  4MGZ E;  3ZSE A;  1PVC 3;  4QB1 A;  4Y20 A;  5FZB A;  5BNP B;  2C4X A;  2RM2 3;  5JZG C;  2W68 A;  2VW0 A;  4DB5 A;  3NVC A;  3RZZ A;  1A78 A;  2R1D A;  1WCK A;  3V0B B;  3LDB A;  4YGD A;  2C26 A;  1WLW A;  1JN2 P;  2VW2 A;  3PUI A;  3SNM A;  1HRV 3;  3ELN A;  1SEF A;  5LA0 A;  1YIP A;  4HBN A;  4I0W B;  2FDF A;  2WZP P;  5DN2 A;  2R07 2;  4LK6 A;  4LOR A;  1J3Q A;  1BLZ A;  3ZXL A;  1POV 0;  4PQQ A;  4B29 A;  5IVF A;  3WXP A;  2IWG B;  4Z8B A;  3WF2 A;  2QJV A;  4BCU A;  1XSR A;  5DG2 A;  2V4V A;  1RUH 3;  1S0F A;  2J1A A;  4E9K A;  4COW A;  3O1M A;  2VGD A;  3NQH A;  3IAQ A;  3FWE A;  2BPA 2;  2Z69 A;  3I3B A;  3NNM A;  2D3P A;  2RR1 1;  1LOF A;  4UT5 A;  4FO9 A;  4XAA A;  2BV4 A;  3E5U A;  3N9Q A;  4HVO A;  4Y5Z 0;  3T08 A;  3OYW A;  4QX7 A;  1MZF A;  2JG8 B;  4F3J A;  2DTY A;  4C8D A;  5HPO A;  5A6Q A;  2ET1 A;  5FJH A;  3PL0 A;  1K12 A;  1ST8 A;  4NHL A;  4QX0 A;  2W39 A;  5A7S A;  4QPG C;  4JGZ B;  5KC6 A;  4WV8 A;  3ZMN A;  4Q4V 1;  2GMP A;  3D0S A;  1UU4 A;  3MF6 A;  5ACA 3;  4Q4X 3;  3TEX A;  4CU6 A;  1UYY A;  3ZFG B;  3WEZ A;  3ZFF C;  1VBE 3;  1CAW A;  2B8M A;  1Q3E A;  5C3Q A;  3JQW A;  4D69 A;  2WL1 A;  2QQJ A;  1LHO A;  4N7U A;  2IXL A;  1DYP A;  3IBM A;  1D4M 1;  1LOF C;  2WNU C;  1NX9 A;  4MXV A;  3VBR B;  4BK5 A;  4I3P A;  4DEQ A;  3NRU A;  1S0J A;  4QGL A;  4PLN A;  1I3H A;  1OFS A;  4LE4 A;  4D3W A;  2DVG A;  5FZF A;  3LPG A;  4BIS A;  3WG1 A;  1O8S A;  3ZXK A;  1W9Y A;  1RIN A;  3KMH A;  4RYD A;  1DGW X;  3CQO A;  4CXX A;  4XBN A;  2X09 A;  1YXW A;  4WM7 C;  4K21 A;  1DQ4 A;  5DAX A;  4K40 A;  1EAH 1;  3I2K A;  2VOT A;  4M0N A;  4XZU G;  5A7N A;  1AL2 1;  5C8C C;  1AUY A;  5LCW L;  3J26 N;  4RR3 C;  4MGY E;  5KHI A;  2XJR A;  3VUO A;  5F5I A;  4GXL A;  1FPN 1;  5FR3 A;  1VMJ A;  3MLK A;  4GAZ A;  2BEO A;  4QWN A;  4X6Q B;  2A3X A;  2RJ2 A;  2VM9 A;  4ZHN A;  4QKD A;  1XYN A;  2RE9 A;  4XJZ A;  1AX2 A;  1SPP A;  2EIC A;  4OUL A;  3WR0 A;  4K9S A;  1ODN A;  5E8A A;  3AJZ A;  4XC9 A;  2WWS A;  1UYX A;  3POS A;  4LKF A;  3I49 A;  4MGK E;  3ZFE B;  1VBB 2;  5FYY A;  3NKG A;  4JRA A;  3Q8C A;  5HV0 A;  5FYS A;  1D2Q A;  4YM3 A;  5LZ6 A;  2ZA9 A;  2OZJ A;  3UGF A;  1H4H A;  1DDL A;  1UW8 A;  1BVP 1;  3RQ0 A;  3VD4 A;  1WMF A;  3THT A;  4NAM A;  1DCS A;  3VD9 A;  3M70 A;  4YVW C;  2W94 A;  4GH4 B;  5F2S A;  4CXY A;  4BZ4 A;  1UNB A;  4DOU A;  4XPV A;  1YEW A;  5GKA C;  3C7F A;  2WZR 1;  4CCK A;  3ME2 A;  1VRH 2;  1ZZ8 A;  3AP4 A;  5IT6 A;  2VZP A;  2YGM A;  5A7O A;  5JOX A;  5FZ0 A;  1IQD C;  5FO9 B;  1PMH X;  2XGX A;  1KXG A;  5C4W A;  2E33 A;  3MEP A;  4L8Q A;  4N8M A;  4A7Z A;  4CDQ C;  3IPV A;  4UFI A;  4CEW B;  1HB3 A;  2ENR A;  1L7L A;  1ASJ 3;  1A6C A;  2BGP A;  4NAO A;  5KXE A;  3POJ A;  2DVF A;  3ACI A;  5F2W A;  1E5R A;  3WNN A;  5FZK A;  1X36 A;  3DEM A;  1UOF A;  1UYP A;  2HBU A;  3CMG A;  4FP2 A;  1Q8V A;  1PGL 1;  4DNY A;  2GAU A;  2NQY A;  3V0B A;  2V5Y A;  2A70 A;  5ISL A;  5BV6 A;  1CN1 A;  4FQ4 A;  2QE3 A;  2RMU 1;  3ZN4 A;  2BBV A;  3SKJ E;  4COZ A;  1YJK A;  2W1W A;  3VB9 A;  2QQI A;  5J37 A;  1H1A A;  1F5F A;  3FLT A;  3ILR A;  1XNB A;  5JIU A;  3W9A A;  2O1Q A;  4I09 A;  5GM0 A;  5K0U B;  3AZY A;  1Z78 A;  4B4P A;  4YZ5 A;  3P6B A;  5LB6 A;  4GJZ A;  2W3J A;  3QH6 A;  3VBF A;  1MEC 1;  4AAX A;  2ZEX A;  3Q8E A;  1W6Q B;  2E6V A;  4FXK B;  4HZF A;  2VTF A;  4NHY A;  3OYW B;  1O5U A;  1D2S A;  4HG6 B;  3S7E A;  1G9F A;  2JEM A;  1CAX B;  4H14 A;  3N35 A;  4JTO A;  5HCB A;  3OGR A;  2NMN A;  2X8K A;  3VV1 A;  1YIF A;  4URA A;  1OQ1 A;  1SCS A;  2XDV A;  5F1R A;  2PMW B;  1CAV A;  3W20 A;  5FYH A;  3VD5 A;  1LOE A;  2ZAC A;  3ACF A;  3DYP A;  4NHK A;  4QM8 A;  4BXS V;  3GCW A;  4E2S A;  2R30 A;  5K7P A;  1ZRC A;  1C8M 2;  1YUD A;  1O4T A;  2DVA A;  1HRV 1;  2PHU A;  4PLM A;  4Q8K A;  2RMU 2;  4ZXK A;  2WA3 A;  4NWV A;  4YZ2 A;  3WDT A;  5CFC A;  1OLR A;  4IDZ A;  3VGI A;  1EPZ A;  5IK8 A;  1REE A;  2YXS A;  3LFI A;  3OB8 A;  3R4D B;  1CAU A;  1PK6 B;  2AAC A;  2C5D A;  4AOC A;  5EPA A;  3O1O A;  3HT1 A;  4WM8 B;  5CAD A;  1KDM A;  