5EHDA

Crystal structure of human nucleophosmin-core in complex with cytochrome c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
106
structure length
106
Chain Sequence
b'PQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleophosmin
publication title Crystal structure of human nucleophosmin-core in complex with cytochrome c
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 14
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H, I, J, a, b, c, d, e, f, g, h, i, j
ec nomenclature
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 5ehdA00
1XE0A 1XB9A 1K5JA 4N8MA 3T30A 2VTXA 4CA9A 2P1BA 5EHDA 2VTXJ 1NLQA
chains in the Genus database with same CATH superfamily
4MHRA 4UT5A 3QBQA 1PK6C 4OUSA 3GHNA 3I2IA 2YXSA 4UFHA 2YGMA 1GFF2 1N3OA 1DHKB 4KH9A 4BMEA 4JTOA 4CP2A 4RSUA 3KCYA 4KWUA 5JIAA 1VE0A 4P9YA 1BK1A 3WG3A 1GYKA 5ABJB 2VZOA 1F5JA 2CDOA 3KGZA 4A42A 1D2SA 3WP4A 5JSRA 2DFCA 1RMU3 2WZ8A 2Y6KA 2ZS6B 3WHTA 3I2HA 3H42B 4QM8A 3D6EA 3AJZA 4FPFA 1OOPA 1FI2A 3JZVA 4KBBA 3UJOA 1WMEA 3L2HA 4LK7A 4PIYA 4IE7A 1S0DA 4N9HA 3V65A 2W2IA 4ITCA 4WM7A 2DU0A 4IEYA 2ZX1A 3I3QA 4KI5M 1ZYBA 1GU3A 4BQ1A 3KLSA 1O8PA 4N43B 2VZ3A 4LPLA 1S2BA 3WDVA 4LO7A 3TEXA 1V6MA 4HONA 4F83A 2H6CA 2BFUL 3ZM8A 3AX4A 2FDJA 2VVDA 2B42B 1SLIA 3POYA 2B9UA 2DCKA 1A34A 4LO5B 3JBG3 5D8AB 3AKQA 4QHOA 2V5YA 5KC6A 3IMNA 5E1RA 1QIQA 1O4YA 2R042 1JMUB 4HT1T 1W05A 4Q4Y2 4G4FA 1GR3A 2BGPA 3VLBB 2RJLA 1UYPA 1KDMA 2RM22 2Y33A 4QKFA 4EN0A 4QQPA 2VQTA 1QJX1 3BOWA 4LOSA 4WM8C 4JX0A 1QDCA 2C6SA 4GALA 5J37A 3DECA 3NJVA 3NWKA 4D69A 4NR1A 4IETA 2QQNA 4Y33A 1IHMA 1US2A 3DL3A 4ZS3A 1HRI2 4GMP1 5LATA 2PHUA 3ROUA 4EJRA 2ZOEB 2J1SA 4ORFA 1TE1B 2XPJA 1L7QA 2YU1A 1R081 5T5OA 4EV0A 4AFCA 2A71A 3DN7A 4NIIA 2UYAA 1X9TA 1BXHA 2DCZA 1BVP1 4IEVA 4FFIA 4DXTA 2ZHLA 2JEMA 4I02A 2PHRA 1XE8A 5KHHA 1XNDA 4BXFA 2Y8KA 2R0HA 5GLWA 1PVC2 3LSEA 1LHVA 4O9EA 1RITA 1HXS1 2P3YA 3MEPA 4RHV2 4Q4W1 4A6SA 4Q4X2 2A6ZA 4Y4YA 4BK5A 1U0AA 1AYM3 1LCLA 2LTNA 4NAOA 4QPWA 3DKQA 1SFYA 4XIOA 4BLJA 3AL5A 5F5IA 1WWYA 2GNBA 2ERFA 3VZJA 5JIUA 1QJX3 4ZU5A 2NZ9A 5LEKA 1S55A 5HI0A 5DAVA 4O7XA 2NLRA 2WSVA 1HB4A 2R30A 2OYZA 1W2AX 1GV9A 4OI2A 3I97A 4BIFA 3RNSA 4UBGA 4GMP3 3PVBB 1Q8QA 4YVWB 1KRIA 4YW7A 1O4ZA 4GKYA 4YG6A 1SCSA 2C24A 3AZYA 3J9SA 4QPIC 5EYXA 3N4MA 1R083 5A32B 4CEYB 3TEZA 4XF3A 5DG1A 1JOBA 1CGPA 3MPBA 4F7ZA 3JB8A 2A3YA 3FHAA 3MV11 1HLCA 3SH4A 2WFPA 2WINB 1J3PA 4XFAA 3KF3A 5FZ4A 3LIHA 5FMDA 1WLDA 4CEWA 4OFGA 5FLIA 2D3RA 4K6BA 5KXCA 1TME1 2LROA 2QNKA 1D4M2 3I4IA 2C4XA 2XLFA 2FDFA 2ZBJA 1HXS3 4GWJA 2WIIB 1F31A 3JXSA 5KHKA 1GQGA 3BN6A 2WLQA 4Q4W3 3RWNA 1AXZA 3MHZA 2D6OX 3KCXA 3ME2A 2OW4A 2GNMA 3PU8A 4GH4A 4LBLA 3X29B 4NE9A 1H2NA 4UFKA 5A7PA 3TN92 1RUC1 1W03A 3DUIA 2WNVB 1DIWA 5AVAA 3LWCA 2EXIA 4HSLA 5FOBB 4QHBA 2VD7A 2ZHMA 4ES8A 3GNEA 1TVGA 3LEGA 1QF3A 1X82A 1JZ5A 5T52A 2OA2A 3KT4A 1MS3A 2WWUA 1WZXA 2MEV1 3OBZA 3VDCA 1DQ5A 3ZLIA 1C3HA 3OPZA 2ZX0A 2YB7A 1O3SA 2VCBA 3FUOA 4AF9A 1IGOA 2J1RA 5IVFA 3ASIA 1XOYA 3AMHA 1DFQA 1OOPC 1WW4A 3CKHA 3W58A 4KU8A 1ASJ2 5CADA 5D1IA 4DUXA 2VY0A 1GBGA 5L7OB 2PA7A 1ZZCA 4WM7C 3UKNA 4AHZA 1OXCA 2CY6A 1NZIA 3I59A 3VD3A 3N7MA 5FY0A 3BGAA 3Q8AA 5F37A 2G9FA 3AYCA 1QXRA 2QQPA 4FTEA 5K7PA 5IATA 1TME3 4QQ2A 1OBNA 2VNRA 5JPMB 2DUPA 3IKWA 5FV3A 2VMHA 4FPLA 4H55A 1NXMA 4Q8LA 2KA3A 2BYVE 4Q29A 1YC61 4OHZA 4CRQA 3ILFA 1JU4A 1QH7A 1UWWA 2JIGA 4WVWA 5CFCB 1XXNA 5FCCA 2Q1FA 5FXVA 1UY4A 3D4KA 2GU9A 1HN0A 2XUEA 4IE5A 2W52A 1RUC3 4IE0A 2XDVA 3U4XA 1RUJ2 5CU1A 2EIBA 2P17A 4CVUA 4NPRA 3FZ3A 3ZXGA 1W6QB 2NN8A 5FYYA 5G04L 1LHWA 1W0NA 1YFYA 3TAYA 4MYEA 2A6WA 3C7EA 3AZZA 1AJOA 2LRPA 5FPUA 1GWMA 1TZOA 1CAWA 2MEV3 5EJ3A 3PHMA 4HANA 1W6OB 3BALA 1SMVA 5BUVA 2O8QA 5D21A 5HPOA 1K5MC 4QX8A 5IK5A 2RS51 1X7NA 1C8NA 2K0GA 2Y26A 5LY1A 1QGLA 5H9QA 1RJ8A 2ET1A 3ENRA 3CDZB 5A3MA 4IQPA 3EQEA 1GZTA 4GZ9A 1ALYA 5K8SA 3MLJA 1MEC2 1PGSA 5GZFA 3ZIWA 1OKOA 3QLQA 3I2FA 3TB0A 3VDAA 1X8MA 1DLCA 2R071 2QQLA 3ZXKA 1XNAA 4NN0A 4Y1YA 1CR7A 2ZX2A 4I0BA 2RMU1 4ARXA 4KWJA 4K40A 1O7FA 3THTA 2OS2A 2D43A 1CX4A 3B9CA 3LZZA 4ZXEA 2JG8B 1VLNA 3M2MA 4QDRA 4QKNA 5F5QA 3FLTA 4QX1A 5L9BA 2FDIA 1WCSA 2XGXA 3RZMA 2HWB1 2V09A 4HL0A 3ZN5A 3ZYRA 3ZPOA 3ATGA 4LQRA 1YI7A 2HEYF 1N1SA 4NUBA 5LRRA 3VBRB 4K21A 3D82A 5JOYA 1F4AA 3O12A 4BQ5A 2V5DA 3HVDA 2F6BA 5IVBA 1HRV1 1QJU2 1UOFA 4ONUA 2XXZA 4XUOA 1OFNA 1O6UA 2WNUA 3OF1A 5C3QA 3MV01 1KXGA 2WR9A 2PHTA 3CZJA 1CPMA 1WKYA 2SBAA 3AKRA 2RS53 2AZ5A 2WAAA 1LULA 2ZGTA 4L9BA 4CCEA 3ACGA 4AG4A 1H1IA 4YVWA 5A33B 5L36A 5JXHA 4FPOB 2K2SA 4FFFA 1JYNA 5A32A 2HWD1 1RUE1 1UU5A 4CYDA 2NPIA 5FK7A 3E5XA 1L7LA 3Q8EA 2R073 1VRH2 5FY1A 4CCJA 3CJIA 1F35A 1H6YA 2PFWA 2RMU3 1DQ4A 2GC2A 1EAH2 4IGOA 1UYZA 3O7OA 5IVYA 5LY2A 5SV8A 1NCQC 3SITA 3PLQA 5FPLA 2VNOA 3ZX7A 2OUJA 2HEWF 1MS5A 3K75B 3OUIA 5I8YA 3APBA 5FP9A 5BNQA 3I2GA 4GH4C 3LOBA 5FZ1A 4Q4V1 4XUQA 2HWB3 5BV6A 5JR2A 5IFTA 3RG0A 4ASKA 1ODNA 2WNVA 3H50A 1UMIA 1OA3A 4Q0SA 1RHI2 3MPPG 3OPWA 5FPBA 3CBNA 3V0BB 2VMEA 4GXLA 1HRV3 4YARA 2E9QA 5SV5A 4HK8A 1C1FA 2ZPXA 1LRHA 1BMV1 1XYPA 3ZYGA 4UW5A 4LO6B 1D0GA 2QZ2A 4GJYA 4V2WA 4EYUA 4UFMA 2D6NA 1JUHA 5FO7B 3H7YA 2ZZQA 5FKCA 2WS91 4IDZA 2PLV1 4YWAA 2W1WA 3VZOA 2Y6JA 1ND3A 2C26A 1BBT2 4I30A 1QXPA 4K7JA 2W5FA 2HWD3 1RUE3 4J1WA 3JD71 4XE9A 1EV12 1PK6B 1V70A 3AZWA 1U5YA 1V6LA 1K3IA 4AGVA 4BDVB 5J1XA 3R6SA 4N43C 4MHUA 4ZY9A 1VBE1 5LASA 2X05A 4ISRA 4XQ4A 2WZPP 1HQWA 2PYTA 4Y5Z0 1J83A 3WR0A 2TUNA 4R4ZA 4LHKA 4O61A 2ZMLA 4CXYA 4LUKA 3MBWA 5FYHA 3IAQA 3VHPA 3VBFA 2JKBA 1KITA 3B9IA 4LKEA 5D8AC 4CPBD 1EPZA 4Q4V3 3WF4A 2WO7A 4AW7A 2JG9B 4BA6A 5FZIA 1GANA 4PDWA 3V56A 3VKMA 2C9AA 4LIVA 4BZ4A 1RVF2 2HYKA 1UXXX 4ZS2A 3VKLA 4XBLA 1RUF1 4HVQA 1WCDJ 3W20A 2CAUA 2EVXA 2YFUA 5HV4A 2DTWA 1DZQA 2YBKA 4Q0PA 4XW3A 3PUIA 4NIHA 3WUCA 3OBAA 2WS93 4M3CE 5CFDA 4IE4A 2PLV3 4AVVA 4Z2AA 2JD4A 4LA2A 1AR72 2PMWB 1S2KA 1IZ3A 4JC1A 5A3WA 2VQUA 2WO2A 3JD73 4HMZA 4XUPA 4ZZ5A 1FAYA 4EE2A 3ITQA 3K46A 5IWFA 3EB7A 2RR11 1VBE3 2CWMA 3CIHA 5JI9A 3BB6A 2F4PA 1O3RA 4D3WA 1VALA 4NRMA 4WM8B 2ZEWA 1H1MA 1XE0A 4G3YC 4XDOA 2BZDA 5DUWA 3VV1A 3QH7A 2QQJA 3JB4C 4AVTA 3HMYA 4L8QA 4CCLA 2VMGA 2WZR1 4J25A 1O5UA 3ZYJB 1RUOA 3RJRA 2P34A 4OQ9A 2DBNA 1WMFA 3LF7A 3OY8B 4L99A 4XUTA 2CDPA 2GALA 2VC9A 4XFIA 4ZZ8A 4K3UA 3FN9A 4D94A 3WF1A 5LCWL 4FP2A 5JCTA 1RUF3 2JE7A 4M4PA 4OVEA 1FNYA 2WN2A 2WO1A 1BZWA 4XABA 2VL4A 1OD3A 3WQBA 4QAWA 4BIOA 3JBG2 3HAGA 4AHWA 3WNPA 2N7GA 4AFMA 1XU1A 4YVWC 2XMLA 3H8RA 1BYHA 3VD5A 4FSJA 5FZOB 2IXIA 3ZDVA 3N9OA 2H0VA 2RR13 2QE3A 1VAVA 4LOTA 3DYMA 3A0KA 1CJPA 1VBB1 1SDDB 3GZUC 3KQRA 4GWIA 3HBZA 5C6CA 2XJRA 1OKQA 2YC0A 2WZR3 1CAVB 1LEMA 2LM3A 3POEA 4QDSA 3A21A 2VZRA 3NO8A 4Q26A 3Q8CA 5ACA1 3T2PA 1DG6A 4AHXA 4D7SA 4JKMA 2W47A 4C8DA 3U75A 1W0OA 5FY8A 4QPIB 5DXDA 4YW5A 5JVVA 4DB5A 1OUXA 4UXAA 3UT0A 5IK4A 3KHBA 3MUZ1 2WNVC 3W9AA 3IZOA 2IVIB 3J4UH 4S2FA 3UGGA 4BLIA 4BQYA 4XBQA 3ILRA 1B09A 1LJ7A 1W28A 1A6CA 3UGHA 3LSDA 3FFQA 4MXVA 3ABZA 1RIRA 2PHLA 2ZGSA 4YGDA 3UK9A 1SLLA 5CG9A 4BH9A 1CIYA 1OT5A 5CA6A 5CB7A 4MV2A 4XFBA 1OQEA 2JXAA 1A3KA 3A4UA 5FQ0B 1OLRA 4Z2WA 3H3LA 1W39A 1ND3C 1W04A 2GNTA 1DDLA 3AMMA 2A3WA 1GOFA 3OD4A 4YZ3A 1KD7A 2W0XA 1K5JA 3PUQA 4LHLA 3RMYA 1S4CA 3JQWA 1QJX2 3UV9A 4BQWA 4XTPA 4Y20A 1VBB3 3VL8A 4C0BA 2Y64A 3OEBA 4NVPA 2Z2SB 5T5LA 4BJ0A 3SH5A 3C7HA 4X6RB 2Y38A 5LK7B 1UCXA 3IBMA 5ACA3 1Z78A 3BTXA 3LDRA 5DAXA 3HWJA 3UGFA 3SKJE 3PURA 1XNBA 1ULFA 5CZKA 4HPKB 4QB6A 3U10A 5CFCC 3VBFC 5JXGA 1H2LA 1OOPB 4YW1A 4CDUA 1ZVFA 1Y9GA 2ETEA 4XC9A 1VJ2A 1JYIA 1W8UA 1H2MA 1VP6A 2VTXA 4DXZA 4WM7B 2JG9A 5HBAA 4QU2A 1G9CA 5C3PA 4YW3A 4XCBA 4U36A 3BU0A 1OFSA 1ZRRA 4LBQB 3WP3A 1S1AA 3KM5A 4XVHA 3KT1A 4V2VA 4COWA 1POV0 1BEV1 1OPOA 4YW4A 2DCYA 1HXS2 1OH3A 1UIJA 4XQDA 3I2KA 1ZNPA 3O5SA 3J7MA 2VCMA 3P3NA 4Q4W2 4RQPA 4UFIA 5C5TA 1GOHA 5DUXA 4FAGA 5FZMA 4A45A 1CX1A 3RWKX 4I01A 4RD7A 2Z4FA 4NHYA 1AX1A 2JJ6A 1Q5OA 1WGPA 1OLME 2XQRA 5FPXA 5L73A 4NPMA 4EWAA 3T4HB 1MQTB 2QFEA 1SHWB 3FFZA 3B3QE 2Y6LA 4P00B 2R1BA 5FP8A 4MX3A 5H9PA 5A3TA 3NMBA 1J84A 2YHJA 2NM1A 4R9DA 2D40A 4E27A 2D98A 3LIGA 1ND2A 4AFAA 2ZHKA 3AJYA 1SFPA 5FYVA 3LEIA 1AYN1 2Q5TA 3O1OA 1PX3A 3O14A 3FBMA 4CXWA 5FZHA 5DZGA 2YV8A 3IMMA 2Q4SA 2YFZA 3FJSA 4IV3A 1M06G 4D7TA 4YGCA 3K77A 3OY8A 1H9PA 4B1LA 4AI9A 5FDBA 5EPAA 4MSVA 3T2TA 3J26N 5L9VA 1OF3A 3P5BA 3VBRC 5J48A 2OUHA 1TME2 3WCSA 1X8EA 2BWAA 2O1QA 3H7JA 1OLMA 3SCFA 1BEV3 3ZFGB 3ZFEA 4IE6A 1ENXA 4BMBA 4CA9A 4CCMA 1PZ9A 3TEYA 4XF9A 4J1XA 3NL1A 5F32A 4CCDA 3NJZA 2VZPA 4M3CF 1YWKA 3RYRA 1WD3A 2VCAA 1E5RA 1QQP1 4RGKA 1RUC2 5FFOC 2XBO1 2DF7A 2ZEZA 4IEQA 1J59A 3VDBA 3OGJA 5F9TA 1IOAA 3B7MA 3VBSB 3ZSJA 2JECA 3MIEA 5EIYB 4AFDA 3B02A 3WDYA 4QM9A 1SQ4A 4PHZA 1Q8SA 1IG3A 2EICA 1MZ6A 3RDIA 2XJTA 4NHKA 1R091 2MEV2 3OSDA 5EZWA 4B8EA 5EP9A 1N47A 4HN0A 4QGMA 4YZ4A 1LU1A 1OC1A 3K4AA 2W3JA 3MF6A 1N1TA 3EJKA 5J96B 4L2NA 4K1YA 1RMU1 1AYN3 2NQYA 5FWEA 1Y4WA 3S0MA 4TSVA 1W6NB 3VKOA 4RN5A 4XMIA 3UETA 3HR9A 4LBQD 3WEZA 2AEYA 1DYKA 2VPVA 4N9IA 4DEVA 1EUTA 4DY5A 3FHIB 3U0ZA 1T6GC 4JVAA 1NA1A 1J3RA 1ZBA1 2YBPA 1GP6A 3NW4A 1KFUL 5LWBA 5ANQA 1S2EA 1F15A 1YHFA 3I3DA 5B4NA 1VMJA 1JXNA 3J7NA 4JRLA 2PXJA 4R52A 3WP6A 3GXUA 2XLGA 4URTA 1SCRA 4INDA 2VAUA 1SDWA 3GALA 1QQP3 2R16A 4PQ9A 3SLIA 5FQ0A 3PIGA 2P4EA 2XBO3 5FP7A 3AC0A 1RJ7A 1X36A 1JI6A 1QNYA 3I2JA 3PJYA 3TNPB 2BNNA 3GCXA 1YRZA 4FCAA 5DPNA 4XFCA 1LGNA 2BUKA 5EXOA 4H7LA 4Y1UA 1R093 1UYXA 2VGDA 2OPKA 2P5BA 3VB9A 1NE4A 4JHZA 1UZZA 2TBVA 5AFEA 4K20A 4OULA 2RS52 4H2AA 3VGIA 1O59A 1W6PA 4LXLA 3DXUA 1REDA 4BISA 4CP0A 1JOPA 4HPKA 1J1TA 1W8NA 2E33A 4Q27A 1E57A 1GMMA 1UXZA 4CDUC 2VXRA 1V6NA 1JZ7A 1GOGA 2XONA 1WW6A 2JG9C 1ZBA3 2JE9A 2DCJA 2HH9A 2R072 3I59B 1APNA 3HT1A 3CF6E 3LOIA 5JI7A 5C8CA 4LBQA 3U07A 2QCSB 4GQ7A 4LHNA 2RMU2 4MOAA 1RINA 3T08A 1N3QA 4IV1A 2E7QA 1JTZX 1DGRN 1UX7A 2VBDA 3KQ4B 1QJY1 1WMXA 4OHYA 2CNAA 3M3QA 1S0EA 1DGWA 1PGL1 4XTMA 1I1EA 4LMFA 1G8WA 3N9LA 2P37A 4XJAA 1H4HA 4LITA 2HWB2 2XKOA 2JB8A 3CO2A 3S5AA 4AI3A 5A6XA 3SC7X 4Y24A 2DUQA 4ASLA 2RDRA 3IWZA 2CGOA 2FZ2A 1PM7A 2CL2A 3POFA 3CMGA 3E5QA 3FE5A 1AYM1 1MQTA 1HRV2 1OPMA 3TYJA 3BTYA 4HG6B 1A8MA 2ZAAA 4EZHA 4M00A 1CAWB 4TYSA 2D7FA 1QH6A 1XQNA 1CAXA 5J7MA 1NQJA 5A7WB 5C4WA 1R64A 1ND2C 4QXHA 3VBUB 5IVVA 1GSLA 1FT9A 2FDHA 1XBFA 2JB4A 4CTEA 1JODA 4YM2A 4QPGA 3K4ZA 1RUE2 1X33A 3WX5A 4IV3C 4N90A 5IVJA 2BGCA 1EYBA 2BFUS 3VHOA 3PTYA 1UOJA 4YFWA 1W3VA 4NIGA 1UZYA 2I2SA 4MGYE 1LESA 5IAXA 1Z7S1 4FPYA 4CUAA 3ZFEC 2HWF1 2VH9A 4BYYA 1OMIA 3ZFGA 2BBAA 5H9SA 4XYXA 1WCQA 4TLGA 2VM9A 3TRSB 1QJY3 2BP6A 5B2GB 2R7EB 3GBGA 4YGEA 1UPSA 4AVCA 3ZVXA 1L3JA 4Q4V2 4QD2A 4XZPA 1WBLA 3OG2A 2YROA 5F6KA 5FZKA 2NMNA 5FJHA 3D3AA 1FOD1 3LA3A 1O5LA 3IDEA 4COVA 2NP0A 1FMD3 3VBSA 1DGLA 1KGYA 1IS3A 5JMCA 5KXEA 3U78A 1VBD1 3VZLA 3WVJA 4Q0VA 1F5FA 1JUIA 4QPYA 2VZSA 1V9U1 3KCCA 2WS92 4XQWA 4HK9A 2PLV2 2WNUB 1ZRFA 3GJAA 3OBRA 2HKXA 4XXAA 2Q30A 5JWPA 5E8AA 4PT6A 4HSJA 1BJQA 1OUSA 1QMJA 1W6NA 3I3MA 2R0FA 3JD72 5F8PA 4EROA 1AR62 3NJXA 5FZ6A 1GP4A 2YU2A 4WVMA 1GQPA 2BTVC 1VBE2 5K0UA 5KC5A 4OZOA 4OI0A 2ZJCA 1Z7S3 1RUH1 1TNRA 2HWF3 4NHLA 5I93A 2BV4A 3CJIB 4MO3M 1UOBA 1H8VA 1LTEA 2HBTA 3I54A 3R4DB 1DZTA 4AQ6A 1FV2A 4F3JA 3VZNA 2W95A 3AYAA 3WF0A 3UKVA 5I0UA 3M3IA 2CGPA 4XETA 4E4HA 1YQCA 1AF9A 3V64A 5FLHA 3VKFC 1CJDA 1FOD3 4NOTA 3WHUA 4TTGA 5AC93 2DUOA 4H14A 5F5AA 4META 2ES3A 2G1MA 2EIGA 4QX0A 3N35A 1RUF2 4WZCA 5FZFA 4URAA 1VBD3 2G9ZA 2F17A 1UZWA 1LAJA 3RGBA 2OT7A 1ULCA 2VTFA 3L9JT 1NQDA 1V9U3 2D97A 2W1UA 3MIHA 1HW5A 3NJYA 2XUMA 4MADA 3LGRA 5APAA 5FZGA 5FZAA 5BXXA 3BIWE 5LA0A 4DUVA 3IM0A 3KWVA 2UWCA 3THPA 3BIEA 2IZWA 1ND3B 2KM2A 2QZ3A 1GNZA 2ZMKA 2B5HA 2RR12 3HPNA 2HJIA 2VJXA 2Y6HA 3ON7A 3AKSA 3K3NA 4RS5A 5FUNA 5GZEA 3QH6A 4Q0UA 3RI8A 1MR5A 1RUH3 1NY71 3T4VA 3WCRA 4JDMA 3BTZA 4MGQA 3ACLA 4S2HA 3WY6A 4BB3A 2Q1ZB 1PHMA 2R1DA 4GB31 4IV1C 3ZKYA 4N8MA 2WZR2 1PO21 2OZJA 2VOKA 2GN7A 2UURA 1MVQA 3ZFFA 1G9DA 2ILMA 5DZEA 4PIZA 5FXXA 4D6RA 4AEJA 3LE0A 2BOIA 3VBFB 3OGSA 4FFGA 1HQLA 2LW8A 4QDQA 3RYKA 3ZMOA 1LKNA 3VDDA 2VZQA 1HB2A 3AFGA 3MICA 5EJZB 4PDWB 3K51A 1MQTC 3MW3A 1UAIA 5FY4A 4Y4RA 1JHNA 4JHTA 4UOJA 4YNIA 5J3UA 1WCUA 2VU9A 3F2ZA 2VZ1A 1AXYA 4R9CA 2FQPA 4XJ9A 3URFA 5A7QA 1BQPA 3HIFA 3WG2A 1ZREA 1DU3D 4LKFA 2XR4A 4R8HA 4A4AA 5C4WC 5CFDB 5A7WA 1U5XA 3VBUA 3MGUA 5LBCA 3RZJA 2BW8A 3E6CC 4AZZA 2UY9A 1AR91 1N3PA 2ZEXA 3ZXJA 4A7YA 4QPGC 1GZCA 2XL9A 3WD5A 1LHUA 2OVUA 1OA2A 3C2UA 5FAXA 2ENRA 1IQDC 1W0PA 4V1PA 4Y22B 3VD9A 4HZFA 4ES9A 1FNZA 2C0ZA 3CEWA 2GDFA 2WT2A 4LO8A 3SMHA 2EF6A 1GICA 1FPN1 1MPXA 1VBB2 1S0GA 1IS6A 2IUWA 3E1F1 4LULA 5EWSA 2B45X 5CYYA 5DABA 2AUYA 1VAKA 2YPJA 4GB33 4YVSA 3ZFGC 1PO23 5ACA2 1TEIA 3GHMA 4H7MA 1Z0HA 2GMEA 3WW3A 4DEQA 2HWC2 3EO6A 4MLOA 4AGGA 3Q9OA 2X5IA 4IERA 1PZ8A 2ZEYA 4K8RB 2P3IA 1GUIA 2PELA 4M3CB 3N7KA 4QU1A 3SKVA 4AHYA 4AQTA 5JLVA 4MGZE 3LEMA 3TWIA 5HCAA 4D7YA 2FCVA 3VBSC 2ARBA 4YZ5A 1V6OA 4ZU4A 3ZO0B 4DMIA 3U4SA 4N7UA 3CNAA 5AC92 3RYPA 1HQNA 1XC6A 3FBYA 3VD7A 1YI9A 3WQ0A 4OI1A 2KR2A 1W8ZA 2ZGRA 1SZBA 5T50A 4AEKA 5A3PA 2WA3A 2XLAA 1RUG1 2WUHA 3ZXFA 4RFT0 1OVPA 2Z79A 4XURA 1WD4A 1YJKA 3ZXDA 2QBXA 1AR93 5A7NA 2ZGKA 1WCKA 3ZN4A 3LDKA 3ZSEA 2WJSA 4AYUA 2BDRA 2JDKA 2XJVA 3ECQA 1FPN3 2DVAA 4EQVA 2FD8A 4XIKA 1NAEA 2XHNA 4UW3A 4LO4B 5FUPA 5FYBA 1UY3A 1JS9A 5FP3A 1R1A1 1HX6A 3PNAA 5EV7A 1CIWA 5LBBA 2O8OA 2OQ7A 1YQ2A 2GC0A 2XVLA 4A7ZA 1LENA 5BNPA 3HOBA 1POV1 1W9TA 2C1FA 2WO3A 3MIDA 5FR3A 1UMHA 3AP9A 3GZAA 4OMDA 3RZZA 3M4FA 3ZYFA 3BYWA 4BK4A 4CDWA 3N7JA 5C9AA 2VVEA 3AKTA 2DVFA 2J1VA 1PVXA 2BGOA 2VE1A 3HQRA 3JUUA 4P9LA 2R32A 2OZ6A 1YQ6A 2A3XA 4Y5TA 4KU7A 3WW1A 1BEV2 4OHXA 3AMNA 3M1HA 2FHRA 3F95A 4YPJA 3SEPA 5FREA 1RUG3 2XHKA 3LFMA 4YRDA 5FYUA 4YYOA 5JXIA 2XWJB 3RRDA 5E89A 1F8VA 5LEJA 1AL22 4S2GA 5F3EA 3ZN6A 1WUVA 1PNFA 3OUHA 2DVBA 2P1BA 1R1ZA 3EBRA 4GWMA 4JGZB 4UYBA 4ET7A 2VCCA 2IXCA 2FCTA 2VOXA 2ZGPA 4B4RA 2Y0OA 3NKGA 4RS5C 1W9FA 2AC1A 1OVSA 4AVAA 4EZ4A 4Y20B 2RDSA 1R1A3 2DYCA 5FWJA 1M4WA 1DZRA 1RUD1 1TG7A 1AXKA 2IXJA 4Z82A 5JPNB 5A6QA 2LS6A 2RM23 5A3LA 3KT7A 1AYN2 1POV3 3ZFFC 4FFHA 3H1MA 4PBPA 2JDNA 2ORXA 3I3BA 4CE8A 1LECA 2RS31 5F3GA 1ZBE1 2QTWB 4CDUB 1TQ5A 3NVCA 4QXKA 5GZCA 5BNOB 4FOWA 3VDDC 1QXJA 4O9GA 5J09A 3GZEA 5FIXA 2ZZJA 2ZGOA 1NLQA 2VMDA 2YGLA 1C5IA 4DRRA 2JX9A 5LA9A 2WQ8A 2DDUA 3I8TA 1YEWA 3WW2A 5AFBA 3FC0A 1RYYA 3U1XA 1SFNA 3MIFA 1QQP2 1HIXA 2AACA 4BQ4A 1MS8A 2W91A 4QB2A 1UD1A 2VMCA 2EA7A 1VMHA 2LALA 4RQPB 2XBO2 4TLFA 5C3OA 1HV1A 4IEOA 5J98B 3ST7A 4GULA 1O3TA 1HB1A 4COZA 1VBA1 4JQTA 4Y22A 1QOTA 2BOJA 3JU9A 1ZRDA 4Y3OA 2BJSA 3WQ7A 1L7RA 4F8AA 1A78A 3OCPA 1PM4A 1IKQA 1RUD3 1W8WA 1PGW1 4C91A 4QKDA 3ZOIA 1RMU2 4XXPA 1ND2B 3GGLA 4AEDA 1LOCA 2GC1A 3EXUA 5T5JA 1O8SA 1P8JA 4I0AA 2RS33 4R9BA 3TEWA 3PTRB 1ZBE3 3WUDA 1E5IA 2GH2A 2X5IC 5JSPA 1I5ZA 3O0WA 2OXBA 4IV3B 4BE3A 4M3CA 3MIBA 4WZFA 5EYYA 1UYYA 1OURA 3AYDA 3I7DA 1CQ9A 2H0BA 5JXJA 4E4ZA 1CD3G 1FX5A 2WQ4A 4N53B 1LOFA 2R061 5T3NA 3T3YA 4CXXA 3ZFEB 2QQKA 2RG4A 1ST8A 3LD8A 4AL9A 1CPNA 5JR7B 1WLCA 3NNJA 3H8OA 1S0IA 1QEXA 1RC6A 1PX4A 2WNUC 5E6HA 4TXWA 2RHPA 3T2QA 3MDPA 2QVSB 1VBC1 1D4M3 3D8CA 4QB1A 3VHNA 4JTNA 1I5PA 1PIV1 4E8CA 3WNXA 4XF4A 5FZ8A 5F6LB 4PQQA 4XHXA 2WC2A 1VBA3 4EN7B 4NIDA 1CONA 4B4PA 4LJHA 1OLQA 1YJLA 2J42A 4MGIE 2OX0A 1MS1A 2JENA 3WG1A 4UF0A 5JSOA 1OHFA 3CJIC 3HNMA 4LEJA 4XILA 3OPTA 3O1TA 4Q1PA 5JUVA 4OCTA 3RJ2X 2PHDA 5BNPC 4RYDA 5LW9A 2ARAA 1SLCA 4MVTA 4CDWC 4IW3A 5FYCA 2ZGUA 4N7IA 1JN2P 1COV1 4FPJA 3N9NA 2NMOA 2QKDA 2XVGA 3R05A 1Q56A 1NA1B 2P6CA 3BOPA 2R063 3DPRA 4JAAA 5F2WA 4YW6A 2A6YA 1WA6X 1AL0G 1MS4A 3GF6A 5CKMA 1QJY2 4HVRA 4CDQA 1FATA 5BNNA 3BI3A 4X8PA 4AFBA 1PGL2 4AAPA 5FZ3A 5EHDA 3MLKA 4PF5A 4Y5SA 3MF9A 1KJLA 1VBC3 1NT0A 2AEZA 2QUOA 4HXCA 3PVNA 4JDNA 5I8SA 5A7SA 3NAPA 3VZMA 4E2QA 5DAPA 1PIV3 4CU7A 2ZMNA 4XOGA 5FLJA 4CDXA 2D3SA 2WYFA 4BPZA 4EN6B 4JGZA 1W99A 3O1RA 1AYM2 2RJ2A 4I0WB 5K4LA 1W2UA 3G6JB 1SBDA 3AP7A 3IIAA 3AYEA 4EWEA 1H1AA 3FUQA 1ZRIA 1XYNA 