3UKN A;  2WZE A;  3DGT A;  1RUJ 1;  3PLQ A;  4AED B;  3ZR5 A;  5FYC A;  4AVV A;  4HON A;  1VBA 3;  4ZZ5 A;  1BYH A;  4E2G A;  4FPH A;  1VRH 1;  4HVR A;  2VUJ A;  1ZZ9 A;  3ITQ A;  3AP5 A;  1PO2 1;  2W0X A;  2WZR 2;  3MIH A;  3HEI A;  5FZM A;  5BYN A;  4P5H A;  4NPM A;  2ES3 A;  4DEV A;  1BMV 2;  3THP A;  4QPI B;  5JMO A;  4P02 B;  1AZD A;  4PQ9 A;  4ZXE A;  1O91 A;  4LKS A;  5D8A C;  3JQX A;  2HWB 3;  2WSV A;  3P1I A;  4B4R A;  4F7Z A;  1O3R A;  2NLR A;  4TZD A;  4P9L A;  1UYZ A;  2ZGN A;  1Y9G A;  1W9T A;  3AYE A;  3J4U H;  2ARE A;  1Y9M A;  4LE3 A;  2AEN A;  3N4M A;  4HN0 A;  3OGJ A;  4LBL A;  3OSD A;  1JUH A;  4PI0 A;  2A75 A;  1XPW A;  3FBY A;  2G9G A;  4IND A;  4MAD A;  5LY2 A;  1WME A;  3C7E A;  3FX3 A;  2O8Q A;  3BU7 A;  1D7P M;  2C9A A;  1GV9 A;  2LM3 A;  2X10 A;  4ZU7 A;  4OVE A;  1RUJ 2;  1AYM 2;  3D4K A;  5E89 A;  3VDD A;  3ZFG A;  4MHR A;  5CFD B;  1NCQ A;  5GLW A;  4DY3 A;  3GXU A;  3ZMO A;  2ZKN A;  1YCI A;  3OGV A;  1A34 A;  1ZRI A;  2BU9 A;  4QQO A;  3ZN6 B;  1HRI 2;  5JI9 A;  3ZPY A;  4NID A;  3VZM A;  5FXZ A;  4W4Z A;  1EAH 2;  5FZH A;  1W06 A;  5LAS A;  1US2 A;  2H6B A;  3POG A;  2FQP A;  2GNB A;  4BA6 A;  1J3R A;  3RYR A;  3OUJ A;  2VMC A;  4I30 A;  3KT1 A;  4CSW A;  4CCD A;  5FCC A;  5AC9 3;  2R1B A;  3BOP A;  3I59 B;  5F9T A;  4OHW A;  4JC1 A;  2XL7 A;  4Z1V A;  5G04 L;  1QDC A;  1V00 A;  1UCX A;  3KCY A;  3I3M A;  3AFG A;  2BWC A;  2EIG A;  1HRI 1;  3LPF A;  5F3G A;  1JYV A;  3VKO A;  1RUE 1;  2R0H A;  4LOS A;  4N9H A;  1UZ0 A;  3WZ1 A;  2VC9 A;  1RC6 A;  4QAW A;  2R04 3;  5I8S A;  4M01 A;  3C8X A;  4FOY A;  3ZN5 A;  3PU3 A;  4XF4 A;  2ZX1 A;  2ZCW A;  1VAV A;  4BHP A;  1EUT A;  1S0C A;  4AR2 A;  1JYC A;  2ZMN A;  1TMF 1;  3BCW A;  3BTA A;  3MLL A;  1PGW 1;  2DYC A;  1GFF 2;  5A6Y A;  5HCF A;  2V09 A;  4LBJ A;  3H1M A;  1C5I A;  2ILM A;  1X9T A;  3NW4 A;  3III A;  4ATF A;  4HPK B;  3BYW A;  5JSR A;  1ZA4 A;  2ZHK A;  2XB6 C;  4IE4 A;  4NRP A;  2VQT A;  5GAL A;  1MS8 A;  5T5P A;  3U07 A;  1J3P A;  5K9Y A;  2RR1 2;  2BNM A;  3GZU C;  4B7E A;  2VUD A;  4NPL A;  4KWK A;  5JAX A;  4K1Z A;  5J96 B;  3SEE A;  4FT8 A;  2YU1 A;  2Y60 A;  4XF0 A;  1ZRR A;  2OX0 A;  4AGV A;  1QIQ A;  4RS5 C;  1FPN 3;  2MEV 3;  5FTT C;  3AKP A;  2FMD A;  3ATG A;  4KG0 A;  3ZO0 B;  4LBQ A;  5ABJ C;  3LIH A;  2QBX A;  5BNN B;  4Q1R A;  4Q0Q A;  3ENR A;  1JZ5 A;  2UY8 A;  3AKT A;  4SLI A;  4K8F A;  4Q0S A;  3M7A A;  2W5F A;  3P3P A;  2Y8K A;  2PHX A;  1AR8 1;  1RUD 1;  1REF A;  3D8C A;  5FZ6 A;  5FPU A;  2XLG A;  1PO1 3;  5GJ6 A;  1OOP A;  2XBO 1;  4MXW A;  1T6G C;  3J8F 2;  4JRL A;  1V6O A;  1F15 A;  1VMH A;  4DMI A;  2JKB A;  3CIH A;  3BIW E;  5CVR A;  1FMD 3;  4AK3 A;  2WQ8 A;  4GH4 A;  2Q8D A;  5A1A A;  2Y38 A;  4G4F A;  3N7M A;  4V2W A;  4OMD A;  3I2G A;  2G9Z A;  4LLF A;  4LT5 A;  2RS5 2;  1S2K A;  2G4I A;  5FZG A;  2R0F A;  2JE8 A;  1X50 A;  4Q2F A;  5KHG A;  1GZW B;  2A7A A;  3POW A;  2RS1 1;  4Z2A A;  2JG8 A;  1HB4 A;  2RDQ A;  2BOJ A;  2WT2 A;  4HFS A;  4GKY A;  1PK6 A;  1RHI 3;  3SCH A;  3WUC A;  1VLN A;  2JIJ A;  5A32 A;  5IAT A;  3FFQ A;  2VVF A;  2BTV C;  3BOD A;  1AR6 2;  2WLP A;  3M3O A;  4GJY A;  3C7G A;  5LBB A;  3WHT A;  2FDK A;  3VBS A;  4L2N A;  3M2M A;  3SEP A;  2A6Y A;  2O14 A;  2QFE A;  3BAL A;  2C1F A;  4XDP A;  2V5D A;  2ADD A;  4UXA A;  1FAY A;  4IE6 A;  3PME A;  2H0V A;  1DHK B;  2VCC A;  3Q8F A;  3MIF A;  2IVI B;  1VJ2 A;  4ERO A;  2DFC A;  2FD8 A;  4FXG B;  4UF0 A;  4CVU A;  4QPG A;  4YPJ A;  3NKT A;  4OI1 A;  1IS3 A;  2DBN A;  4WZF A;  4HKL A;  1QY4 A;  2RJK A;  2XML A;  1LOB A;  2XR4 A;  3MGU A;  1ZRE A;  1AL2 3;  2YPJ A;  1PX4 A;  5DAW A;  2OZ6 A;  1H2N A;  1KQR A;  1RVF 3;  1W6Q A;  1WCQ A;  2ZAB A;  4HN1 A;  5JVV A;  4EN7 B;  4NR1 A;  5DAV A;  2PAK A;  2L9L A;  2YBP A;  3E6D A;  3VBO A;  3UGH A;  1H1I A;  4DS0 A;  3RJR A;  2P2K A;  1WW4 A;  4MYE A;  4CDU A;  3OGS A;  4XVH A;  3RNS A;  2QVS B;  2Y6H A;  5FFO C;  3U4X A;  1YNA A;  3R6S A;  2VJX A;  1BJQ A;  1QNW A;  1V9U 3;  2EIB A;  4YW5 A;  1UXZ A;  2WZ8 A;  4L99 A;  4XHX A;  1W99 A;  4HL0 A;  4DRR A;  1F4A A;  5IFT A;  4UFM A;  1UXX X;  1ULG A;  1H30 A;  4ARX A;  3WW2 A;  3MPP G;  5JSO A;  2QQW A;  4MO3 M;  4EZ4 A;  4R4X A;  4ZKT B;  3V0A A;  2XJQ A;  3N9P A;  4LPL A;  4QPG B;  2WIN B;  4LIT A;  1DZT A;  5KXC A;  2I2S A;  5CKN A;  2VZ1 A;  2Q8E A;  2OA2 A;  4UFK A;  5IW0 A;  1GZC A;  4NHM A;  1UMI A;  5DZE A;  3KCX A;  2VAU A;  5EQU A;  4Y5S A;  3JBG 1;  4AXO A;  3APB A;  1VBB 1;  2ZX3 A;  1UZW A;  4GQ7 A;  3BGA A;  1C1L A;  1W6M A;  4PI2 A;  2XWB B;  4LBQ D;  3B7M A;  5FP4 A;  5FPZ A;  4M0H A;  3AKQ A;  3VHN A;  4QQ2 A;  2PHL A;  1UU5 A;  2QQU A;  4W6X A;  5FKB A;  2ZBJ A;  4OUS A;  2YC0 A;  3DUI A;  2D6N A;  3LDK A;  4XF1 A;  5CFC B;  4CXW A;  2VBP A;  3D82 A;  1LHN A;  3T0D A;  1W0O A;  1OI6 A;  1RXG A;  2YY1 A;  4M4R A;  4WVM B;  5DAB A;  4A2U A;  4C1W A;  1GQH A;  1VB4 A;  3HWJ A;  5FUP A;  1WZX A;  3D5O A;  3ZN6 A;  4CA9 A;  5L9V A;  5L36 A;  2P6H A;  4AGG A;  3K77 A;  2ET7 A;  3POY A;  3WV6 A;  2Y0I A;  2WO3 A;  4AFD A;  4CP9 B;  2VZQ A;  3JBG 2;  1VAK A;  1IQA A;  3X29 B;  3OBR A;  4MSV A;  2RHP A;  4UBG A;  1OOP B;  3I3E A;  1TNR A;  4RFR B;  4DIQ A;  3D6E A;  3M3C A;  4FFI A;  4IUG A;  1BK0 A;  1Y7B A;  1PX3 A;  1XNC A;  2UWC A;  4YG3 A;  1MAC A;  2RS5 3;  5FXX A;  3H8O A;  4QDR A;  2E53 A;  3RI8 A;  4EV0 A;  4RGA A;  4MET A;  1XB9 A;  3MV1 1;  3NNF A;  2JDA A;  2WLQ A;  1O3S A;  3WIN E;  5D8A B;  2R32 A;  4QPI C;  5IVY A;  5DZF A;  3J8F 1;  3GBW A;  2FZ1 A;  1RUC 2;  1URX A;  2DBI A;  3JD7 2;  1ZNP A;  4BQ1 A;  1OD5 A;  2CY6 A;  4AQ2 A;  3I2I A;  3VLB B;  3WCS A;  2GP3 A;  1X8M A;  3PU8 A;  1JYX A;  2FZ2 A;  3CL1 A;  2MEV 1;  4FCA A;  2GC2 A;  1XND A;  2B9V A;  3L2Y A;  1LNS A;  2QZ2 A;  3CU7 A;  5J98 B;  5I8T A;  2GN3 A;  1O59 A;  1L3J A;  5JXJ A;  4R9B A;  2CAV A;  3IAP A;  3ES4 A;  2Q5T A;  5GZD A;  5HCH A;  1PK6 C;  3K3O A;  5JDB A;  3QAC A;  3CJX A;  4LUK A;  1RUG 1;  5T5J A;  3ZKU A;  2RDS A;  1K45 A;  4HT1 T;  3EO6 A;  1DZR A;  4XUT A;  4A3X A;  4YGB A;  1XE0 A;  2R07 1;  3HMY A;  4UFH A;  5IK4 A;  2YBS A;  1J83 A;  4M3C A;  4XUR A;  3MLJ A;  4Q4Y 2;  3VKN A;  2AEZ A;  2WNV A;  3WQB A;  1MEC 3;  1OVP A;  2VQA A;  1PGW 2;  5A7W A;  5I0R A;  3W5M A;  3I59 A;  2ZHM A;  1TMF 2;  2K46 A;  4QHZ A;  1WA6 X;  5FAX A;  1F9K A;  5KHH A;  3PIJ A;  1UZZ A;  3VDD C;  1N1V A;  5FZ3 A;  1BEV 3;  3VBS B;  4HPK A;  1R08 3;  1AR6 1;  2R16 A;  3S7I A;  4JVA A;  2QTW B;  1WMD A;  4YVW B;  3VBO B;  4D6Q A;  2RS1 3;  1ZA7 A;  2Y64 A;  1W6N A;  1MVE A;  1NLS A;  3O1R A;  2EF6 A;  5CIS A;  2VW1 A;  1R09 2;  1K3I A;  5C6C A;  3P5B A;  2HWF 1;  5ACA 1;  1STM A;  2OPW A;  2XJU A;  1G9B A;  5A3W A;  3ACH A;  1MS4 A;  3LSD A;  4NIG A;  3AP6 A;  5BNO A;  4Z07 A;  2JDH A;  1ASJ 1;  1B35 B;  1SDD B;  3B3Q E;  3N36 A;  4H7M A;  4BJ0 A;  4BH9 A;  4RGK A;  4E4D X;  1TME 3;  2D6K A;  4AVS A;  2PAE A;  4J25 A;  4G9S B;  5JXH A;  5L7O A;  2WFF 2;  1LUL A;  1QXR A;  4AFA A;  2BNO A;  1ULO A;  2JG9 B;  5HCA A;  1US3 A;  5A32 B;  2VU9 A;  1GNY A;  1NQD A;  4KH9 A;  5DDJ 1;  1CQ9 A;  5BNN C;  2YHJ A;  2P3I A;  3ACG A;  1OBN A;  1Q8S A;  3BVC A;  2D7F A;  2VEC A;  3VBU A;  5C8C B;  1AF9 A;  2GND A;  1A8D A;  3AP7 A;  4FFH A;  3ORJ A;  2VQU A;  2ZZJ A;  4O65 A;  4QXH A;  2YDE A;  3ETP A;  4C1X A;  5A3N A;  2CWM A;  4OHV A;  4JKL A;  4Z82 A;  4CDQ B;  4D6R A;  1X7N A;  3HNY M;  1W6N B;  3MPB A;  5AVA A;  1YFX A;  1OPO A;  1Q56 A;  2BP6 A;  2JIG A;  2GZW A;  2R07 3;  5JI7 A;  1W03 A;  1WA4 A;  5EYY A;  3A7Q A;  1XBF A;  1VP6 A;  1SMV A;  4D8M A;  1PZ9 A;  1ONA A;  2VZV A;  2YMZ A;  3KVB A;  1JZ4 A;  3OD0 A;  4BQW A;  5EJ3 A;  2HJI A;  2WRA A;  2XG3 A;  1CWP A;  2TUN A;  2WDB A;  1AYN 3;  1CZV A;  3NNG A;  2JB8 A;  3UES A;  3WCR A;  4KBB A;  4XUQ A;  3A0K A;  1LOG A;  4C91 A;  3WNK A;  2IVJ A;  2QQM A;  3J7M A;  1NY7 2;  2WWJ A;  1N1T A;  5IK5 A;  1Q8Q A;  4QT6 A;  5L19 A;  3KB5 A;  3RYP A;  1C5H A;  1PO2 2;  4FPJ A;  4CEY B;  1VBE 1;  2CL2 A;  4JGZ A;  3RZM A;  2BFU S;  4QKN A;  2XOM A;  2DCT A;  4ISR A;  2JG8 C;  5DAP A;  1PZ7 A;  4D94 A;  4ET7 A;  3SIS A;  4EWE A;  3KV9 A;  