1RL3A 3O1VA 1C57A 1XSRA 2E51A 1DYPA 3ALQA 2X10A 4GIQA 2RJKA 1QJEA 4IL7A 5DDJ1 3WW4A 4GA9A 4CU6A 4NJ4A 4PI2A 2B39A 3KV6A 4AR2A 1W6PB 2KD7A 3ETQA 5CEHA 3KZ4C 4HETA 5E88A 4JGYB 4XJUA 4GKXA 5T5PA 1COV3 1Q3EA 1R082 3LAGA 2HWE1 1QJZA 4W6XA 5A6YA 5BNOA 2RDNA 2D6LX 3FX3A 4NIAA 1IG0A 3RSJA 1E5SA 2HWF2 3AK0A 4PDWC 2CGNA 5BYNA 5C8CB 5FZ7A 2BQPA 4YW2A 1RUNA 1JYTA 4LR4A 2GP5A 4J6GA 4L0PA 1NOVA 2Q8EA 4COYA 2VBPA 4IV1B 4A6OA 2Q8DA 4IEZA 3UESA 1PNGA 3OD0A 2FBEA 3K4DA 5CFDC 1OA4A 3SQOA 2RS11 1FOD2 1XRUA 2D6PA 5CIRA 2TNFA 1REFA 3ZPYA 3SCHA 4EN8B 4PLMA 5LA1A 3LB9A 1MZEA 3C3VA 2VNVA 4UW4A 1LHOA 2OQ6A 2ZGQA 3ACHA 4E8DA 4X6QB 3M3CA 3GYDA 1REEA 1RUI1 1VBD2 3PUAA 5A1LA 2PQSA 4AGRA 4JCKA 4AVBA 1ENRA 2VZVA 5B4XA 1V9U2 1FYUA 2E6VA 4E4SA 1GWLA 3LEKA 4AVSA 1TMF1 1PMIA 5DDJ3 2VUDA 4KWKA 1VAMA 1CAXB 4K1ZA 4MGSA 2YDEA 5HCFA 2QQVA 5C4WB 4ZPIA 5FOJB 1O3QA 3LFIA 5F3IA 4AEDC 3O1PA 3KVBA 4QHZA 1AJKA 1UKGA 2OKXA 5C5UA 4C90A 4QPGB 2VZTA 2HWE3 4KNCA 1U5IA 4DS0A 5L9RA 2UYBA 2VOVA 3PDQA 2GH8A 2ARCA 1XB9A 5FMOS 5IT6A 1RUH2 4KMQA 3MUY1 4OHWA 2CU5A 2PHWA 1QU0A 3DXTA 4DINB 4TN7A 1LOFC 1UOGA 1D4VB 2B4KA 2P3JA 2UWBA 2BWCA 4N53A 3TOJA 1N1YA 3WDWA 1MACA 1ZZ6A 3CLPA 3VKNA 5KWRA 4I2OA 5IHRA 1UY2A 1SPPA 4C0HA 2AENA 2RS13 4UFJA 1JU3A 3IPVA 4XFGA 1UZVA 1SLBA 2JE8A 2MPFA 2DFBA 4I3GA 1EAH3 3SEEA 4OMCA 1H8TB 2RE9A 3JCIA 1OSGA 1U5ZA 1VIWB 1LGCA 2WNOA 2FMDA 3BPZA 3DEMA 3RZKA 1UNBA 3KMHA 2C9KA 1RUI3 2GNDA 2PQQA 4YGBA 2W9XA 3WINE 1LOEA 2Y60A 2Q8CA 1YYNA 4PIXA 5HXMA 3ZKUA 4IXLA 2VBBA 1JH5A 1TNFA 4FOQA 5JZGA 1TMF3 4LORA 2I45A 4W6WA 5CKQA 2ZX4A 1Y7BA 2ZA9A 4CCKA 1KFXL 2JKXA 5KHIA 4GWNA 2CHHA 4XFFA 1SACA 3KS7A 1V6JA 1V6IA 3K2OA 2EAKA 3ZR6A 2BVVA 1ONAA 2XJUA 3QACA 1STMA 3BTAA 4Y1XA 3U14A 1QJFA 5D2AA 1NZCA 3RFRA 4U2AA 2P3KA 1OH4A 2EIDA 1NY72 3ELNA 3P3PA 4QX7A 2IXLA 4WVMB 5CG8A 1H6XA 1QY4A 1EP0A 1X50A 3DKWA 5K0UB 4KQ7A 3UL2A 3DPRC 4GB32 3DYOA 2WFF1 5FYTA 1PO22 2J1TA 1UQXA 5T55A 2VZUA 3OTFA 4ISQA 3BODA 5BNNC 4Y1ZA 2ZGMA 3WLUA 5FZ0A 4CEWC 3AZXA 5ISLA 3VBUC 2ZAHA 3B94A 3N9QA 4YFZA 1PO11 4CDXC 3SNMA 2UU8A 3ETPA 5FO8B 4JGZC 4PJYA 2PTMA 2GC3A 3DF0A 4QX5A 1KS5A 4XF0A 3Q8FA 3QCWA 4KL1A 3AZVA 3PIJA 2BEOA 2E26A 1YFUA 3BPSA 5FRAA 1H2KA 1AX2A 2EXHA 4OQ8A 3VBHA 1NYWA 1ULEA 2YPDA 3V0AA 3I2OA 1US3A 4FPGA 3MO4A 2WWJA 5C7GA 2CV6A 1C5HA 4LE3A 4LLOA 4R9AA 4B3NA 4DFSA 5LK5A 1S0FA 1QKQA 4JQRA 3ZMNA 5FBZA 3H3ZA 2YYOA 5HXVA 2VW2A 3WDTA 3N36A 2DTYA 3J7LA 4JGYA 3MFCA 1FPN2 1VMFA 3EYPA 3ZYIB 4H3WA 1O4TA 3THCA 5BNOC 3T09A 3ZXAC 4RS5B 3BU7A 4XFHA 2E53A 4JKLA 2JDAA 2WFF3 2CYFA 3D0SA 4UBHA 3WV6A 5CKNA 4Z07A 4OUMA 1JZ6A 2XVKA 1HB3A 1W2OA 2B46X 4KG0A 3M7AA 4SLIA 3S7IA 3ZFFB 3MFAA 2O14A 4CP9A 1PO13 4P5YA 4RQPC 2QQMA 5BPXA 1N1VA 1ZX5A 4LA3A 4QXCA 4NMIA 1LHNA 1DLLA 5GJ6A 1DQ0A 1XU2A 5GLZA 2QQUA 3VDDB 2X8KA 4Q8KA 5C3RA 2DVDA 1FMD1 2ZTNA 3VD4A 5GZDA 3BUCA 1XJAA 2XOMA 3NV3A 4DPNA 5DMYA 1QNWA 2F4LA 3OB8A 1ENQA 4MH0E 4I09A 1RUG2 2PN5A 5A6ZA 4COUA 1GNHA 2D3PA 2EXJA 4I3PA 3W5MA 2VNGA 1DP0A 2GMPA 4Q0QA 1KJRA 4BQ2A 3W21A 1V0AA 5FYMA 3AMPA 5A3NA 2Y34A 1I6XA 1W8FA 4BHPA 3B69A 2IC1A 2PHXA 4QX3A 1AUYA 1UY1A 3ZXEA 1K42A 2Y6FA 2HWD2 4HFSA 1UMZA 2XWBB 4OLLA 3ZSMA 2W94A 1ULOA 2V73A 4QGNA 4CP1A 4E4DX 1B35A 4FPEA 2PHFA 3AXDA 3OYWA 4XHBA 1R1A2 2DCTA 5TSWA 3A23A 1HKDA 2UWAA 3UNPA 5I0TA 1W8TA 1H0BA 2RDQA 4N53C 1NLSA 3KV5A 4UI9L 3S7EA 2WL1A 4YVSB 1YIPA 4PCRA 3C7GA 2BRTA 3OGVA 5DZFA 2CAVA 1DGRA 2UY8A 1SBEA 3N3HA 4NRPA 1Q8OA 3B00A 3GDBA 3THDA 1G7YA 1RB8G 1ENSA 3ES4A 4CCCA 2AREA 3CJXA 2Q0AA 1K5MA 3WZ1A 1H8TA 2X5IB 3O0XA 1JYCA 5C33A 1C8M1 2VR4A 3KVAA 1CWPA 1UY0A 4DIQA 5A1AA 1Q8VA 3AL6A 3VHRA 4AXOA 5AC91 2NYYA 2A6VA 2DU1A 2XJPA 2VO5A 3S6PA 4FT8A 4W65A 1WW5A 5GLVA 4Z92B 2X29A 1BMV2 3OJBA 3SH3A 2VMIA 5JZGC 2BNOA 3FMGA 2GAUA 5T54A 1JZ4A 1SEFA 3HQUA 2WSUA 3CQOA 3M8LA 5IFPA 3WSOA 4RGAA 3G7DA 1HN1A 3POSA 3AKPA 3KV4A 4M4RA 4XAAA 1AR81 1Y3TA 4YLZA 1UIKA 1W6MA 2ZABA 5A1FA 1AX0A 2OPWA 5FKBA 1UO9A 3WOGA 4FTSA 2E32A 4KBZA 2HEVF 3INAA 1NA1C 1RUD2 4UAPA 3U37A 2VW0A 4XJZA 3VZKA 2A70A 1W9YA 3MW4A 1SBFA 4BWOA 2IVJA 4MXWA 4S2DA 3AP4A 1Y43B 5I0RA 4DUWA 2RS32 5BNPB 3O1MA 4OYUA 1ZBE2 3IN9A 2D44A 2VMFA 4NWVA 3ZYPA 5GZGA 1C8M3 1F2NA 4P9JA 3P1IA 4CDWB 4E2GA 3H1YA 5C9AB 5HCBA 1YFWA 5JAXA 3QD6A 1H9WA 3CU7A 1URXA 5A7OA 5JOZA 3I49A 1S0BA 3SXWA 4ATFA 3J8F1 4DXSA 5F7UA 5LB6A 4YSFA 1NCRA 3D0JA 2XKPA 3GBFA 3RVHA 4KGQA 4IEPA 3VBHC 4E2SA 1XYOA 4QQOA 1CAUA 1ZA4A 3MLLA 4MZUA 3KF5A 4DOUA 4QMAA 3A22A 2G9GA 1QDOA 2IXKA 3KGLA 1NCQA 1VBA2 4ASMB 3S30A 1AR83 2YUEA 4LNVA 3ZN6B 4JGYC 2WZEA 5F1RA 4G9SB 4IGPA 4LBNA 2V72A 4AEMA 4FI9A 3DGTA 1J3QA 2WYSA 3I3EA 5FZEA 5DAWA 3RZGA 1PGW2 4LKSA 4P9GA 5FK8A 5C8CC 3IDAA 4WBBA 2JDZA 3AXEA 3USUB 1YLLA 5C3SA 5LZ6A 3POJA 5H9RA 2VECA 5A80A 1DQ1A 1O91A 4A2UA 4Z8BA 5E16A 5ABJA 1UW8A 3HQXA 4M01A 2FMYA 1W3XA 4RL7A 5CVRA 4XEZA 3RZHA 4EWDA 1GZWB 4KWLA 4IEUA 4AI0A 2A7AA 4P5HA 1DQ2A 2WQZC 4PBOA 3ZR5A 5EFUA 2D93A 4BQ3A 3POWA 4FQZA 5I8TA 2R062 4NHMA 3FWEA 3J8F3 1NG0A 4FOYA 4XJWA 3PVEA 1W2NA 2A75A 2W1SA 4N43A 1VB2A 5C70A 3Q8BA 2QQOA 5IUQA 1UPIA 4CUCA 2PAMA 1VBC2 2Y6GA 4W8JA 5JOWA 1PIV2 3EMRA 2A6XA 2JDMA 3NKTA 4E9KA 4A7KA 1MS9A 3NNGA 5FZDA 3USSA 3HN3A 1PMHX 2JIJA 5D8AA 3O0VA 2QQIA 1B35C 3H3UA 1CESA 3WNKA 3ZSLA 3MYXA 2WN3A 1SLAA 2XJQA 5I0SA 1KEXA 1VRBA 3PU3A 4A3ZA 4A41A 4LIUA 3RMXA 1ZZ7A 3J7HA 2WKKA 3OBTA 1YQ8A 1H4GA 1LOBA 1ZZBA 2JDYA 3WF2A 4D8MA 5CAZA 4XDQA 4AEDB 4OUEA 4QWNA 1QOSA 3HBKA 3AP5A 3E6DA 3LKJA 2VVFA 1GZ9A 1AZDA 1A8DA 1IKPA 1COV2 1H8TC 1RGSA 5EQUA 4CSWA 1ZZ9A 5IW0A 1RXFA 2J1UA 4XBNA 4ATEA 4UFLA 3PMSA 2W1QA 5DUUA 5FY5A 4Q2FA 1F9KA 2WT0A 1Y9QA 3NV4A 5L19A 2YC2A 1T2XA 2J1EA 3CL1A 3NV1A 4MUVA 3U11A 1DF0A 2YY1A 3M3EA 1G9BA 4YM0A 3NNFA 1BK0A 1UKRA 2GSYA 3L2YA 2DVGA 3C8XA 2ARXA 2IXHA 2VOWA 3IDCB 4WVVA 1GQHA 1PZ7A 4RA0A 3ZYBA 3T1MA 4XZUG 1YQ5A 2WNEA 3ILNA 2TEPA 1HJFA 4PLOA 4RR3B 4DRVA 5A3UA 3CHXA 2R49A 4AI1A 2ADDA 5FP4A 1YUDA 3WXPA 1I9RA 3WDUA 2G4IA 1S0CA 1BHGA 4L11A 2GMMA 4Y1VA 5GKAC 5K0UC 4M0HA 4CCNA 2R041 4RGGA 2SLIA 4UF0B 5DDJ2 5F39A 4Q4Y1 1LODA 4C1XA 3DV8A 2YZ4A 2EIEA 2RM21 1DGWX 5JDBA 5KHGA 2W46A 3IAPA 3HT2A 4IESA 1YNAA 2HWE2 4DXRA 1DYOA 2YBSA 2IFRA 1OQDA 2ORZA 3T1LA 2W08A 1MZFA 2Z69A 3OGRA 5KR7A 4CEYA 1HRI1 3DPRB 3ZIXA 3OGGA 3A7QA 1NCRC 4PF1A 4CU8A 2JWPA 4FAHA 5GM0A 1GLHA 5CNAA 5FJKA 4CDQB 5BNNB 1XPWA 2RS12 2ID4A 4P14A 3VBOB 3S57A 2BU9A 2HBUA 4CEWB 2R6QA 4AK3A 2JDHA 1CZTA 3NAPB 2JDUA 4GMP0 1IS5A 1WLTA 4CDXB 2D6KA 4CUGA 1MZ5A 4AQSA 1RUI2 3LA7A 1MVEA 1PVC1 3D5OA 4XUNA 3K3OA 3PMEA 4YZ2A 2P6HA 4RHV1 1NX9A 4BOWA 2EALA 1TMF2 1ZA7A 2R043 3GCWA 4MGKE 4Q4X1 5DN2A 3H8UA 2OIIA 3WDXA 4A44A 4K8FA 1CN1A 4Q4Y3 3USUA 2D5FA 2X53S 4FTBA 2B7YA 2ZGNA 3WNOA 1LR5A 4L92A 5ABJC 3HN1A 4XPVA 5FPAA 4W50A 4FXGB 4JV4A 5FY9A 2VULA 2ZACA 4XCAA 3LA2A 1CZVA 1G6NA 3TNQA 2ADEA 1EUUA 3AVSA 1GZWA 1HJGA 5CISA 2ZX3A 5IK8A 1X9PA 2VUAA 2XH6A 1HRI3 4JZRA 4TWTA 5ANNA 3UJQA 2VQ0A 5L7OA 1ODMA 3KD4A 1AR61 3O1SA 3POGA 4P9IA 5FMBA 1NKGA 4DNYA 3R4SA 3KHCA 4LTAA 4K9SA 4LBKA 1XE7A 2JICA 3C7FA 2IWGB 4ZHNA 5DUVA 4ZKTB 1YXWA 3H0OA 5LBEA 4B7EA 2E63A 5CBLA 1IQAA 2WABA 5A70A 2Q8OA 3HJRA 1BCXA 1QWRA 1D4M1 4M0NA 4NO4A 4XMAA 1PVC3 5CFCA 1LB2A 4GAZA 2E7AA 3IDBB 1SLTA 2XL7A 4RHV3 2XQXA 1GNYA 4GD4A 2K46A 4Q4X3 5J36A 5GLTA 1R092 1QOOA 4LBOA 4MG2A 5C71A 2D5HA 1W2TA 3TN91 1W6QA 1ULPA 2E7TA 4YVSC 5C8WA 4LKDA 2GP3A 4KG8A 4ARYA 5KXDA 5FY7A 1HV0A 1S0JA 2ZGLA 1AHSA 3T0BA 3LPFA 1XNTA 4DQAA 3C7OA 1W6OA 3RS6A 1F4HA 4P9XA 1LNSA 1JZ3A 4Y26A 2Z5WA 1I3HA 1UU4A 1UZ0A 1ZBA2 5IYYA 2WFF2 3HNBM 1T6BX 1AR63 5FYIA 1IPJA 1OI6A 1ASJ1 3N9PA 4JDOA 4LBJA 2W39A 2A5ZA 1YIFA 2WT1A 2J7MA 4FO9A 2FZ1A 2QQWA 3AB0A 1MS0A 3H1WA 2WWSA 1SPPB 4P02B 1FXZA 2PAEA 3FLPA 1PO12 3IPVB 1JZ8A 4P9WA 4TZDA 3IB3A 1XNCA 4IEXA 1BKZA 4B7KA 3IT8A 5ERLA 4HKLA 1CVNA 2JG8A 1YCIA 4O65A 4RR3A 1LOGA 4B4QA 1HDKA 1V00A 5DAQA 1KDKA 3T0DA 1E5HA 3TN93 1UX6A 3SISA 4AWDA 3VBRA 1D2QA 5JZGB 2V4AA 1RUJ1 3NSTA 4CPBA 1G9FA 3NNMA 3A0NA 1NLRA 2QDNA 2VXJA 3FLRA 3OUJA 1D0HA 