5FY0 A;  1DGL A;  4Y33 A;  1ZRF A;  3MID A;  4HK9 A;  3R4S A;  5LBE A;  5E16 A;  1UQX A;  1I5Z A;  5FMB A;  5FYV A;  4YW7 A;  3VZL A;  2XQX A;  3LIG A;  3AK0 A;  4IW3 A;  5FZ1 A;  1SAC A;  1W39 A;  5FYB A;  4D7T A;  3AMM A;  1TNF A;  2V72 A;  4EJR A;  5JOY A;  2J1E A;  1PMJ X;  1JZ6 A;  4RSU A;  1QH6 A;  4CCM A;  3MDP A;  1HRV 2;  4QDS A;  4QXB A;  3OBT A;  1ND3 C;  2OVU A;  1JMU B;  3USU A;  1JYW A;  2WR9 A;  1JYN A;  3HVD A;  1QJX 3;  1HW5 A;  4YVS C;  2VVD A;  3QCW A;  5FP8 A;  4BMB A;  1WD3 A;  4CUC A;  5LA2 A;  4MH0 E;  4GWN A;  2EXI A;  3DYO A;  3ZIW A;  2E26 A;  4JGY B;  2YFU A;  3CJI A;  3BPS A;  4XJ9 A;  4A41 A;  3CEW A;  4IEV A;  2VZR A;  5FKC A;  1FAT A;  4ARY A;  5T50 A;  2D98 A;  2NMO A;  3WY6 A;  1UY3 A;  4P9J A;  4QPW A;  2JDN A;  2RS1 2;  2YC4 A;  2P6C A;  3IIA A;  5FZ8 A;  4CRQ A;  5EJ1 B;  1LES A;  5TSW A;  3I2D A;  4P9Y A;  4YZ3 A;  1VBB 3;  3IKW A;  2CYF A;  2BBA A;  2UWB A;  4RR3 A;  1IS5 A;  1MS9 A;  2ERF A;  3JUU A;  4PIY A;  5F6K A;  3VKF C;  2WQ4 A;  4UBH A;  1Q8P A;  3WNL A;  5JMC A;  1TME 1;  4Q4X 2;  2HWE 3;  2A73 B;  4LHL A;  4PT6 A;  5FZE A;  3OBZ A;  3U78 A;  4LBN A;  4CPB D;  2XXZ A;  1OA4 A;  3PNA A;  5F3C A;  5IFP A;  2A1X A;  3E6B A;  1WCU A;  2XBO 2;  1PGL 2;  1LHV A;  1ZM1 A;  2WNV C;  4ISQ A;  5AC9 1;  2WFF 3;  1M4W A;  3ZXG A;  1AR8 2;  4CUB A;  5BNO B;  5LEJ A;  2Y6G A;  1MQT B;  3B9C A;  3CO2 A;  4AVA A;  4AQT A;  4DO0 A;  1JI6 A;  2WKK A;  1NA1 A;  2W9X A;  4NWW A;  2J1S A;  5EWS A;  1UY0 A;  2A6W A;  4KI5 M;  4KG8 A;  2DFB A;  1HIX A;  4ZON A;  2GH2 A;  4H2A A;  1DGR A;  1Y4W A;  2GC3 A;  4XUO A;  4HXC A;  1QXJ A;  3OJB A;  5C8C A;  1RUO A;  2LTN A;  3B93 A;  4BDV B;  4JHT A;  3NV1 A;  1G7Y A;  1ENR A;  2WO1 A;  4FFG A;  4W6W A;  1OQD A;  3QBQ A;  4Q4X 1;  4XFB A;  5FQ0 B;  3ZDV A;  2WO7 A;  3DV8 A;  1ZX5 A;  1C8M 1;  1TMF 3;  2XWJ B;  1NYW A;  2YBK A;  3I2J A;  1SPP B;  2AH2 A;  1W2N A;  5D2A A;  1HX6 A;  1W2U A;  2JXA A;  3GGL A;  3KHC A;  3WOG A;  1QMJ A;  2PHT A;  5CNA A;  1AJK A;  4IEX A;  1YRZ A;  4JDO A;  2HWB 2;  3MFC A;  3THD A;  1YWK A;  1HN0 A;  2UU8 A;  1DIW A;  4BE3 A;  1GWK A;  1JTZ X;  3ETQ A;  4TTG A;  4XBL A;  1H8T A;  2ARA A;  2VXR A;  3SQO A;  2BOI A;  2GME A;  5EZW A;  3J9S A;  5KWR A;  4P9W A;  3VBU B;  5EV7 A;  3FBM A;  1NCR C;  3I2H A;  3VDB A;  4H7L A;  5GZE A;  4UFJ A;  1TE1 B;  5FO8 B;  1RUE 2;  3ILN A;  3OTF A;  4IV1 C;  2W92 A;  5KHK A;  4R52 A;  2D3R A;  3FL7 A;  1RIT A;  5CU1 A;  4YWA A;  2OQ6 A;  4XF9 A;  3H7Y A;  3T2T A;  4DXR A;  5H9S A;  3VBR A;  5CIR A;  1COV 3;  3T4H B;  1UMZ A;  2VNV A;  4N53 B;  4ZS3 A;  5GLV A;  3WW1 A;  3VBF C;  2ARX A;  2CDP A;  1NAE A;  1XRU A;  2VBB A;  2WNV B;  1HRI 3;  4AZZ A;  4UOJ A;  2P3K A;  4MX3 A;  1LGC A;  2Q1M A;  4JV4 A;  2JB4 A;  4C90 A;  2RMU 3;  1PNF A;  3K48 A;  1TQ5 A;  4Y1X A;  4Y24 A;  3I2F A;  1DFQ A;  1DZQ A;  3SCG A;  3DEC A;  1L7Q A;  1AYM 1;  4W8J A;  1UWW A;  4COY A;  1JHN A;  4GUL A;  4ASM B;  1OUX A;  1R1A 3;  3LE0 A;  2EAA A;  3SIT A;  4Q5O A;  1QF3 A;  2B7Y A;  1SZB A;  4AHX A;  3WDU A;  1UIK A;  4CCO A;  4LO5 B;  2KR2 A;  2CWS A;  4ITC A;  5BUV A;  4GH4 C;  1V6N A;  1V6L A;  3VBH C;  4DQA A;  3AX4 A;  3N9L A;  3BUC A;  1QHD A;  4KWU A;  2GH8 A;  5DUX A;  2FCV A;  1JZ7 A;  2H0B A;  2BNN A;  4OZO A;  4EYU A;  2VCA A;  1ND3 A;  4LIU A;  2P17 A;  3AMQ A;  1SBD A;  2MPF A;  1HQL A;  2ORX A;  3LOI A;  3BI3 A;  4XCA A;  4YVS B;  2WAB A;  2XUM A;  3VDC A;  3JB8 A;  1KFU L;  4FPG A;  4Q4W 3;  3ECQ A;  1ZBE 3;  1Y43 B;  5GZF A;  3ZYJ B;  2B39 A;  5JR2 A;  5I8Y A;  3MV0 1;  1GQP A;  3U4S A;  4SBV A;  3VHR A;  3BPZ A;  2GN7 A;  3WQ0 A;  4GA9 A;  1CR7 A;  1WBL A;  4IEP A;  4NIA A;  5KXB A;  4K8R B;  3GZT B;  3VL9 A;  1F4H A;  1Q43 A;  2PN5 A;  3LD8 A;  5E1R A;  4CCN A;  4S2G A;  3ILF A;  4CCJ A;  1UX6 A;  1FPN 2;  2ZPX A;  4DFS A;  3VZJ A;  3N7L A;  4JKM A;  1W04 A;  1NLQ A;  1YI9 A;  1EV1 2;  4ASK A;  4YFZ A;  3NO8 A;  2A3W A;  1CAU B;  2XL9 A;  1IG3 A;  3IPV B;  4CEW A;  3MW4 A;  5A33 B;  1NLR A;  5BNN A;  1GU3 A;  1OFN A;  1H2K A;  2VMG A;  2Q8C A;  4I0A A;  1E5I A;  2E63 A;  1JZ2 A;  3UNP A;  1XQN A;  4FPF A;  4Y1U A;  2WS9 2;  3AZX A;  4E4S A;  1ASJ 2;  5LBF A;  3ZYI B;  3ZYP A;  3I7D A;  3RVH A;  1HQN A;  1X8E A;  2GDF A;  4OFG A;  4ORF A;  1JXN A;  2BDR A;  3ZFF B;  1CZT A;  1GIC A;  1D4M 2;  2IZW A;  2WT0 A;  1APN A;  4O9E A;  1CJD A;  4QDQ A;  3T0B A;  5HXV A;  2BGO A;  3K75 B;  2Y26 A;  1ACC A;  2F17 A;  2QUO A;  1H2M A;  1MS0 A;  3NNL A;  1YYN A;  3AVR A;  5A7W B;  2Q1F A;  3ZSK A;  1B09 A;  4LO6 B;  4AI9 A;  4MG2 A;  3L9J T;  4Y4Y A;  1NA1 B;  1NZC A;  4FOQ A;  4YFW A;  3W58 A;  4D6S A;  4YVW A;  1W8O A;  1ZZC A;  3LEG A;  2J42 A;  2O8O A;  3AYD A;  1JBC A;  4OI2 A;  4W65 A;  3AB0 A;  3WLU A;  4E4Z A;  3OG2 A;  5FZA A;  3KSC A;  3KT4 A;  3SCF A;  1ZZ6 A;  1GBG A;  5FIX A;  2ZZQ A;  3LEK A;  3M3Q A;  3GZE A;  1OF3 A;  3HT2 A;  2KM2 A;  1RUG 2;  4M4P A;  1VBA 1;  5FRE A;  1T2X A;  4AYU A;  3FN9 A;  5EJZ B;  1H6X A;  3E5X A;  4JQR A;  3LZZ A;  4YRD A;  3RGB A;  5BY5 A;  1JYT A;  4EZH A;  1QJX 1;  4BOW A;  1NUK A;  2LUW A;  3W59 A;  1W9S A;  1AL0 G;  4HSL A;  4BQ3 A;  3TEW A;  5CZK A;  4ONU A;  5FYI A;  5FPL A;  5G05 L;  4HAN A;  1FV3 A;  1R64 A;  4XJU A;  4CP2 A;  1B35 C;  1PVX A;  1WLC A;  2MEV 2;  2Q4S A;  4YG0 A;  3OOX A;  3LEI A;  1RUD 3;  5B4X A;  3VBU C;  3LWC A;  4LBQ B;  4AI1 A;  4FBF A;  2VE1 A;  4N43 A;  3ZSJ A;  2XHK A;  4U36 A;  2IXC A;  1AR7 2;  3HN1 A;  1F2N A;  3MHZ A;  4RHV 2;  4ZU5 A;  3ZKY A;  5J3U A;  2OXB A;  5SV8 A;  4BQ5 A;  2IC1 A;  5LA1 A;  2D43 A;  3E1F 1;  3LOB A;  1NKG A;  2Y33 A;  4HK8 A;  5CKM A;  3JCI A;  2JEC A;  2K9Z A;  4UWD A;  1R1Z A;  3T1M A;  1BBT 1;  3J8F 3;  4YW4 A;  4LQR A;  2IFR A;  5T55 A;  5FZI A;  3R4U A;  1JHJ A;  1PGS A;  4P08 A;  1LEM A;  2R04 2;  5A7P A;  2HYX A;  1V6I A;  4P00 B;  4XF3 A;  4Y22 A;  5C3R A;  3C7O A;  2WZR 3;  1UPI A;  4GWJ A;  3RJ2 X;  3LB9 A;  4J1W A;  4LEJ A;  2A71 A;  1SHW B;  4EWD A;  5APA A;  1QKQ A;  2B42 B;  2F6B A;  4LLO A;  1GZW A;  1Z0H A;  3HQU A;  2GP5 A;  2LRP A;  1RUN A;  3RMX A;  5EHD A;  1KD7 A;  1HXS 2;  4QQH A;  1XSQ A;  5LA9 A;  1VBC 1;  4QB2 A;  1RUI 2;  2X5I B;  1WW7 A;  2B45 X;  3HAG A;  3G7D A;  1QJY 1;  5B4N A;  1Z7S 1;  2DU1 A;  1WCD J;  5FZO B;  1WGP A;  1WW5 A;  3AYA A;  2Z2S B;  3UET A;  2GMM A;  4FPC A;  1WWY A;  4MGT A;  1BZW A;  3MW3 A;  1FT9 A;  4FI9 A;  3VKL A;  2VY0 A;  3POE A;  3PJQ A;  2KXL A;  5GLU A;  2W91 A;  1JYI A;  5FY5 A;  4DUX A;  3WNM A;  3FE5 A;  5M0T A;  5LRR A;  3Q8B A;  3QLQ A;  4IE5 A;  1AR8 3;  4PIZ A;  4XUP A;  4NMI A;  2V73 A;  2DUR A;  3GZA A;  3PUA A;  1RUJ 3;  5FZ4 A;  4NUB A;  4X8P A;  1AYM 3;  4P9G A;  5A3L A;  4HVQ A;  4LNV A;  1VE0 A;  3DXT A;  2YFZ A;  1VAL A;  4O9G A;  2AR6 A;  3ES1 A;  1H9W A;  4R8H A;  3RWN A;  3TN9 3;  4YW3 A;  4LR4 A;  5FUN A;  5FWJ A;  3RYK A;  4XW3 A;  2JD9 A;  4MUV A;  3WP5 A;  1DP0 A;  4DIN B;  3TEY A;  1D4M 3;  1H6Y A;  1NE4 A;  1VR3 A;  1XU1 A;  2JIC A;  5LEK A;  5I0D A;  4ZY9 A;  4JGY C;  3RPQ A;  2B4K A;  2YG0 A;  4NVP A;  5J7M A;  3S5Q A;  4D7S A;  5F5A A;  2Y34 A;  2SLI A;  2FDJ A;  1A3K A;  1N1Y A;  3NAP A;  4HSJ A;  2JWP A;  4MGS A;  1V9U 2;  3OPT A;  1I9R A;  5A80 A;  2ZEY A;  3LAG A;  1ZYB A;  2VBD A;  1H8V A;  5LK7 B;  5D8A A;  1VBD 2;  3UKV A;  4IV3 C;  2VPV A;  2R7E B;  1Z7S 2;  1N1S A;  2PHR A;  4XJ8 A;  3PJY A;  4FPE A;  2WBK A;  3AYC A;  1KRI A;  4XFG A;  5F5C A;  2PHF A;  3GNE A;  3O5S A;  4ZU4 A;  2WNU A;  4B4Q A;  4YW6 A;  1UAI A;  4JQT A;  4PBP A;  1EV1 3;  1QH7 A;  3M3I A;  1FMD 1;  2XHN A;  4GZ9 A;  1COV 2;  4BB3 A;  5JOZ A;  4RN5 A;  5IVB A;  2QDR A;  1BEV 1;  1UY4 A;  1DQ2 A;  1V6K A;  3WDY A;  4TSV A;  2X05 A;  2BUK A;  4FFF A;  5FBZ A;  5FMO S;  5LBC A;  4ZZ8 A;  3GJA A;  3R05 A;  4NE9 A;  4XIL A;  4GB3 1;  3ZYB A;  1GWL A;  4FPO B;  1LOA A;  5JR7 B;  5C70 A;  3VHP A;  1XNT A;  3U10 A;  4NII A;  4BQ2 A;  3NAP B;  2ZGO A;  4IV1 A;  5C9A A;  1XE8 A;  3OD4 A;  3KD4 A;  3PDQ A;  2UY9 A;  3DKQ A;  1S0I A;  3WSO A;  1GOF A;  1R08 2;  3A23 A;  1ZVF A;  1PIV 1;  4E2Q A;  1PM4 A;  3J7H A;  4JDM A;  1XYP A;  3NST A;  4Q4W 1;  4QKF