2VOTA 2YC4A 4WV8A 2DBIA 4P08A 2GN3A 3K48A 4HVOA 5FMCA 3KSCA 3ZXLA 3UYJA 3PUHA 5C9AC 4QGLA 3SHRA 3T30A 4BU2A 3I2DA 4EN9B 3FL7A 5A33A 4XF1A 4YG0A 1JW6A 4FPHA 1ASJ3 4PI0A 4XAEA 2ZKNA 5G05L 4CEYC 4W6YA 2I74A 4HBNA 4BM8A 4D6QA 4YM3A 5HV0A 1NUKA 4CUBA 4FPKA 2E31A 2L9LA 3KV9A 1MEC1 4JRAA 4W4ZA 2O0OA 4HKWA 3VBOA 4PLNA 5M0TA 2HYXA 1RXGA 1K12A 1ZM1A 1C4RA 4ZONA 1ULDA 1YFXA 5FPZA 1WBFA 3PJQA 5FXWA 4QKBA 5LA2A 2HWC1 3BCWA 1FMD2 5FBJA 5FUIA 1OD5A 3RQ0A 5IK7A 2ZXQA 3POIA 4CZSA 3PVOA 1JHJA 5GLUA 3H8XA 5BY5A 3FHQA 1RUJ3 5IVEA 3VBHB 2BERA 2AGSA 3N9MA 1EY2A 3MI8A 3IIIA 4SBVA 1JZ2A 3V0AB 3V0BA 4C1WA 3R0RA 4YZ1A 4NPLA 1H30A 3RI9A 2VUJA 3R4UA 3LCPA 5IJRA 4QQHA 4JKKA 1QJU1 2RV9A 5KXBA 3O1UA 2VTXJ 5I0DA 3E5UA 1G86A 3BKZA 1UU6A 1ZRCA 1D7PM 4KGGA 1LEDA 5LBFA 5KHJA 4Q5OA 2W92A 1CZSA 3HD8B 1Z7S2 5L7OC 4FP3A 3MW2A 4XDPA 5IVCA 3POBA 1PK6A 1DQ6A 1DBNA 2Z42A 3DYPA 1UN1A 4A3XA 2VG9A 3ES1A 1EPWA 1MEC3 1W90A 4RFRB 5IAVA 3EHKA 4HOOA 4D6SA 1W9WA 1VRH1 4IEWA 5DG2A 1C8M2 2G19A 4BXSV 4CP9B 2LUWA 1PMJX 4OHVA 5EJ1B 2AH2A 4QQLA 1Q43A 1C1LA 1EAH1 1IS4A 2ATFA 1JOJA 2ET7A 3M3OA 2HWC3 2YMZA 3ACFA 4FQ4A 2XJSA 1NXD1 3JQXA 4NWWA 4QX2A 2WAOA 3W59A 3P6BA 3ACIA 4NRQA 5FZ9A 2VQAA 1XSQA 3B5LB 1IPSA 3W5NA 2D6MA 2XB6C 2XG3A 5F2SA 5F5CA 3QOPA 3PUSA 4QT6A 5FYSA 2I07B 1LOAA 4NROA 1K45A 5FMOL 5DQ0A 5A3OA 1RHI1 3AP6A 4DY3A 2GZWA 1JYVA 1QJU3 4OI4A 1AR82 3HNYM 5F3CA 4Q1RA 4UWDA 1YO8A 2QJVA 4D0QA 4NHXA 2BNMA 4AI8A 3HEIA 1JBCA 5FYZA 2YG0A 4LK6A 4XACA 2JDPA 1GP5A 1KS4A 4LLFA 2B8MA 3NRUA 3ZDSA 1B35B 1AL21 3WP5A 3OYWB 2Q1MA 3GZTB 1WA4A 2K9ZA 1BBT1 4L97A 4MGTA 2BVBA 5JMOA 3GM8A 2A73B 4LBMA 1EV11 4YM1A 3WG4A 2QDRA 3WNNA 4AOCA 3MIGA 1JYXA 4LUMA 4ZXKA 1VRH3 3OEAA 3WT3A 3AFKA 4WM8A 1V6KA 5FZBA 2IFWA 2BBVA 1QHDA 2JD9A 3OOXA 1K5MB 3WNMA 1BLZA 4FXKB 5FZCA 4WVZA 5FZLA 1GWKA 2JG8C 2WBKA 4RR3C 1W8HA 3ZYHA 3J8F2 2RVAA 4HLTA 4HN1A 3T0AA 3LQCA 4B29A 1J1LA 1OF4A 2MHFA 2ZKLA 5FPVA 4DZGA 3VUOA 2CTVA 3MZHA 4GJZA 5FXZA 4LE4A 2H6BA 4DO0A 5LRSA 5AVPA 2BPA2 1WLWA 3AM2A 1BVVA 3PL0A 1ULGA 4QXBA 1POQA 2EXKA 3VN4A 2EAAA 1VR3A 1RHI3 2FDKA 1RVF1 1VB4A 4BCUA 4CU9A 5I91A 3H9AA 4FOVA 2FDGA 3N7LA 3SCGA 4ZU7A 2PAKA 1UF2C 1ACCA 3GBWA 4XJ8A 1C28A 5GALA 1W6MB 2DV9A 1W9SA 2A1XA 4AAXA 2WLPA 3WQ1A 1AL23 1U12A 1LU2A 1OQ1A 5K9YA 3BVCA 3NNLA 1LGBA 1BBT3 5FZOA 1AR71 2WA4A 4LHSA 2AR6A 3VL9A 3WNLA 4B1MA 2MNGA 2VW1A 1EV13 1VPHA 2AYHA 3RPQA 3TBDA 3ZSKA 3AVRA 1XNKA 3M70A 4MXWB 1G9AA 4CDQC 1W06A 3LDBA 4AE2A 1FV3A 3VBOC 4YG3A 4FBFA 3CZUA 4UW6A 3T2OA 2C5DA 3DCQA 4FPCA 2HLEA 2W87A 2X09A 3ORJA 1RTVA 4X8NA 1CAVA 2W68A 2V4VA 2ZHNA 3NAPC 1J58A 5HCHA 3GJBA 3E6BA 2DWRA 3NQHA 4NAMA 5FTTC 1UL9A 1WMDA 4Z1VA 4QPIA 5KBFA 4R4XA 4OZXA 2CSGA 1KQRA 2WRAA 2WDBA 1NCRB 4FVVA 4AQ2A 2VUCA 1W8OA 1WW7A 1AVBA 2B9VA 1IPKA 2J1AA 2FCUA 2P2KA 3WF3A 1CAUB 3AMQA 1JYWA 3S5QA 1RVF3 4LT5A 5JOXA 4AI2A 2Y0IA 3B93A 3B01A 1AR92 1NCQB 2CWSA 3KB5A 1ZZ8A 3RZLA 3LPGA 4CCOA 2DURA 5FO9B 1SG3A 1GKBA 3E97A 4HKOA 1NE6A 3NV2A 2ZCWA 4GH4B 2KXLA 1Q8PA 3JBG1 1Y9MA 4IGQA 4IUGA 2J22A 3UKTA 1AR73 4BQXA 1DCSA
chains in the Genus database with same CATH topology
1XE0A 1XB9A 1K5JA 4N8MA 3T30A 2VTXA 4CA9A 2P1BA 5EHDA 2VTXJ 1NLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XE0 A;  1XB9 A;  1K5J A;  4N8M A;  3T30 A;  2VTX A;  4CA9 A;  2P1B A;  5EHD A;  2VTX J;  1NLQ A; 
#chains in the Genus database with same CATH topology
 4MHR A;  4UT5 A;  3QBQ A;  1PK6 C;  4OUS A;  3GHN A;  3I2I A;  2YXS A;  4UFH A;  2YGM A;  1GFF 2;  1N3O A;  1DHK B;  4KH9 A;  4BME A;  4JTO A;  4CP2 A;  4RSU A;  3KCY A;  4KWU A;  5JIA A;  1VE0 A;  4P9Y A;  1BK1 A;  3WG3 A;  1GYK A;  5ABJ B;  2VZO A;  1F5J A;  2CDO A;  3KGZ A;  4A42 A;  1D2S A;  3WP4 A;  5JSR A;  2DFC A;  1RMU 3;  2WZ8 A;  2Y6K A;  2ZS6 B;  3WHT A;  3I2H A;  3H42 B;  4QM8 A;  3D6E A;  3AJZ A;  4FPF A;  1OOP A;  1FI2 A;  3JZV A;  4KBB A;  3UJO A;  1WME A;  3L2H A;  4LK7 A;  4PIY A;  4IE7 A;  1S0D A;  4N9H A;  3V65 A;  2W2I A;  4ITC A;  4WM7 A;  2DU0 A;  4IEY A;  2ZX1 A;  3I3Q A;  4KI5 M;  1ZYB A;  1GU3 A;  4BQ1 A;  3KLS A;  1O8P A;  4N43 B;  2VZ3 A;  4LPL A;  1S2B A;  3WDV A;  4LO7 A;  3TEX A;  1V6M A;  4HON A;  4F83 A;  2H6C A;  2BFU L;  3ZM8 A;  3AX4 A;  2FDJ A;  2VVD A;  2B42 B;  1SLI A;  3POY A;  2B9U A;  2DCK A;  1A34 A;  4LO5 B;  3JBG 3;  5D8A B;  3AKQ A;  4QHO A;  2V5Y A;  5KC6 A;  3IMN A;  5E1R A;  1QIQ A;  1O4Y A;  2R04 2;  1JMU B;  4HT1 T;  1W05 A;  4Q4Y 2;  4G4F A;  1GR3 A;  2BGP A;  3VLB B;  2RJL A;  1UYP A;  1KDM A;  2RM2 2;  2Y33 A;  4QKF A;  4EN0 A;  4QQP A;  2VQT A;  1QJX 1;  3BOW A;  4LOS A;  4WM8 C;  4JX0 A;  1QDC A;  2C6S A;  4GAL A;  5J37 A;  3DEC A;  3NJV A;  3NWK A;  4D69 A;  4NR1 A;  4IET A;  2QQN A;  4Y33 A;  1IHM A;  1US2 A;  3DL3 A;  4ZS3 A;  1HRI 2;  4GMP 1;  5LAT A;  2PHU A;  3ROU A;  4EJR A;  2ZOE B;  2J1S A;  4ORF A;  1TE1 B;  2XPJ A;  1L7Q A;  2YU1 A;  1R08 1;  5T5O A;  4EV0 A;  4AFC A;  2A71 A;  3DN7 A;  4NII A;  2UYA A;  1X9T A;  1BXH A;  2DCZ A;  1BVP 1;  4IEV A;  4FFI A;  4DXT A;  2ZHL A;  2JEM A;  4I02 A;  2PHR A;  1XE8 A;  5KHH A;  1XND A;  4BXF A;  2Y8K A;  2R0H A;  5GLW A;  1PVC 2;  3LSE A;  1LHV A;  4O9E A;  1RIT A;  1HXS 1;  2P3Y A;  3MEP A;  4RHV 2;  4Q4W 1;  4A6S A;  4Q4X 2;  2A6Z A;  4Y4Y A;  4BK5 A;  1U0A A;  1AYM 3;  1LCL A;  2LTN A;  4NAO A;  4QPW A;  3DKQ A;  1SFY A;  4XIO A;  4BLJ A;  3AL5 A;  5F5I A;  1WWY A;  2GNB A;  2ERF A;  3VZJ A;  5JIU A;  1QJX 3;  4ZU5 A;  2NZ9 A;  5LEK A;  1S55 A;  5HI0 A;  5DAV A;  4O7X A;  2NLR A;  2WSV A;  1HB4 A;  2R30 A;  2OYZ A;  1W2A X;  1GV9 A;  4OI2 A;  3I97 A;  4BIF A;  3RNS A;  4UBG A;  4GMP 3;  3PVB B;  1Q8Q A;  4YVW B;  1KRI A;  4YW7 A;  1O4Z A;  4GKY A;  4YG6 A;  1SCS A;  2C24 A;  3AZY A;  3J9S A;  4QPI C;  5EYX A;  3N4M A;  1R08 3;  5A32 B;  4CEY B;  3TEZ A;  4XF3 A;  5DG1 A;  1JOB A;  1CGP A;  3MPB A;  4F7Z A;  3JB8 A;  2A3Y A;  3FHA A;  3MV1 1;  1HLC A;  3SH4 A;  2WFP A;  2WIN B;  1J3P A;  4XFA A;  3KF3 A;  5FZ4 A;  3LIH A;  5FMD A;  1WLD A;  4CEW A;  4OFG A;  5FLI A;  2D3R A;  4K6B A;  5KXC A;  1TME 1;  2LRO A;  2QNK A;  1D4M 2;  3I4I A;  2C4X A;  2XLF A;  2FDF A;  2ZBJ A;  1HXS 3;  4GWJ A;  2WII B;  1F31 A;  3JXS A;  5KHK A;  1GQG A;  3BN6 A;  2WLQ A;  4Q4W 3;  3RWN A;  1AXZ A;  3MHZ A;  2D6O X;  3KCX A;  3ME2 A;  2OW4 A;  2GNM A;  3PU8 A;  4GH4 A;  4LBL A;  3X29 B;  4NE9 A;  1H2N A;  4UFK A;  5A7P A;  3TN9 2;  1RUC 1;  1W03 A;  3DUI A;  2WNV B;  1DIW A;  5AVA A;  3LWC A;  2EXI A;  4HSL A;  5FOB B;  4QHB A;  2VD7 A;  2ZHM A;  4ES8 A;  3GNE A;  1TVG A;  3LEG A;  1QF3 A;  1X82 A;  1JZ5 A;  5T52 A;  2OA2 A;  3KT4 A;  1MS3 A;  2WWU A;  1WZX A;  2MEV 1;  3OBZ A;  3VDC A;  1DQ5 A;  3ZLI A;  1C3H A;  3OPZ A;  2ZX0 A;  2YB7 A;  1O3S A;  2VCB A;  3FUO A;  4AF9 A;  1IGO A;  2J1R A;  5IVF A;  3ASI A;  1XOY A;  3AMH A;  1DFQ A;  1OOP C;  1WW4 A;  3CKH A;  3W58 A;  4KU8 A;  1ASJ 2;  5CAD A;  5D1I A;  4DUX A;  2VY0 A;  1GBG A;  5L7O B;  2PA7 A;  1ZZC A;  4WM7 C;  3UKN A;  4AHZ A;  1OXC A;  2CY6 A;  1NZI A;  3I59 A;  3VD3 A;  3N7M A;  5FY0 A;  3BGA A;  3Q8A A;  5F37 A;  2G9F A;  3AYC A;  1QXR A;  2QQP A;  4FTE A;  5K7P A;  5IAT A;  1TME 3;  4QQ2 A;  1OBN A;  2VNR A;  5JPM B;  2DUP A;  3IKW A;  5FV3 A;  2VMH A;  4FPL A;  4H55 A;  1NXM A;  4Q8L A;  2KA3 A;  2BYV E;  4Q29 A;  1YC6 1;  4OHZ A;  4CRQ A;  3ILF A;  1JU4 A;  1QH7 A;  1UWW A;  2JIG A;  4WVW A;  5CFC B;  1XXN A;  5FCC A;  2Q1F A;  5FXV A;  1UY4 A;  3D4K A;  2GU9 A;  1HN0 A;  2XUE A;  4IE5 A;  2W52 A;  1RUC 3;  4IE0 A;  2XDV A;  3U4X A;  1RUJ 2;  5CU1 A;  2EIB A;  2P17 A;  4CVU A;  4NPR A;  3FZ3 A;  3ZXG A;  1W6Q B;  2NN8 A;  5FYY A;  5G04 L;  1LHW A;  1W0N A;  1YFY A;  3TAY A;  4MYE A;  2A6W A;  3C7E A;  3AZZ A;  1AJO A;  2LRP A;  5FPU A;  1GWM A;  1TZO A;  1CAW A;  2MEV 3;  5EJ3 A;  3PHM A;  4HAN A;  1W6O B;  3BAL A;  1SMV A;  5BUV A;  2O8Q A;  5D21 A;  5HPO A;  1K5M C;  4QX8 A;  5IK5 