A;  1PVC 1;  3S6P A;  3HPN A;  2IXJ A;  2P34 A;  1CAW B;  2JE9 A;  5DUW A;  3QD6 A;  4RS5 A;  1O7F A;  1A8M A;  4FTS A;  4NIH A;  2PYT A;  2AYH A;  3NV2 A;  3DXU A;  3QOP A;  3ZSL A;  3ZXJ A;  1V0A A;  1W9W A;  2O0O A;  3V0A B;  4QB6 A;  1XC6 A;  2J1R A;  2W1S A;  5F37 A;  3AMH A;  5A33 A;  3N9N A;  2ZGQ A;  3C2U A;  4TLG A;  1AR9 1;  2ZJC A;  4GMP 1;  2JEN A;  3N7K A;  3O12 A;  1RVF 1;  4FAH A;  2CGP A;  1O6U A;  2DCJ A;  2D44 A;  4IL7 A;  2FCU A;  4PJY A;  5AFE A;  2E9Q A;  2PXJ A;  2GC0 A;  1UZY A;  4MLO A;  4O7X A;  1RUH 1;  4R9A A;  1XNK A;  4BM8 A;  5J1X A;  2Y0O A;  3ABZ A;  3KV5 A;  2K0G A;  2XLA A;  4PDW B;  3NWK A;  2YPD A;  1V6M A;  3EQE A;  4KQ7 A;  4CDW C;  3E5Q A;  3WDV A;  1MZ5 A;  3I54 A;  1S2E A;  1O3Q A;  2FMY A;  3OF1 A;  1IKQ A;  1OH4 A;  1QJU 2;  5C71 A;  2ZEZ A;  2HWC 3;  3V64 A;  1BK1 A;  4LO4 B;  5F5Q A;  3FLR A;  1UKG A;  1O4Y A;  5FOB B;  3DF0 A;  3UJO A;  1CVN A;  1R1A 1;  1SFN A;  1LEN A;  5EYX A;  4AEJ A;  5JCT A;  5KBF A;  3Q9O A;  1JOP A;  2VVE A;  1NZI A;  4H55 A;  2CAU A;  2JG9 A;  3T3Y A;  3JBG 3;  4XFF A;  4QX3 A;  2AEY A;  1TZO A;  2LAL A;  3A21 A;  1GP5 A;  2HBT A;  1C8N A;  2IFW A;  5EXO A;  1CX4 A;  4IEQ A;  4RFT 0;  1S0D A;  3NL1 A;  1H1M A;  2A3Y A;  1SLA A;  3LGR A;  3VZK A;  4AED A;  2K2S A;  3ZOI A;  5A6X A;  4Y1V A;  1S0B A;  3BTX A;  1FYU A;  2QZ3 A;  2XJT A;  5CG8 A;  4CEY A;  1ULC A;  1HXS 3;  2VMD A;  1GSL A;  3OGG A;  5FUI A;  1SCR A;  1QJF A;  4AG4 A;  1LCL A;  2XVK A;  3U14 A;  2RV9 A;  3K3N A;  1ODM A;  3O14 A;  2OUH A;  3RWK X;  5DMY A;  1HB1 A;  2PLV 1;  1L7R A;  3WF4 A;  4CP0 A;  2G1M A;  2JDK A;  4NOT A;  2CU5 A;  2JG9 C;  1GR3 A;  2CDO A;  2DDU A;  3T1L A;  1W8N A;  1JOJ A;  5H9Q A;  3GAL A;  4AI2 A;  1LEC A;  2X5I A;  1GNZ A;  3I4I A;  3MFA A;  4MHU A;  4A6S A;  4QU2 A;  1UPS A;  5JPM B;  1I5P A;  3B94 A;  3SHR A;  2R06 3;  1FXZ A;  3IN9 A;  2D6M A;  4QGN A;  4Y3O A;  3T2O A;  2AC1 A;  4KGG A;  3ZXE A;  3D3A A;  4MGQ A;  1YQ8 A;  3KQR A;  4LA2 A;  2RS3 3;  4Y22 B;  1ZBA 2;  5FY1 A;  2OII A;  3O7O A;  5I0T A;  1VMF A;  3B02 A;  5GLZ A;  1QGL A;  3MIB A;  3VBO C;  3PVB B;  2XUE A;  3HNM A;  2ZGP A;  4FPY A;  1H4G A;  1JUI A;  3LA7 A;  1AR7 3;  4RHV 3;  5FZC A;  3KWV A;  2VMI A;  1RJ8 A;  3LA2 A;  4CTE A;  5C5T A;  5I91 A;  4F83 A;  1MS1 A;  2P3J A;  3AZV A;  5B2G B;  2DUO A;  1PNG A;  1IPK A;  1OHF A;  4L92 A;  1RHI 1;  5DUV A;  5FMD A;  2DU0 A;  2TBV A;  3U75 A;  4F8A A;  1UOG A;  2I07 B;  2WII B;  4FOW A;  4IEY A;  4WVW A;  1XU2 A;  2XLF A;  4EN8 B;  5IYY A;  1F8V A;  3WVJ A;  3ZLI A;  4KNC A;  4WM8 A;  3H3U A;  1EY2 A;  1LJ7 A;  2GSY A;  2RJL A;  3DL3 A;  4GWM A;  4JDN A;  4CUG A;  1I1E A;  1NCQ C;  2EA7 A;  3M1H A;  3OUI A;  4XBQ A;  3WX5 A;  4PF1 A;  2GNM A;  2W1Q A;  5E6H A;  3TYJ A;  5KXD A;  3S5A A;  2Z5W A;  1OMI A;  3FLP A;  4XIK A;  1QQP 3;  3ZXF A;  1OKQ A;  2VTX A;  3O1S A;  2HWE 2;  3SH5 A;  1LAJ A;  1LGB A;  1C3H A;  1QOO A;  4AL9 A;  1KDK A;  4AVT A;  1J59 A;  1H8T C;  5BNO C;  4Y4R A;  5IWF A;  1MZ6 A;  1UY2 A;  3INA A;  2W52 A;  2MNG A;  2VD7 A;  2EXJ A;  4QPY A;  3ZSM A;  4OQ8 A;  1RUI 3;  3BU0 A;  2QQO A;  2ZGR A;  3POF A;  3V56 A;  5CFD C;  3AJY A;  2UYA A;  4LBK A;  1PO1 1;  3AM2 A;  4YW1 A;  4AFM A;  2WT1 A;  1GOG A;  1CJP A;  3TN9 1;  2CTV A;  3CDZ B;  3SXW A;  3HR9 A;  5T5O A;  3B00 A;  1OPM A;  1ULD A;  2PFW A;  3H0O A;  2E31 A;  2A6X A;  2BQP A;  4GIQ A;  3OUH A;  3K46 A;  4XOG A;  1POV 1;  2HWC 2;  2VOW A;  2CNA A;  3DPR C;  4QQP A;  3ZYG A;  5GZG A;  3RZH A;  4EE2 A;  1LU1 A;  2VMF A;  1X9P A;  1IS4 A;  5F3E A;  4UAP A;  1S55 A;  1WW6 A;  2P37 A;  4QPI A;  5C4W B;  3RZG A;  5DXD A;  1OOP C;  2JDZ A;  3AZW A;  4ES8 A;  4YGE A;  1IS6 A;  4AQ6 A;  1CIY A;  3TN9 2;  4UI9 L;  4AW7 A;  4RGG A;  1XXN A;  2VR4 A;  4YG6 A;  1F5J A;  4HLT A;  1Y9Q A;  1UO9 A;  1AYN 2;  2Q0A A;  2QDN A;  4XFC A;  5C8W A;  3GBG A;  1MEC 2;  4AE2 A;  3CZU A;  3CKH A;  1JZ8 A;  5F7U A;  4XJA A;  4AI0 A;  5JLV A;  3NJV A;  5C3S A;  4IGP A;  1FV2 A;  2WO2 A;  4XHB A;  1D0G A;  4AED C;  1CPM A;  2HWE 1;  1CZS A;  2PLV 3;  3KV6 A;  4OUE A;  3CNA A;  1PMI A;  3WP6 A;  5CKQ A;  4DY5 A;  4IES A;  2E32 A;  1UOB A;  3NMB A;  2Z42 A;  4D0Q A;  4I2O A;  1W2T A;  2JX9 A;  4QKB A;  2W46 A;  2BYV E;  5GZC A;  5LW9 A;  3KS7 A;  2I45 A;  2G19 A;  3EJK A;  3OCP A;  4G3Y C;  1PVC 2;  1HLC A;  1LB2 A;  3IB3 A;  3VBH A;  4RQP A;  4QX8 A;  4E8D A;  1U5I A;  1YHF A;  1DGW A;  1PIV 2;  5K4L A;  4LO8 A;  3KGZ A;  5FZO A;  4A44 A;  3WG4 A;  2EVX A;  3OEA A;  4XCB A;  4NRO A;  3TWI A;  4CEY C;  3F95 A;  4L9B A;  4AVB A;  5DUU A;  1F31 A;  4CCL A;  4OZX A;  4UW4 A;  4XJW A;  2YC2 A;  2WAO A;  1ZRD A;  3EYP A;  2RDR A;  3HD8 B;  1OXC A;  2P3Y A;  3LQC A;  3THC A;  2HLE A;  1W90 A;  1LRH A;  4XAE A;  3E6C C;  4K6B A;  4YLZ A;  3ROU A;  3U11 A;  4XIO A;  4CYD A;  4LKD A;  5FMC A;  2WNE A;  1TVG A;  3NJZ A;  3FHA A;  3LF7 A;  4R4Z A;  1XE7 A;  1QJE A;  2BRT A;  2EIE A;  1AXZ A;  3PUS A;  1FMD 2;  5HXM A;  4BU2 A;  2VUL A;  2RDN A;  4XQW A;  3UGG A;  5K0U C;  4LO7 A;  5FZL A;  1OH3 A;  1YI7 A;  2CHH A;  2VME A;  4KU8 A;  4RL7 A;  1AR9 3;  1GLH A;  1RTV A;  2PAM A;  4N90 A;  2Y6F A;  4A6O A;  2BJS A;  2E7T A;  2YU2 A;  1QJY 3;  1OA3 A;  2ZML A;  4NO4 A;  3URF A;  2HEV F;  4B3N A;  5A6Z A;  1K5J A;  1QOS A;  1KFX L;  2ZAA A;  3GJB A;  1ULE A;  5FYM A;  5C3O A;  2GU9 A;  2YGL A;  4Q0U A;  2WAA A;  4ASL A;  1Q8O A;  1VBD 1;  4XAC A;  1LOD A;  1U5X A;  4NHX A;  4R9C A;  1JS9 A;  2BFU L;  2D97 A;  1XJA A;  2HWD 1;  3OY8 A;  4AVC A;  3UL2 A;  4TXW A;  4Y5T A;  1G9A A;  4AGR A;  5FY7 A;  2XON A;  4COV A;  2PTM A;  3RMY A;  1HDK A;  1WUV A;  3GDB A;  4QMA A;  1GMM A;  4IE0 A;  5ERL A;  3ZX7 A;  1AHS A;  3RDI A;  1IPJ A;  1NY7 1;  4A7K A;  1NQJ A;  5C3P A;  2G9F A;  3RRD A;  5FYU A;  3FZ3 A;  3H1Y A;  5FBJ A;  3OPW A;  2B9U A;  5EFU A;  2X53 S;  4N43 C;  4CDW A;  4PLO A;  3USU B;  3SLI A;  2WS9 3;  1ZBA 3;  2YUE A;  4FVV A;  1UOJ A;  5I0U A;  1UF2 C;  4CZS A;  4UW6 A;  3WF0 A;  5A3P A;  5A1L A;  2EID A;  2BVV A;  2ZX0 A;  1AJO A;  5ANQ A;  3VDD B;  5CFD A;  3AMP A;  5F3I A;  2ZGM A;  4Q0V A;  5FOJ B;  1BHG A;  4FSJ A;  4MGI E;  1FOD 1;  1W6P A;  2YV8 A;  1NG0 A;  2XKO A;  3MYX A;  1ALY A;  2IXH A;  2YYO A;  4E8C A;  3AZZ A;  3ON7 A;  1C4R A;  4XET A;  2ZX4 A;  2WYF A;  3JB4 C;  3S30 A;  3WD5 A;  3TAY A;  4QX5 A;  2YB7 A;  3WNX A;  1CX1 A;  3DPR A;  3O1T A;  4K3U A;  3FFZ A;  5DZG A;  3O1U A;  1W6O B;  5FZ9 A;  2F4P A;  2JDM A;  4AF9 A;  4I3G A;  5JZG A;  1E5S A;  3TEZ A;  2LS6 A;  4RR3 B;  1X82 A;  5ABJ B;  5FXV A;  2YRO A;  1U5Y A;  3RG0 A;  3DN7 A;  3LEM A;  3VZO A;  5EIY B;  4URT A;  3JXS A;  4RS5 B;  3W5N A;  4CDU B;  1UMH A;  1T6B X;  3HQX A;  1SFP A;  3HN3 A;  2FDG A;  3UKT A;  4QD2 A;  2XQR A;  1RUG 3;  2ZGS A;  3H7J A;  5FLJ A;  4Z2W A;  4N53 A;  4U2A A;  2W87 A;  3OEB A;  2W1U A;  5FPV A;  4QXC A;  4Y20 B;  1S2B A;  4Q4V 3;  1IHM A;  2RM2 2;  3T2Q A;  3VHO A;  3ASI A;  4BLJ A;  4FTE A;  3F2Z A;  2EAL A;  2VCB A;  2DWR A;  5FMO L;  2QNK A;  3KHB A;  2V4A A;  2NN8 A;  3K51 A;  3DKW A;  3PTY A;  4IGO A;  3LCP A;  3WF1 A;  3IMM A;  4P9X A;  1O4Z A;  2DUP A;  2A6V A;  3GF6 A;  4YVS A;  4DRV A;  2RM2 1;  3NAP C;  5FPA A;  1BQP A;  3DPR B;  4HKO A;  1AXY A;  4JZR A;  3PIG A;  4Q4Y 1;  1R1A 2;  4GMP 0;  3BTZ A;  4CU7 A;  4XFH A;  4XFI A;  4LBM A;  4BQY A;  2TNF A;  3PVO A;  5CYY A;  2JDU A;  5FLH A;  5KHJ A;  2VH9 A;  3AXE A;  4AQS A;  5A3U A;  1J1L A;  1PHM A;  3R0R A;  2H6C A;  1DQ5 A;  1QJU 1;  4YZ4 A;  5FP3 A;  4GKX A;  2B46 X;  1OQE A;  4M00 A;  4V1P A;  2C9K A;  2VZT A;  1KJR A;  2Q30 A;  4IER A;  3EB7 A;  5CFC C;  4YSF A;  3H9A A;  4MXW B;  4OQ9 A;  2VXJ A;  1H8T B;  4WM8 C;  2VOK A;  1RUF 2;  2W2I A;  3GCX A;  4L11 A;  4LUL A;  4ZPI A;  1DBN A;  4C0H A;  5IAX A;  5FZD A;  3ZFE A;  1RUF 1;  2P4E A;  1ZBE 2;  1ZZB A;  2ZAH A;  1RUC 1;  5FO7 B;  3UK9 A;  3KT7 A;  3N3H A;  4CU9 A;  1CPN A;  3JD7 3;  4HET A;  2ATF A;  2OT7 A;  3ZM8 A;  2FDI A;  2J1T A;  1KS4 A;  1W2O A;  2J1V A;  4BK4 A;  2NP0 A;  3T2P A;  1RUE 3;  2WQZ C;  2LRO A;  4DXZ A;  4QU1 A;  4D7Y A;  1OT5 A;  5BNP C;  1KGY A;  3VZN A;  3BIE A;  2VG9 