A;  2RS5 1;  1X7N A;  1C8N A;  2K0G A;  2Y26 A;  5LY1 A;  1QGL A;  5H9Q A;  1RJ8 A;  2ET1 A;  3ENR A;  3CDZ B;  5A3M A;  4IQP A;  3EQE A;  1GZT A;  4GZ9 A;  1ALY A;  5K8S A;  3MLJ A;  1MEC 2;  1PGS A;  5GZF A;  3ZIW A;  1OKO A;  3QLQ A;  3I2F A;  3TB0 A;  3VDA A;  1X8M A;  1DLC A;  2R07 1;  2QQL A;  3ZXK A;  1XNA A;  4NN0 A;  4Y1Y A;  1CR7 A;  2ZX2 A;  4I0B A;  2RMU 1;  4ARX A;  4KWJ A;  4K40 A;  1O7F A;  3THT A;  2OS2 A;  2D43 A;  1CX4 A;  3B9C A;  3LZZ A;  4ZXE A;  2JG8 B;  1VLN A;  3M2M A;  4QDR A;  4QKN A;  5F5Q A;  3FLT A;  4QX1 A;  5L9B A;  2FDI A;  1WCS A;  2XGX A;  3RZM A;  2HWB 1;  2V09 A;  4HL0 A;  3ZN5 A;  3ZYR A;  3ZPO A;  3ATG A;  4LQR A;  1YI7 A;  2HEY F;  1N1S A;  4NUB A;  5LRR A;  3VBR B;  4K21 A;  3D82 A;  5JOY A;  1F4A A;  3O12 A;  4BQ5 A;  2V5D A;  3HVD A;  2F6B A;  5IVB A;  1HRV 1;  1QJU 2;  1UOF A;  4ONU A;  2XXZ A;  4XUO A;  1OFN A;  1O6U A;  2WNU A;  3OF1 A;  5C3Q A;  3MV0 1;  1KXG A;  2WR9 A;  2PHT A;  3CZJ A;  1CPM A;  1WKY A;  2SBA A;  3AKR A;  2RS5 3;  2AZ5 A;  2WAA A;  1LUL A;  2ZGT A;  4L9B A;  4CCE A;  3ACG A;  4AG4 A;  1H1I A;  4YVW A;  5A33 B;  5L36 A;  5JXH A;  4FPO B;  2K2S A;  4FFF A;  1JYN A;  5A32 A;  2HWD 1;  1RUE 1;  1UU5 A;  4CYD A;  2NPI A;  5FK7 A;  3E5X A;  1L7L A;  3Q8E A;  2R07 3;  1VRH 2;  5FY1 A;  4CCJ A;  3CJI A;  1F35 A;  1H6Y A;  2PFW A;  2RMU 3;  1DQ4 A;  2GC2 A;  1EAH 2;  4IGO A;  1UYZ A;  3O7O A;  5IVY A;  5LY2 A;  5SV8 A;  1NCQ C;  3SIT A;  3PLQ A;  5FPL A;  2VNO A;  3ZX7 A;  2OUJ A;  2HEW F;  1MS5 A;  3K75 B;  3OUI A;  5I8Y A;  3APB A;  5FP9 A;  5BNQ A;  3I2G A;  4GH4 C;  3LOB A;  5FZ1 A;  4Q4V 1;  4XUQ A;  2HWB 3;  5BV6 A;  5JR2 A;  5IFT A;  3RG0 A;  4ASK A;  1ODN A;  2WNV A;  3H50 A;  1UMI A;  1OA3 A;  4Q0S A;  1RHI 2;  3MPP G;  3OPW A;  5FPB A;  3CBN A;  3V0B B;  2VME A;  4GXL A;  1HRV 3;  4YAR A;  2E9Q A;  5SV5 A;  4HK8 A;  1C1F A;  2ZPX A;  1LRH A;  1BMV 1;  1XYP A;  3ZYG A;  4UW5 A;  4LO6 B;  1D0G A;  2QZ2 A;  4GJY A;  4V2W A;  4EYU A;  4UFM A;  2D6N A;  1JUH A;  5FO7 B;  3H7Y A;  2ZZQ A;  5FKC A;  2WS9 1;  4IDZ A;  2PLV 1;  4YWA A;  2W1W A;  3VZO A;  2Y6J A;  1ND3 A;  2C26 A;  1BBT 2;  4I30 A;  1QXP A;  4K7J A;  2W5F A;  2HWD 3;  1RUE 3;  4J1W A;  3JD7 1;  4XE9 A;  1EV1 2;  1PK6 B;  1V70 A;  3AZW A;  1U5Y A;  1V6L A;  1K3I A;  4AGV A;  4BDV B;  5J1X A;  3R6S A;  4N43 C;  4MHU A;  4ZY9 A;  1VBE 1;  5LAS A;  2X05 A;  4ISR A;  4XQ4 A;  2WZP P;  1HQW A;  2PYT A;  4Y5Z 0;  1J83 A;  3WR0 A;  2TUN A;  4R4Z A;  4LHK A;  4O61 A;  2ZML A;  4CXY A;  4LUK A;  3MBW A;  5FYH A;  3IAQ A;  3VHP A;  3VBF A;  2JKB A;  1KIT A;  3B9I A;  4LKE A;  5D8A C;  4CPB D;  1EPZ A;  4Q4V 3;  3WF4 A;  2WO7 A;  4AW7 A;  2JG9 B;  4BA6 A;  5FZI A;  1GAN A;  4PDW A;  3V56 A;  3VKM A;  2C9A A;  4LIV A;  4BZ4 A;  1RVF 2;  2HYK A;  1UXX X;  4ZS2 A;  3VKL A;  4XBL A;  1RUF 1;  4HVQ A;  1WCD J;  3W20 A;  2CAU A;  2EVX A;  2YFU A;  5HV4 A;  2DTW A;  1DZQ A;  2YBK A;  4Q0P A;  4XW3 A;  3PUI A;  4NIH A;  3WUC A;  3OBA A;  2WS9 3;  4M3C E;  5CFD A;  4IE4 A;  2PLV 3;  4AVV A;  4Z2A A;  2JD4 A;  4LA2 A;  1AR7 2;  2PMW B;  1S2K A;  1IZ3 A;  4JC1 A;  5A3W A;  2VQU A;  2WO2 A;  3JD7 3;  4HMZ A;  4XUP A;  4ZZ5 A;  1FAY A;  4EE2 A;  3ITQ A;  3K46 A;  5IWF A;  3EB7 A;  2RR1 1;  1VBE 3;  2CWM A;  3CIH A;  5JI9 A;  3BB6 A;  2F4P A;  1O3R A;  4D3W A;  1VAL A;  4NRM A;  4WM8 B;  2ZEW A;  1H1M A;  1XE0 A;  4G3Y C;  4XDO A;  2BZD A;  5DUW A;  3VV1 A;  3QH7 A;  2QQJ A;  3JB4 C;  4AVT A;  3HMY A;  4L8Q A;  4CCL A;  2VMG A;  2WZR 1;  4J25 A;  1O5U A;  3ZYJ B;  1RUO A;  3RJR A;  2P34 A;  4OQ9 A;  2DBN A;  1WMF A;  3LF7 A;  3OY8 B;  4L99 A;  4XUT A;  2CDP A;  2GAL A;  2VC9 A;  4XFI A;  4ZZ8 A;  4K3U A;  3FN9 A;  4D94 A;  3WF1 A;  5LCW L;  4FP2 A;  5JCT A;  1RUF 3;  2JE7 A;  4M4P A;  4OVE A;  1FNY A;  2WN2 A;  2WO1 A;  1BZW A;  4XAB A;  2VL4 A;  1OD3 A;  3WQB A;  4QAW A;  4BIO A;  3JBG 2;  3HAG A;  4AHW A;  3WNP A;  2N7G A;  4AFM A;  1XU1 A;  4YVW C;  2XML A;  3H8R A;  1BYH A;  3VD5 A;  4FSJ A;  5FZO B;  2IXI A;  3ZDV A;  3N9O A;  2H0V A;  2RR1 3;  2QE3 A;  1VAV A;  4LOT A;  3DYM A;  3A0K A;  1CJP A;  1VBB 1;  1SDD B;  3GZU C;  3KQR A;  4GWI A;  3HBZ A;  5C6C A;  2XJR A;  1OKQ A;  2YC0 A;  2WZR 3;  1CAV B;  1LEM A;  2LM3 A;  3POE A;  4QDS A;  3A21 A;  2VZR A;  3NO8 A;  4Q26 A;  3Q8C A;  5ACA 1;  3T2P A;  1DG6 A;  4AHX A;  4D7S A;  4JKM A;  2W47 A;  4C8D A;  3U75 A;  1W0O A;  5FY8 A;  4QPI B;  5DXD A;  4YW5 A;  5JVV A;  4DB5 A;  1OUX A;  4UXA A;  3UT0 A;  5IK4 A;  3KHB A;  3MUZ 1;  2WNV C;  3W9A A;  3IZO A;  2IVI B;  3J4U H;  4S2F A;  3UGG A;  4BLI A;  4BQY A;  4XBQ A;  3ILR A;  1B09 A;  1LJ7 A;  1W28 A;  1A6C A;  3UGH A;  3LSD A;  3FFQ A;  4MXV A;  3ABZ A;  1RIR A;  2PHL A;  2ZGS A;  4YGD A;  3UK9 A;  1SLL A;  5CG9 A;  4BH9 A;  1CIY A;  1OT5 A;  5CA6 A;  5CB7 A;  4MV2 A;  4XFB A;  1OQE A;  2JXA A;  1A3K A;  3A4U A;  5FQ0 B;  1OLR A;  4Z2W A;  3H3L A;  1W39 A;  1ND3 C;  1W04 A;  2GNT A;  1DDL A;  3AMM A;  2A3W A;  1GOF A;  3OD4 A;  4YZ3 A;  1KD7 A;  2W0X A;  1K5J A;  3PUQ A;  4LHL A;  3RMY A;  1S4C A;  3JQW A;  1QJX 2;  3UV9 A;  4BQW A;  4XTP A;  4Y20 A;  1VBB 3;  3VL8 A;  4C0B A;  2Y64 A;  3OEB A;  4NVP A;  2Z2S B;  5T5L A;  4BJ0 A;  3SH5 A;  3C7H A;  4X6R B;  2Y38 A;  5LK7 B;  1UCX A;  3IBM A;  5ACA 3;  1Z78 A;  3BTX A;  3LDR A;  5DAX A;  3HWJ A;  3UGF A;  3SKJ E;  3PUR A;  1XNB A;  1ULF A;  5CZK A;  4HPK B;  4QB6 A;  3U10 A;  5CFC C;  3VBF C;  5JXG A;  1H2L A;  1OOP B;  4YW1 A;  4CDU A;  1ZVF A;  1Y9G A;  2ETE A;  4XC9 A;  1VJ2 A;  1JYI A;  1W8U A;  1H2M A;  1VP6 A;  2VTX A;  4DXZ A;  4WM7 B;  2JG9 A;  5HBA A;  4QU2 A;  1G9C A;  5C3P A;  4YW3 A;  4XCB A;  4U36 A;  3BU0 A;  1OFS A;  1ZRR A;  4LBQ B;  3WP3 A;  1S1A A;  3KM5 A;  4XVH A;  3KT1 A;  4V2V A;  4COW A;  1POV 0;  1BEV 1;  1OPO A;  4YW4 A;  2DCY A;  1HXS 2;  1OH3 A;  1UIJ A;  4XQD A;  3I2K A;  1ZNP A;  3O5S A;  3J7M A;  2VCM A;  3P3N A;  4Q4W 2;  4RQP A;  4UFI A;  5C5T A;  1GOH A;  5DUX A;  4FAG A;  5FZM A;  4A45 A;  1CX1 A;  3RWK X;  4I01 A;  4RD7 A;  2Z4F A;  4NHY A;  1AX1 A;  2JJ6 A;  1Q5O A;  1WGP A;  1OLM E;  2XQR A;  5FPX A;  5L73 A;  4NPM A;  4EWA A;  3T4H B;  1MQT B;  2QFE A;  1SHW B;  3FFZ A;  3B3Q E;  2Y6L A;  4P00 B;  2R1B A;  5FP8 A;  4MX3 A;  5H9P A;  5A3T A;  3NMB A;  1J84 A;  2YHJ A;  2NM1 A;  4R9D A;  2D40 A;  4E27 A;  2D98 A;  3LIG A;  1ND2 A;  4AFA A;  2ZHK A;  3AJY A;  1SFP A;  5FYV A;  3LEI A;  1AYN 1;  2Q5T A;  3O1O A;  1PX3 A;  3O14 A;  3FBM A;  4CXW A;  5FZH A;  5DZG A;  2YV8 A;  3IMM A;  2Q4S A;  2YFZ A;  3FJS A;  4IV3 A;  1M06 G;  4D7T A;  4YGC A;  3K77 A;  3OY8 A;  1H9P A;  4B1L A;  4AI9 A;  5FDB A;  5EPA A;  4MSV A;  3T2T A;  3J26 N;  5L9V A;  1OF3 A;  3P5B A;  3VBR C;  5J48 A;  2OUH A;  1TME 2;  3WCS A;  1X8E A;  2BWA A;  2O1Q A;  3H7J A;  1OLM A;  3SCF A;  1BEV 3;  3ZFG B;  3ZFE A;  4IE6 A;  1ENX A;  4BMB A;  4CA9 A;  4CCM A;  1PZ9 A;  3TEY A;  4XF9 A;  4J1X A;  3NL1 A;  5F32 A;  4CCD A;  3NJZ A;  2VZP A;  4M3C F;  1YWK A;  3RYR A;  1WD3 A;  2VCA A;  1E5R A;  1QQP 1;  4RGK A;  1RUC 2;  5FFO C;  2XBO 1;  2DF7 A;  2ZEZ A;  4IEQ A;  1J59 A;  3VDB A;  3OGJ A;  5F9T A;  1IOA A;  3B7M A;  3VBS B;  3ZSJ A;  2JEC A;  3MIE A;  5EIY B;  4AFD A;  3B02 A;  3WDY A;  4QM9 A;  1SQ4 A;  4PHZ A;  1Q8S A;  1IG3 A;  2EIC A;  1MZ6 A;  3RDI A;  2XJT A;  4NHK A;  1R09 1;  2MEV 2;  3OSD A;  5EZW A;  4B8E A;  5EP9 A;  1N47 A;  4HN0 A;  4QGM A;  4YZ4 A;  1LU1 A;  1OC1 A;  3K4A A;  2W3J A;  3MF6 A;  1N1T A;  3EJK A;  5J96 B;  4L2N A;  4K1Y A;  1RMU 1;  1AYN 3;  2NQY A;  5FWE A;  1Y4W A;  3S0M A;  4TSV A;  1W6N B;  3VKO A;  4RN5 A;  4XMI A;  3UET A;  3HR9 A;  4LBQ D;  3WEZ A;  2AEY A;  1DYK A;  2VPV A;  4N9I A;  4DEV A;  1EUT A;  4DY5 A;  3FHI B;  3U0Z A;  1T6G C;  4JVA A;  1NA1 A;  1J3R A;  1ZBA 1;  2YBP A;  1GP6 A;  3NW4 A;  1KFU L;  5LWB A;  5ANQ A;  1S2E A;  1F15 A;  1YHF A;  3I3D A;  5B4N A;  1VMJ A;  1JXN A;  3J7N A;  4JRL A;  2PXJ A;  4R52 A;  3WP6 A;  3GXU A;  2XLG A;  4URT A;  1SCR A;  4IND A;  2VAU A;  1SDW A;  3GAL A;  1QQP 3;  2R16 A;  4PQ9 A;  3SLI A;  5FQ0 A;  3PIG A;  2P4E A;  2XBO 3;  5FP7 A;  3AC0 A;  1RJ7 A;  1X36 A;  1JI6 A;  1QNY A;  3I2J A;  3PJY A;  3TNP B;  2BNN A;  3GCX A;  1YRZ A;  4FCA A;  5DPN A;  4XFC A;  1LGN A;  2BUK A;  5EXO A;  4H7L A;  4Y1U A;  1R09 3;  1UYX A;  2VGD A;  2OPK A;  2P5B A;  3VB9 A;  1NE4 A;  4JHZ A;  1UZZ A;  2TBV A;  5AFE A;  4K20 A;  4OUL A;  2RS5 2;  4H2A A;  3VGI A;  1O59 A;  1W6P A;  4LXL A;  3DXU A;  1RED A;  4BIS A;  4CP0 A;  1JOP A;  4HPK A;  1J1T A;  1W8N A;  2E33 A;  4Q27 A;  1E57 A;  1GMM A;  1UXZ A;  4CDU C;  2VXR A;  1V6N A;  1JZ7 A;  1GOG A;  2XON A;  1WW6 A;  2JG9 C;  1ZBA 3;  2JE9 A;  2DCJ A;  2HH9 A;  2R07 2;  3I59 B;  1APN A;  3HT1 A;  3CF6 E;  3LOI A;  5JI7 A;  5C8C A;  4LBQ A;  3U07 A;  2QCS B;  4GQ7 A;  4LHN A;  2RMU 2;  4MOA A;  1RIN A;  3T08 A;  1N3Q A;  4IV1 A;  2E7Q A;  1JTZ X;  1DGR N;  1UX7 A;  2VBD A;  3KQ4 B;  1QJY 1;  1WMX A;  4OHY A;  2CNA A;  3M3Q A;  1S0E A;  1DGW A;  1PGL 1;  4XTM A;  1I1E A;  4LMF A;  1G8W A;  3N9L A;  2P37 A;  4XJA A;  1H4H A;  4LIT A;  2HWB 2;  2XKO A;  2JB8 A;  3CO2 A;  3S5A A;  4AI3 A;  5A6X A;  3SC7 X;  4Y24 A;  2DUQ A;  4ASL A;  2RDR A;  3IWZ A;  2CGO A;  2FZ2 A;  1PM7 A;  2CL2 A;  3POF A;  3CMG A;  3E5Q A;  3FE5 A;  1AYM 1;  1MQT A;  1HRV 2;  1OPM A;  3TYJ A;  3BTY A;  4HG6 B;  1A8M A;  2ZAA A;  4EZH A;  4M00 A;  1CAW B;  4TYS A;  2D7F A;  1QH6 A;  1XQN A;  1CAX A;  5J7M A;  1NQJ A;  5A7W B;  5C4W A;  1R64 A;  1ND2 C;  4QXH A;  3VBU B;  5IVV A;  1GSL A;  1FT9 A;  2FDH A;  1XBF A;  2JB4 A;  4CTE A;  1JOD A;  4YM2 A;  4QPG A;  3K4Z A;  1RUE 2;  1X33 A;  3WX5 A;  4IV3 C;  4N90 A;  5IVJ A;  2BGC A;  1EYB A;  2BFU S;  3VHO A;  3PTY A;  1UOJ A;  4YFW A;  1W3V A;  4NIG A;  1UZY A;  2I2S A;  4MGY E;  1LES A;  5IAX A;  1Z7S 1;  4FPY A;  4CUA A;  3ZFE C;  2HWF 1;  2VH9 A;  4BYY A;  1OMI A;  3ZFG A;  2BBA A;  5H9S A;  4XYX A;  1WCQ A;  4TLG A;  2VM9 A;  3TRS B;  1QJY 3;  2BP6 A;  5B2G B;  2R7E B;  3GBG A;  4YGE A;  1UPS A;  4AVC A;  3ZVX A;  1L3J A;  4Q4V 2;  4QD2 A;  4XZP A;  1WBL A;  3OG2 A;  2YRO A;  5F6K A;  5FZK A;  2NMN A;  5FJH A;  3D3A A;  1FOD 1;  3LA3 A;  1O5L A;  3IDE A;  4COV A;  2NP0 A;  1FMD 3;  3VBS A;  1DGL A;  1KGY A;  1IS3 A;  5JMC A;  5KXE A;  3U78 A;  1VBD 1;  3VZL A;  3WVJ A;  4Q0V A;  1F5F A;  1JUI A;  4QPY A;  2VZS A;  1V9U 1;  3KCC A;  2WS9 2;  4XQW A;  4HK9 A;  2PLV 2;  2WNU B;  1ZRF A;  3GJA A;  3OBR A;  2HKX A;  4XXA A;  2Q30 A;  5JWP A;  5E8A A;  4PT6 A;  4HSJ A;  1BJQ A;  1OUS A;  1QMJ A;  1W6N A;  3I3M A;  2R0F A;  3JD7 2;  5F8P A;  4ERO A;  1AR6 2;  3NJX A;  5FZ6 A;  1GP4 A;  2YU2 A;  4WVM A;  1GQP A;  2BTV C;  1VBE 2;  5K0U A;  5KC5 A;  4OZO A;  4OI0 A;  2ZJC A;  1Z7S 3;  1RUH 1;  1TNR A;  2HWF 3;  4NHL A;  5I93 A;  2BV4 A;  3CJI B;  4MO3 M;  1UOB A;  1H8V A;  1LTE A;  2HBT A;  3I54 A;  3R4D B;  1DZT A;  4AQ6 A;  1FV2 A;  4F3J A;  3VZN A;  2W95 A;  3AYA A;  3WF0 A;  3UKV A;  5I0U A;  3M3I A;  2CGP A;  4XET A;  4E4H A;  1YQC A;  1AF9 A;  3V64 A;  5FLH A;  3VKF C;  1CJD A;  1FOD 3;  4NOT A;  3WHU A;  4TTG A;  5AC9 3;  2DUO A;  4H14 A;  5F5A A;  4MET A;  2ES3 A;  2G1M A;  2EIG A;  4QX0 A;  3N35 A;  1RUF 2;  4WZC A;  5FZF A;  4URA A;  1VBD 3;  2G9Z A;  2F17 A;  1UZW A;  1LAJ A;  3RGB A;  2OT7 A;  1ULC A;  2VTF A;  3L9J T;  1NQD A;  1V9U 3;  2D97 A;  2W1U A;  3MIH A;  1HW5 A;  3NJY A;  2XUM A;  4MAD A;  3LGR A;  5APA A;  5FZG A;  5FZA A;  5BXX A;  3BIW E;  5LA0 A;  4DUV A;  3IM0 A;  3KWV A;  2UWC A;  3THP A;  3BIE A;  2IZW A;  1ND3 B;  2KM2 A;  2QZ3 A;  1GNZ A;  2ZMK A;  2B5H A;  2RR1 2;  3HPN A;  2HJI A;  2VJX A;  2Y6H A;  3ON7 A;  3AKS A;  3K3N A;  4RS5 A;  5FUN A;  5GZE A;  3QH6 A;  4Q0U A;  3RI8 A;  1MR5 A;  1RUH 3;  1NY7 1;  3T4V A;  3WCR A;  4JDM A;  3BTZ A;  4MGQ A;  3ACL A;  4S2H A;  3WY6 A;  4BB3 A;  2Q1Z B;  1PHM A;  2R1D A;  4GB3 1;  4IV1 C;  3ZKY A;  4N8M A;  2WZR 2;  1PO2 1;  2OZJ A;  2VOK A;  2GN7 A;  2UUR A;  1MVQ A;  3ZFF A;  1G9D A;  2ILM A;  5DZE A;  4PIZ A;  5FXX A;  4D6R A;  4AEJ A;  3LE0 A;  2BOI A;  3VBF B;  3OGS A;  4FFG A;  1HQL A;  2LW8 A;  4QDQ A;  3RYK A;  3ZMO A;  1LKN A;  3VDD A;  2VZQ A;  1HB2 A;  3AFG A;  3MIC A;  5EJZ B;  4PDW B;  3K51 A;  1MQT C;  3MW3 A;  1UAI A;  5FY4 A;  4Y4R A;  1JHN A;  4JHT A;  4UOJ A;  4YNI A;  5J3U A;  1WCU A;  2VU9 A;  3F2Z A;  2VZ1 A;  1AXY A;  4R9C A;  2FQP A;  4XJ9 A;  3URF A;  5A7Q A;  1BQP A;  3HIF A;  3WG2 A;  1ZRE A;  1DU3 D;  4LKF A;  2XR4 A;  4R8H A;  4A4A A;  5C4W C;  5CFD B;  5A7W A;  1U5X A;  3VBU A;  3MGU A;  5LBC A;  3RZJ A;  2BW8 A;  3E6C C;  4AZZ A;  2UY9 A;  1AR9 1;  1N3P A;  2ZEX A;  3ZXJ A;  4A7Y A;  4QPG C;  1GZC A;  2XL9 A;  3WD5 A;  1LHU A;  2OVU A;  1OA2 A;  3C2U A;  5FAX A;  2ENR A;  1IQD C;  1W0P A;  4V1P A;  4Y22 B;  3VD9 A;  4HZF A;  4ES9 A;  1FNZ A;  2C0Z A;  3CEW A;  2GDF A;  2WT2 A;  4LO8 A;  3SMH A;  2EF6 A;  1GIC A;  1FPN 1;  1MPX A;  1VBB 2;  1S0G A;  1IS6 A;  2IUW A;  3E1F 1;  4LUL A;  5EWS A;  2B45 X;  5CYY A;  5DAB A;  2AUY A;  1VAK A;  2YPJ A;  4GB3 3;  4YVS A;  3ZFG C;  1PO2 3;  5ACA 2;  1TEI A;  3GHM A;  4H7M A;  1Z0H A;  2GME A;  3WW3 A;  4DEQ A;  2HWC 2;  3EO6 A;  4MLO A;  4AGG A;  3Q9O A;  2X5I A;  4IER A;  1PZ8 A;  2ZEY A;  4K8R B;  2P3I A;  1GUI A;  2PEL A;  4M3C B;  3N7K A;  4QU1 A;  3SKV A;  4AHY A;  4AQT A;  5JLV A;  4MGZ E;  3LEM A;  3TWI A;  5HCA A;  4D7Y A;  2FCV A;  3VBS C;  2ARB A;  4YZ5 A;  1V6O A;  4ZU4 A;  3ZO0 B;  4DMI A;  3U4S A;  4N7U A;  3CNA A;  5AC9 2;  3RYP A;  1HQN A;  1XC6 A;  3FBY A;  3VD7 A;  1YI9 A;  3WQ0 A;  4OI1 A;  2KR2 A;  1W8Z A;  2ZGR A;  1SZB A;  5T50 A;  4AEK A;  5A3P A;  2WA3 A;  2XLA A;  1RUG 1;  2WUH A;  3ZXF A;  4RFT 0;  1OVP A;  2Z79 A;  4XUR A;  1WD4 A;  1YJK A;  3ZXD A;  2QBX A;  1AR9 3;  5A7N A;  2ZGK A;  1WCK A;  3ZN4 A;  3LDK A;  3ZSE A;  2WJS A;  4AYU A;  2BDR A;  2JDK A;  2XJV A;  3ECQ A;  1FPN 3;  2DVA A;  4EQV A;  2FD8 A;  4XIK A;  1NAE A;  2XHN A;  4UW3 A;  4LO4 B;  5FUP A;  5FYB A;  1UY3 A;  1JS9 A;  5FP3 A;  1R1A 1;  1HX6 A;  3PNA A;  5EV7 A;  1CIW A;  5LBB A;  2O8O A;  2OQ7 A;  1YQ2 A;  2GC0 A;  2XVL A;  4A7Z A;  1LEN A;  5BNP A;  3HOB A;  1POV 1;  1W9T A;  2C1F A;  2WO3 A;  3MID A;  5FR3 A;  1UMH A;  3AP9 A;  3GZA A;  4OMD A;  3RZZ A;  3M4F A;  3ZYF A;  3BYW A;  4BK4 A;  4CDW A;  3N7J A;  5C9A A;  2VVE A;  3AKT A;  2DVF A;  2J1V A;  1PVX A;  2BGO A;  2VE1 A;  3HQR A;  3JUU A;  4P9L A;  2R32 A;  2OZ6 A;  1YQ6 A;  2A3X A;  4Y5T A;  4KU7 A;  3WW1 A;  1BEV 2;  4OHX A;  3AMN A;  3M1H A;  2FHR A;  3F95 A;  4YPJ A;  3SEP A;  5FRE A;  1RUG 3;  2XHK A;  3LFM A;  4YRD A;  5FYU A;  4YYO A;  5JXI A;  2XWJ B;  3RRD A;  5E89 A;  1F8V A;  5LEJ A;  1AL2 2;  4S2G A;  5F3E A;  3ZN6 A;  1WUV A;  1PNF A;  3OUH A;  2DVB A;  2P1B A;  1R1Z A;  3EBR A;  4GWM A;  4JGZ B;  4UYB A;  4ET7 A;  2VCC A;  2IXC A;  2FCT A;  2VOX A;  2ZGP A;  4B4R A;  2Y0O A;  3NKG A;  4RS5 C;  1W9F A;  2AC1 A;  1OVS A;  4AVA A;  4EZ4 A;  4Y20 B;  2RDS A;  1R1A 3;  2DYC A;  5FWJ A;  1M4W A;  1DZR A;  1RUD 1;  1TG7 A;  1AXK A;  2IXJ A;  4Z82 A;  5JPN B;  5A6Q A;  2LS6 A;  2RM2 3;  5A3L A;  3KT7 A;  1AYN 2;  1POV 3;  3ZFF C;  4FFH A;  3H1M A;  4PBP A;  2JDN A;  2ORX A;  3I3B A;  4CE8 A;  1LEC A;  2RS3 1;  5F3G A;  1ZBE 1;  2QTW B;  4CDU B;  1TQ5 A;  3NVC A;  4QXK A;  5GZC A;  5BNO B;  4FOW A;  3VDD C;  1QXJ A;  4O9G A;  5J09 A;  3GZE A;  5FIX A;  2ZZJ A;  2ZGO A;  1NLQ A;  2VMD A;  2YGL A;  1C5I A;  4DRR A;  2JX9 A;  5LA9 A;  2WQ8 A;  2DDU A;  3I8T A;  1YEW A;  3WW2 A;  5AFB A;  3FC0 A;  1RYY A;  3U1X A;  1SFN A;  3MIF A;  1QQP 2;  1HIX A;  2AAC A;  4BQ4 A;  1MS8 A;  2W91 A;  4QB2 A;  1UD1 A;  2VMC