A;  5IVE A;  4KMQ A;  3MIG A;  3WHU A;  1POQ A;  3WQ1 A;  1MVQ A;  4IQP A;  3SKV A;  3DYM A;  3HJR A;  1DLC A;  4JKK A;  3VKM A;  3K4D A;  5IVC A;  3BTY A;  4XQD A;  5DAQ A;  4EN9 B;  2ZHL A;  3AKR A;  3S0M A;  1GWM A;  1SBF A;  3WG3 A;  4IE7 A;  2OPK A;  4Q4Y 3;  1W28 A;  3MZH A;  2NZ9 A;  4Q0P A;  2AUY A;  4OI0 A;  4E4H A;  3IM0 A;  3MBW A;  4UF0 B;  4XAB A;  4OUM A;  4COU A;  4A7Y A;  1AVB A;  1JH5 A;  3EXU A;  4YW2 A;  3LKJ A;  4HOO A;  2C24 A;  2D40 A;  1BEV 2;  2D3S A;  1OD3 A;  2QQK A;  4KWL A;  5LAT A;  4K20 A;  2JDY A;  4CDU C;  1YLL A;  4RD7 A;  5L7O C;  5T5L A;  4MVT A;  4WVV A;  2VOX A;  3IDC B;  4IXL A;  2E51 A;  3VL8 A;  1NXM A;  2ZTN A;  3A0N A;  4J6G A;  3GBF A;  4V2V A;  5FK8 A;  1QOT A;  2WWU A;  4N9I A;  4OLL A;  1OVS A;  1ND2 A;  2DCK A;  2JJ6 A;  3E97 A;  1HKD A;  1SLB A;  4UYB A;  1AXK A;  2VCM A;  3MI8 A;  1UIJ A;  3B01 A;  1Z7S 3;  4JCK A;  4PIX A;  4Q1P A;  4YM0 A;  5FZ7 A;  2JD4 A;  5FP9 A;  1CES A;  4B1M A;  3H1W A;  3HBK A;  1W6O A;  1W6M B;  3W21 A;  4I02 A;  2JE7 A;  2Y6L A;  3OBA A;  2QQP A;  2R04 1;  3AXD A;  1XNA A;  5C5U A;  4CUA A;  2D5F A;  4L0P A;  3RI9 A;  5C9A C;  3PVN A;  1K5M C;  2WYS A;  1VRH 3;  4J1X A;  5FY9 A;  4CDX C;  1KJL A;  1W8W A;  3CBN A;  1EUU A;  4IGQ A;  5CBL A;  5FPX A;  4QQL A;  4JX0 A;  4XE9 A;  5I0S A;  1C8M 3;  2GAL A;  4AFB A;  4WVM A;  1CGP A;  2R6Q A;  1PIV 3;  1I6X A;  3CLP A;  3OY8 B;  1S0E A;  2QQL A;  2ARC A;  1AR7 1;  4RHV 1;  1B35 A;  4N43 B;  2D6P A;  4LHK A;  1RED A;  1VRB A;  2HH9 A;  3T0A A;  4EQV A;  5IUQ A;  5IVV A;  5ABJ A;  1TEI A;  3KGL A;  1D4V B;  2PEL A;  4LK7 A;  2UWA A;  4A45 A;  2DCZ A;  3AC0 A;  4CPB A;  1ULP A;  5C33 A;  1GKB A;  3KCC A;  3ZFF A;  5F8P A;  1UX7 A;  3M8L A;  4TYS A;  2VL4 A;  5FRA A;  1J58 A;  3NV4 A;  4GMP 3;  3J7N A;  2HKX A;  1VBA 2;  1X33 A;  2DF7 A;  5FY8 A;  3KF3 A;  1QQP 1;  5BNQ A;  1YQ2 A;  4I01 A;  2J1U A;  4AI3 A;  4OMC A;  4A42 A;  2F4L A;  4EWA A;  4E27 A;  1HJG A;  1HV0 A;  1W8Z A;  1ZBE 1;  2ZMK A;  3AVS A;  4P14 A;  3PUQ A;  1DU3 D;  2WUH A;  3ZDS A;  3PVE A;  2A5Z A;  3POB A;  1V70 A;  1VB2 A;  5L9B A;  3O1P A;  1DQ6 A;  3V65 A;  1FX5 A;  3B69 A;  2HEY F;  1ENS A;  1GP4 A;  1HB2 A;  1W3X A;  1LKN A;  3DCQ A;  4YYO A;  3H8R A;  3QH7 A;  1BVV A;  1O8P A;  2JKX A;  4LHN A;  2D5H A;  2RR1 3;  3MUZ 1;  2NYY A;  3H8U A;  1DQ0 A;  3BN6 A;  3O0V A;  1JU3 A;  1S1A A;  4XMA A;  2A6Z A;  2HWB 1;  4I0B A;  2B5H A;  2WNU B;  4BQX A;  4LHS A;  5I93 A;  3AKS A;  2D6L X;  4XYX A;  3BB6 A;  4RQP C;  2RS5 1;  4TWT A;  2HWC 1;  5FP7 A;  1WBF A;  4IEW A;  5HI0 A;  4PF5 A;  1W9F A;  1RXF A;  1CIW A;  4GB3 3;  4CP1 A;  2FDH A;  4UW3 A;  5HBA A;  3T4V A;  5CG9 A;  4BYY A;  1N3O A;  4IEZ A;  3VDA A;  2PHD A;  4NN0 A;  4QX2 A;  3GYD A;  3GM8 A;  4X8N A;  4XEZ A;  3WF3 A;  1U0A A;  3VD3 A;  3IDB B;  4AHY A;  4XZP A;  1IKP A;  1IPS A;  3N9O A;  4OI4 A;  1RUD 2;  3A4U A;  1DF0 A;  3B9I A;  3JU9 A;  2ZHN A;  5FLI A;  4FOV A;  5C7G A;  2W95 A;  4PDW C;  1UZV A;  4ATE A;  3MIC A;  1JW6 A;  4FPL A;  4UFL A;  4KBZ A;  5T3N A;  2Z79 A;  4NRM A;  4ZS2 A;  3UYJ A;  5J48 A;  1C57 A;  4TN7 A;  1CAV B;  3SMH A;  4XXA A;  4LMF A;  3UV9 A;  1OLM A;  3UT0 A;  5LRS A;  1LED A;  1RUF 3;  1Q5O A;  2VZS A;  3MUY 1;  4LTA A;  1SDW A;  3P3N A;  1WMX A;  2IXK A;  3U1X A;  5F6L B;  2VO5 A;  1OKO A;  1SLT A;  4CE8 A;  1VBD 3;  3K4Z A;  5FYT A;  4Q27 A;  4EN0 A;  2CSG A;  4AHZ A;  1MZE A;  2LW8 A;  1XYO A;  1W8U A;  4W6Y A;  3B5L B;  3JZV A;  1FI2 A;  2ARB A;  4N7I A;  2W08 A;  4FTB A;  1SLL A;  2RS3 1;  4LKE A;  5T52 A;  2XBO 3;  1UY1 A;  1SLI A;  3VBR C;  3C3V A;  1K42 A;  4GWI A;  2IUW A;  4S2H A;  4Y1Z A;  5C4W C;  1FOD 2;  1P8J A;  3EHK A;  1JZ3 A;  1CD3 G;  2R06 1;  4AEK A;  5A3O A;  5AFB A;  4S2D A;  3ALQ A;  3ZFG C;  1VPH A;  1YFW A;  2QQN A;  1DG6 A;  2E7A A;  1FNZ A;  1W8F A;  2BWA A; 
#chains in the Genus database with same CATH homology
 4N8M A;  3T30 A;  1XB9 A;  5EHD A;  1NLQ A;  4CA9 A;  2P1B A;  2VTX J;  1K5J A;  2VTX A;  1XE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...