A;  2EA7 A;  1VMH A;  2LAL A;  4RQP B;  2XBO 2;  4TLF A;  5C3O A;  1HV1 A;  4IEO A;  5J98 B;  3ST7 A;  4GUL A;  1O3T A;  1HB1 A;  4COZ A;  1VBA 1;  4JQT A;  4Y22 A;  1QOT A;  2BOJ A;  3JU9 A;  1ZRD A;  4Y3O A;  2BJS A;  3WQ7 A;  1L7R A;  4F8A A;  1A78 A;  3OCP A;  1PM4 A;  1IKQ A;  1RUD 3;  1W8W A;  1PGW 1;  4C91 A;  4QKD A;  3ZOI A;  1RMU 2;  4XXP A;  1ND2 B;  3GGL A;  4AED A;  1LOC A;  2GC1 A;  3EXU A;  5T5J A;  1O8S A;  1P8J A;  4I0A A;  2RS3 3;  4R9B A;  3TEW A;  3PTR B;  1ZBE 3;  3WUD A;  1E5I A;  2GH2 A;  2X5I C;  5JSP A;  1I5Z A;  3O0W A;  2OXB A;  4IV3 B;  4BE3 A;  4M3C A;  3MIB A;  4WZF A;  5EYY A;  1UYY A;  1OUR A;  3AYD A;  3I7D A;  1CQ9 A;  2H0B A;  5JXJ A;  4E4Z A;  1CD3 G;  1FX5 A;  2WQ4 A;  4N53 B;  1LOF A;  2R06 1;  5T3N A;  3T3Y A;  4CXX A;  3ZFE B;  2QQK A;  2RG4 A;  1ST8 A;  3LD8 A;  4AL9 A;  1CPN A;  5JR7 B;  1WLC A;  3NNJ A;  3H8O A;  1S0I A;  1QEX A;  1RC6 A;  1PX4 A;  2WNU C;  5E6H A;  4TXW A;  2RHP A;  3T2Q A;  3MDP A;  2QVS B;  1VBC 1;  1D4M 3;  3D8C A;  4QB1 A;  3VHN A;  4JTN A;  1I5P A;  1PIV 1;  4E8C A;  3WNX A;  4XF4 A;  5FZ8 A;  5F6L B;  4PQQ A;  4XHX A;  2WC2 A;  1VBA 3;  4EN7 B;  4NID A;  1CON A;  4B4P A;  4LJH A;  1OLQ A;  1YJL A;  2J42 A;  4MGI E;  2OX0 A;  1MS1 A;  2JEN A;  3WG1 A;  4UF0 A;  5JSO A;  1OHF A;  3CJI C;  3HNM A;  4LEJ A;  4XIL A;  3OPT A;  3O1T A;  4Q1P A;  5JUV A;  4OCT A;  3RJ2 X;  2PHD A;  5BNP C;  4RYD A;  5LW9 A;  2ARA A;  1SLC A;  4MVT A;  4CDW C;  4IW3 A;  5FYC A;  2ZGU A;  4N7I A;  1JN2 P;  1COV 1;  4FPJ A;  3N9N A;  2NMO A;  2QKD A;  2XVG A;  3R05 A;  1Q56 A;  1NA1 B;  2P6C A;  3BOP A;  2R06 3;  3DPR A;  4JAA A;  5F2W A;  4YW6 A;  2A6Y A;  1WA6 X;  1AL0 G;  1MS4 A;  3GF6 A;  5CKM A;  1QJY 2;  4HVR A;  4CDQ A;  1FAT A;  5BNN A;  3BI3 A;  4X8P A;  4AFB A;  1PGL 2;  4AAP A;  5FZ3 A;  5EHD A;  3MLK A;  4PF5 A;  4Y5S A;  3MF9 A;  1KJL A;  1VBC 3;  1NT0 A;  2AEZ A;  2QUO A;  4HXC A;  3PVN A;  4JDN A;  5I8S A;  5A7S A;  3NAP A;  3VZM A;  4E2Q A;  5DAP A;  1PIV 3;  4CU7 A;  2ZMN A;  4XOG A;  5FLJ A;  4CDX A;  2D3S A;  2WYF A;  4BPZ A;  4EN6 B;  4JGZ A;  1W99 A;  3O1R A;  1AYM 2;  2RJ2 A;  4I0W B;  5K4L A;  1W2U A;  3G6J B;  1SBD A;  3AP7 A;  3IIA A;  3AYE A;  4EWE A;  1H1A A;  3FUQ A;  1ZRI A;  1XYN A;  1RL3 A;  3O1V A;  1C57 A;  1XSR A;  2E51 A;  1DYP A;  3ALQ A;  2X10 A;  4GIQ A;  2RJK A;  1QJE A;  4IL7 A;  5DDJ 1;  3WW4 A;  4GA9 A;  4CU6 A;  4NJ4 A;  4PI2 A;  2B39 A;  3KV6 A;  4AR2 A;  1W6P B;  2KD7 A;  3ETQ A;  5CEH A;  3KZ4 C;  4HET A;  5E88 A;  4JGY B;  4XJU A;  4GKX A;  5T5P A;  1COV 3;  1Q3E A;  1R08 2;  3LAG A;  2HWE 1;  1QJZ A;  4W6X A;  5A6Y A;  5BNO A;  2RDN A;  2D6L X;  3FX3 A;  4NIA A;  1IG0 A;  3RSJ A;  1E5S A;  2HWF 2;  3AK0 A;  4PDW C;  2CGN A;  5BYN A;  5C8C B;  5FZ7 A;  2BQP A;  4YW2 A;  1RUN A;  1JYT A;  4LR4 A;  2GP5 A;  4J6G A;  4L0P A;  1NOV A;  2Q8E A;  4COY A;  2VBP A;  4IV1 B;  4A6O A;  2Q8D A;  4IEZ A;  3UES A;  1PNG A;  3OD0 A;  2FBE A;  3K4D A;  5CFD C;  1OA4 A;  3SQO A;  2RS1 1;  1FOD 2;  1XRU A;  2D6P A;  5CIR A;  2TNF A;  1REF A;  3ZPY A;  3SCH A;  4EN8 B;  4PLM A;  5LA1 A;  3LB9 A;  1MZE A;  3C3V A;  2VNV A;  4UW4 A;  1LHO A;  2OQ6 A;  2ZGQ A;  3ACH A;  4E8D A;  4X6Q B;  3M3C A;  3GYD A;  1REE A;  1RUI 1;  1VBD 2;  3PUA A;  5A1L A;  2PQS A;  4AGR A;  4JCK A;  4AVB A;  1ENR A;  2VZV A;  5B4X A;  1V9U 2;  1FYU A;  2E6V A;  4E4S A;  1GWL A;  3LEK A;  4AVS A;  1TMF 1;  1PMI A;  5DDJ 3;  2VUD A;  4KWK A;  1VAM A;  1CAX B;  4K1Z A;  4MGS A;  2YDE A;  5HCF A;  2QQV A;  5C4W B;  4ZPI A;  5FOJ B;  1O3Q A;  3LFI A;  5F3I A;  4AED C;  3O1P A;  3KVB A;  4QHZ A;  1AJK A;  1UKG A;  2OKX A;  5C5U A;  4C90 A;  4QPG B;  2VZT A;  2HWE 3;  4KNC A;  1U5I A;  4DS0 A;  5L9R A;  2UYB A;  2VOV A;  3PDQ A;  2GH8 A;  2ARC A;  1XB9 A;  5FMO S;  5IT6 A;  1RUH 2;  4KMQ A;  3MUY 1;  4OHW A;  2CU5 A;  2PHW A;  1QU0 A;  3DXT A;  4DIN B;  4TN7 A;  1LOF C;  1UOG A;  1D4V B;  2B4K A;  2P3J A;  2UWB A;  2BWC A;  4N53 A;  3TOJ A;  1N1Y A;  3WDW A;  1MAC A;  1ZZ6 A;  3CLP A;  3VKN A;  5KWR A;  4I2O A;  5IHR A;  1UY2 A;  1SPP A;  4C0H A;  2AEN A;  2RS1 3;  4UFJ A;  1JU3 A;  3IPV A;  4XFG A;  1UZV A;  1SLB A;  2JE8 A;  2MPF A;  2DFB A;  4I3G A;  1EAH 3;  3SEE A;  4OMC A;  1H8T B;  2RE9 A;  3JCI A;  1OSG A;  1U5Z A;  1VIW B;  1LGC A;  2WNO A;  2FMD A;  3BPZ A;  3DEM A;  3RZK A;  1UNB A;  3KMH A;  2C9K A;  1RUI 3;  2GND A;  2PQQ A;  4YGB A;  2W9X A;  3WIN E;  1LOE A;  2Y60 A;  2Q8C A;  1YYN A;  4PIX A;  5HXM A;  3ZKU A;  4IXL A;  2VBB A;  1JH5 A;  1TNF A;  4FOQ A;  5JZG A;  1TMF 3;  4LOR A;  2I45 A;  4W6W A;  5CKQ A;  2ZX4 A;  1Y7B A;  2ZA9 A;  4CCK A;  1KFX L;  2JKX A;  5KHI A;  4GWN A;  2CHH A;  4XFF A;  1SAC A;  3KS7 A;  1V6J A;  1V6I A;  3K2O A;  2EAK A;  3ZR6 A;  2BVV A;  1ONA A;  2XJU A;  3QAC A;  1STM A;  3BTA A;  4Y1X A;  3U14 A;  1QJF A;  5D2A A;  1NZC A;  3RFR A;  4U2A A;  2P3K A;  1OH4 A;  2EID A;  1NY7 2;  3ELN A;  3P3P A;  4QX7 A;  2IXL A;  4WVM B;  5CG8 A;  1H6X A;  1QY4 A;  1EP0 A;  1X50 A;  3DKW A;  5K0U B;  4KQ7 A;  3UL2 A;  3DPR C;  4GB3 2;  3DYO A;  2WFF 1;  5FYT A;  1PO2 2;  2J1T A;  1UQX A;  5T55 A;  2VZU A;  3OTF A;  4ISQ A;  3BOD A;  5BNN C;  4Y1Z A;  2ZGM A;  3WLU A;  5FZ0 A;  4CEW C;  3AZX A;  5ISL A;  3VBU C;  2ZAH A;  3B94 A;  3N9Q A;  4YFZ A;  1PO1 1;  4CDX C;  3SNM A;  2UU8 A;  3ETP A;  5FO8 B;  4JGZ C;  4PJY A;  2PTM A;  2GC3 A;  3DF0 A;  4QX5 A;  1KS5 A;  4XF0 A;  3Q8F A;  3QCW A;  4KL1 A;  3AZV A;  3PIJ A;  2BEO A;  2E26 A;  1YFU A;  3BPS A;  5FRA A;  1H2K A;  1AX2 A;  2EXH A;  4OQ8 A;  3VBH A;  1NYW A;  1ULE A;  2YPD A;  3V0A A;  3I2O A;  1US3 A;  4FPG A;  3MO4 A;  2WWJ A;  5C7G A;  2CV6 A;  1C5H A;  4LE3 A;  4LLO A;  4R9A A;  4B3N A;  4DFS A;  5LK5 A;  1S0F A;  1QKQ A;  4JQR A;  3ZMN A;  5FBZ A;  3H3Z A;  2YYO A;  5HXV A;  2VW2 A;  3WDT A;  3N36 A;  2DTY A;  3J7L A;  4JGY A;  3MFC A;  1FPN 2;  1VMF A;  3EYP A;  3ZYI B;  4H3W A;  1O4T A;  3THC A;  5BNO C;  3T09 A;  3ZXA C;  4RS5 B;  3BU7 A;  4XFH A;  2E53 A;  4JKL A;  2JDA A;  2WFF 3;  2CYF A;  3D0S A;  4UBH A;  3WV6 A;  5CKN A;  4Z07 A;  4OUM A;  1JZ6 A;  2XVK A;  1HB3 A;  1W2O A;  2B46 X;  4KG0 A;  3M7A A;  4SLI A;  3S7I A;  3ZFF B;  3MFA A;  2O14 A;  4CP9 A;  1PO1 3;  4P5Y A;  4RQP C;  2QQM A;  5BPX A;  1N1V A;  1ZX5 A;  4LA3 A;  4QXC A;  4NMI A;  1LHN A;  1DLL A;  5GJ6 A;  1DQ0 A;  1XU2 A;  5GLZ A;  2QQU A;  3VDD B;  2X8K A;  4Q8K A;  5C3R A;  2DVD A;  1FMD 1;  2ZTN A;  3VD4 A;  5GZD A;  3BUC A;  1XJA A;  2XOM A;  3NV3 A;  4DPN A;  5DMY A;  1QNW A;  2F4L A;  3OB8 A;  1ENQ A;  4MH0 E;  4I09 A;  1RUG 2;  2PN5 A;  5A6Z A;  4COU A;  1GNH A;  2D3P A;  2EXJ A;  4I3P A;  3W5M A;  2VNG A;  1DP0 A;  2GMP A;  4Q0Q A;  1KJR A;  4BQ2 A;  3W21 A;  1V0A A;  5FYM A;  3AMP A;  5A3N A;  2Y34 A;  1I6X A;  1W8F A;  4BHP A;  3B69 A;  2IC1 A;  2PHX A;  4QX3 A;  1AUY A;  1UY1 A;  3ZXE A;  1K42 A;  2Y6F A;  2HWD 2;  4HFS A;  1UMZ A;  2XWB B;  4OLL A;  3ZSM A;  2W94 A;  1ULO A;  2V73 A;  4QGN A;  4CP1 A;  4E4D X;  1B35 A;  4FPE A;  2PHF A;  3AXD A;  3OYW A;  4XHB A;  1R1A 2;  2DCT A;  5TSW A;  3A23 A;  1HKD A;  2UWA A;  3UNP A;  5I0T A;  1W8T A;  1H0B A;  2RDQ A;  4N53 C;  1NLS A;  3KV5 A;  4UI9 L;  3S7E A;  2WL1 A;  4YVS B;  1YIP A;  4PCR A;  3C7G A;  2BRT A;  3OGV A;  5DZF A;  2CAV A;  1DGR A;  2UY8 A;  1SBE A;  3N3H A;  4NRP A;  1Q8O A;  3B00 A;  3GDB A;  3THD A;  1G7Y A;  1RB8 G;  1ENS A;  3ES4 A;  4CCC A;  2ARE A;  3CJX A;  2Q0A A;  1K5M A;  3WZ1 A;  1H8T A;  2X5I B;  3O0X A;  1JYC A;  5C33 A;  1C8M 1;  2VR4 A;  3KVA A;  1CWP A;  1UY0 A;  4DIQ A;  5A1A A;  1Q8V A;  3AL6 A;  3VHR A;  4AXO A;  5AC9 1;  2NYY A;  2A6V A;  2DU1 A;  2XJP A;  2VO5 A;  3S6P A;  4FT8 A;  4W65 A;  1WW5 A;  5GLV A;  4Z92 B;  2X29 A;  1BMV 2;  3OJB A;  3SH3 A;  2VMI A;  5JZG C;  2BNO A;  3FMG A;  2GAU A;  5T54 A;  1JZ4 A;  1SEF A;  3HQU A;  2WSU A;  3CQO A;  3M8L A;  5IFP A;  3WSO A;  4RGA A;  3G7D A;  1HN1 A;  3POS A;  3AKP A;  3KV4 A;  4M4R A;  4XAA A;  1AR8 1;  1Y3T A;  4YLZ A;  1UIK A;  1W6M A;  2ZAB A;  5A1F A;  1AX0 A;  2OPW A;  5FKB A;  1UO9 A;  3WOG A;  4FTS A;  2E32 A;  4KBZ A;  2HEV F;  3INA A;  1NA1 C;  1RUD 2;  4UAP A;  3U37 A;  2VW0 A;  4XJZ A;  3VZK A;  2A70 A;  1W9Y A;  3MW4 A;  1SBF A;  4BWO A;  2IVJ A;  4MXW A;  4S2D A;  3AP4 A;  1Y43 B;  5I0R A;  4DUW A;  2RS3 2;  5BNP B;  3O1M A;  4OYU A;  1ZBE 2;  3IN9 A;  2D44 A;  2VMF A;  4NWV A;  3ZYP A;  5GZG A;  1C8M 3;  1F2N A;  4P9J A;  3P1I A;  4CDW B;  4E2G A;  3H1Y A;  5C9A B;  5HCB A;  1YFW A;  5JAX A;  3QD6 A;  1H9W A;  3CU7 A;  1URX A;  5A7O A;  5JOZ A;  3I49 A;  1S0B A;  3SXW A;  4ATF A;  3J8F 1;  4DXS A;  5F7U A;  5LB6 A;  4YSF A;  1NCR A;  3D0J A;  2XKP A;  3GBF A;  3RVH A;  4KGQ A;  4IEP A;  3VBH C;  4E2S A;  1XYO A;  4QQO A;  1CAU A;  1ZA4 A;  3MLL A;  4MZU A;  3KF5 A;  4DOU A;  4QMA A;  3A22 A;  2G9G A;  1QDO A;  2IXK A;  3KGL A;  1NCQ A;  1VBA 2;  4ASM B;  3S30 A;  1AR8 3;  2YUE A;  4LNV A;  3ZN6 B;  4JGY C;  2WZE A;  5F1R A;  4G9S B;  4IGP A;  4LBN A;  2V72 A;  4AEM A;  4FI9 A;  3DGT A;  1J3Q A;  2WYS A;  3I3E A;  5FZE A;  5DAW A;  3RZG A;  1PGW 2;  4LKS A;  4P9G A;  5FK8 A;  5C8C C;  3IDA A;  4WBB A;  2JDZ A;  3AXE A;  3USU B;  1YLL A;  5C3S A;  5LZ6 A;  3POJ A;  5H9R A;  2VEC A;  5A80 A;  1DQ1 A;  1O91 A;  4A2U A;  4Z8B A;  5E16 A;  5ABJ A;  1UW8 A;  3HQX A;  4M01 A;  2FMY A;  1W3X A;  4RL7 A;  5CVR A;  4XEZ A;  3RZH A;  4EWD A;  1GZW B;  4KWL A;  4IEU A;  4AI0 A;  2A7A A;  4P5H A;  1DQ2 A;  2WQZ C;  4PBO A;  3ZR5 A;  5EFU A;  2D93 A;  4BQ3 A;  3POW A;  4FQZ A;  5I8T A;  2R06 2;  4NHM A;  3FWE A;  3J8F 3;  1NG0 A;  4FOY A;  4XJW A;  3PVE A;  1W2N A;  2A75 A;  2W1S A;  4N43 A;  1VB2 A;  5C70 A;  3Q8B A;  2QQO A;  5IUQ A;  1UPI A;  4CUC A;  2PAM A;  1VBC 2;  2Y6G A;  4W8J A;  5JOW A;  1PIV 2;  3EMR A;  2A6X A;  2JDM A;  3NKT A;  4E9K A;  4A7K A;  1MS9 A;  3NNG A;  5FZD A;  3USS A;  3HN3 A;  1PMH X;  2JIJ A;  5D8A A;  3O0V A;  2QQI A;  1B35 C;  3H3U A;  1CES A;  3WNK A;  3ZSL A;  3MYX A;  2WN3 A;  1SLA A;  2XJQ A;  5I0S A;  1KEX A;  1VRB A;  3PU3 A;  4A3Z A;  4A41 A;  4LIU A;  3RMX A;  1ZZ7 A;  3J7H A;  2WKK A;  3OBT A;  1YQ8 A;  1H4G A;  1LOB A;  1ZZB A;  2JDY A;  3WF2 A;  4D8M A;  5CAZ A;  4XDQ A;  4AED B;  4OUE A;  4QWN A;  1QOS A;  3HBK A;  3AP5 A;  3E6D A;  3LKJ A;  2VVF A;  1GZ9 A;  1AZD A;  1A8D A;  1IKP A;  1COV 2;  1H8T C;  1RGS A;  5EQU A;  4CSW A;  1ZZ9 A;  5IW0 A;  1RXF A;  2J1U A;  4XBN A;  4ATE A;  4UFL A;  3PMS A;  2W1Q A;  5DUU A;  5FY5 A;  4Q2F A;  1F9K A;  2WT0 A;  1Y9Q A;  3NV4 A;  5L19 A;  2YC2 A;  1T2X A;  2J1E A;  3CL1 A;  3NV1 A;  4MUV A;  3U11 A;  1DF0 A;  2YY1 A;  3M3E A;  1G9B A;  4YM0 A;  3NNF A;  1BK0 A;  1UKR A;  2GSY A;  3L2Y A;  2DVG A;  3C8X A;  2ARX A;  2IXH A;  2VOW A;  3IDC B;  4WVV A;  1GQH A;  1PZ7 A;  4RA0 A;  3ZYB A;  3T1M A;  4XZU G;  1YQ5 A;  2WNE A;  3ILN A;  2TEP A;  1HJF A;  4PLO A;  4RR3 B;  4DRV A;  5A3U A;  3CHX A;  2R49 A;  4AI1 A;  2ADD A;  5FP4 A;  1YUD A;  3WXP A;  1I9R A;  3WDU A;  2G4I A;  1S0C A;  1BHG A;  4L11 A;  2GMM A;  4Y1V A;  5GKA C;  5K0U C;  4M0H A;  4CCN A;  2R04 1;  4RGG A;  2SLI A;  4UF0 B;  5DDJ 2;  5F39 A;  4Q4Y 1;  1LOD A;  4C1X A;  3DV8 A;  2YZ4 A;  2EIE A;  2RM2 1;  1DGW X;  5JDB A;  5KHG A;  2W46 A;  3IAP A;  3HT2 A;  4IES A;  1YNA A;  2HWE 2;  4DXR A;  1DYO A;  2YBS A;  2IFR A;  1OQD A;  2ORZ A;  3T1L A;  2W08 A;  1MZF A;  2Z69 A;  3OGR A;  5KR7 A;  4CEY A;  1HRI 1;  3DPR B;  3ZIX A;  3OGG A;  3A7Q A;  1NCR C;  4PF1 A;  4CU8 A;  2JWP A;  4FAH A;  5GM0 A;  1GLH A;  5CNA A;  5FJK A;  4CDQ B;  5BNN B;  1XPW A;  2RS1 2;  2ID4 A;  4P14 A;  3VBO B;  3S57 A;  2BU9 A;  2HBU A;  4CEW B;  2R6Q A;  4AK3 A;  2JDH A;  1CZT A;  3NAP B;  2JDU A;  4GMP 0;  1IS5 A;  1WLT A;  4CDX B;  2D6K A;  4CUG A;  1MZ5 A;  4AQS A;  1RUI 2;  3LA7 A;  1MVE A;  1PVC 1;  3D5O A;  4XUN A;  3K3O A;  3PME A;  4YZ2 A;  2P6H A;  4RHV 1;  1NX9 A;  4BOW A;  2EAL A;  1TMF 2;  1ZA7 A;  2R04 3;  3GCW A;  4MGK E;  4Q4X 1;  5DN2 A;  3H8U A;  2OII A;  3WDX A;  4A44 A;  4K8F A;  1CN1 A;  4Q4Y 3;  3USU A;  2D5F A;  2X53 S;  4FTB A;  2B7Y A;  2ZGN A;  3WNO A;  1LR5 A;  4L92 A;  5ABJ C;  3HN1 A;  4XPV A;  5FPA A;  4W50 A;  4FXG B;  4JV4 A;  5FY9 A;  2VUL A;  2ZAC A;  4XCA A;  3LA2 A;  1CZV A;  1G6N A;  3TNQ A;  2ADE A;  1EUU A;  3AVS A;  1GZW A;  1HJG A;  5CIS A;  2ZX3 A;  5IK8 A;  1X9P A;  2VUA A;  2XH6 A;  1HRI 3;  4JZR A;  4TWT A;  5ANN A;  3UJQ A;  2VQ0 A;  5L7O A;  1ODM A;  3KD4 A;  1AR6 1;  3O1S A;  3POG A;  4P9I A;  5FMB A;  1NKG A;  4DNY A;  3R4S A;  3KHC A;  4LTA A;  4K9S A;  4LBK A;  1XE7 A;  2JIC A;  3C7F A;  2IWG B;  4ZHN A;  5DUV A;  4ZKT B;  1YXW A;  3H0O A;  5LBE A;  4B7E A;  2E63 A;  5CBL A;  1IQA A;  2WAB A;  5A70 A;  2Q8O A;  3HJR A;  1BCX A;  1QWR A;  1D4M 1;  4M0N A;  4NO4 A;  4XMA A;  1PVC 3;  5CFC A;  1LB2 A;  4GAZ A;  2E7A A;  3IDB B;  1SLT A;  2XL7 A;  4RHV 3;  2XQX A;  1GNY A;  4GD4 A;  2K46 A;  4Q4X 3;  5J36 A;  5GLT A;  1R09 2;  1QOO A;  4LBO A;  4MG2 A;  5C71 A;  2D5H A;  1W2T A;  3TN9 1;  1W6Q A;  1ULP A;  2E7T A;  4YVS C;  5C8W A;  4LKD A;  2GP3 A;  4KG8 A;  4ARY A;  5KXD A;  5FY7 A;  1HV0 A;  1S0J A;  2ZGL A;  1AHS A;  3T0B A;  3LPF A;  1XNT A;  4DQA A;  3C7O A;  1W6O A;  3RS6 A;  1F4H A;  4P9X A;  1LNS A;  1JZ3 A;  4Y26 A;  2Z5W A;  1I3H A;  1UU4 A;  1UZ0 A;  1ZBA 2;  5IYY A;  2WFF 2;  3HNB M;  1T6B X;  1AR6 3;  5FYI A;  1IPJ A;  1OI6 A;  1ASJ 1;  3N9P A;  4JDO A;  4LBJ A;  2W39 A;  2A5Z A;  1YIF A;  2WT1 A;  2J7M A;  4FO9 A;  2FZ1 A;  2QQW A;  3AB0 A;  1MS0 A;  3H1W A;  2WWS A;  1SPP B;  4P02 B;  1FXZ A;  2PAE A;  3FLP A;  1PO1 2;  3IPV B;  1JZ8 A;  4P9W A;  4TZD A;  3IB3 A;  1XNC A;  4IEX A;  1BKZ A;  4B7K A;  3IT8 A;  5ERL A;  4HKL A;  1CVN A;  2JG8 A;  1YCI A;  4O65 A;  4RR3 A;  1LOG A;  4B4Q A;  1HDK A;  1V00 A;  5DAQ A;  1KDK A;  3T0D A;  1E5H A;  3TN9 3;  1UX6 A;  3SIS A;  4AWD A;  3VBR A;  1D2Q A;  5JZG B;  2V4A A;  1RUJ 1;  3NST A;  4CPB A;  1G9F A;  3NNM A;  3A0N A;  1NLR A;  2QDN A;  2VXJ A;  3FLR A;  3OUJ A;  1D0H A;  2VOT A;  2YC4 A;  4WV8 A;  2DBI A;  4P08 A;  2GN3 A;  3K48 A;  4HVO A;  5FMC A;  3KSC A;  3ZXL A;  3UYJ A;  3PUH A;  5C9A C;  4QGL A;  3SHR A;  3T30 A;  4BU2 A;  3I2D A;  4EN9 B;  3FL7 A;  5A33 A;  4XF1 A;  4YG0 A;  1JW6 A;  4FPH A;  1ASJ 3;  4PI0 A;  4XAE A;  2ZKN A;  5G05 L;  4CEY C;  4W6Y A;  2I74 A;  4HBN A;  4BM8 A;  4D6Q A;  4YM3 A;  5HV0 A;  1NUK A;  4CUB A;  4FPK A;  2E31 A;  2L9L A;  3KV9 A;  1MEC 1;  4JRA A;  4W4Z A;  2O0O A;  4HKW A;  3VBO A;  4PLN A;  5M0T A;  2HYX A;  1RXG A;  1K12 A;  1ZM1 A;  1C4R A;  4ZON A;  1ULD A;  1YFX A;  5FPZ A;  1WBF A;  3PJQ A;  5FXW A;  4QKB A;  5LA2 A;  2HWC 1;  3BCW A;  1FMD 2;  5FBJ A;  5FUI A;  1OD5 A;  3RQ0 A;  5IK7 A;  2ZXQ A;  3POI A;  4CZS A;  3PVO A;  1JHJ A;  5GLU A;  3H8X A;  5BY5 A;  3FHQ A;  1RUJ 3;  5IVE A;  3VBH B;  2BER A;  2AGS A;  3N9M A;  1EY2 A;  3MI8 A;  3III A;  4SBV A;  1JZ2 A;  3V0A B;  3V0B A;  4C1W A;  3R0R A;  4YZ1 A;  4NPL A;  1H30 A;  3RI9 A;  2VUJ A;  3R4U A;  3LCP A;  5IJR A;  4QQH A;  4JKK A;  1QJU 1;  2RV9 A;  5KXB A;  3O1U A;  2VTX J;  5I0D A;  3E5U A;  1G86 A;  3BKZ A;  1UU6 A;  1ZRC A;  1D7P M;  4KGG A;  1LED A;  5LBF A;  5KHJ A;  4Q5O A;  2W92 A;  1CZS A;  3HD8 B;  1Z7S 2;  5L7O C;  4FP3 A;  3MW2 A;  4XDP A;  5IVC A;  3POB A;  1PK6 A;  1DQ6 A;  1DBN A;  2Z42 A;  3DYP A;  1UN1 A;  4A3X A;  2VG9 A;  3ES1 A;  1EPW A;  1MEC 3;  1W90 A;  4RFR B;  5IAV A;  3EHK A;  4HOO A;  4D6S A;  1W9W A;  1VRH 1;  4IEW A;  5DG2 A;  1C8M 2;  2G19 A;  4BXS V;  4CP9 B;  2LUW A;  1PMJ X;  4OHV A;  5EJ1 B;  2AH2 A;  4QQL A;  1Q43 A;  1C1L A;  1EAH 1;  1IS4 A;  2ATF A;  1JOJ A;  2ET7 A;  3M3O A;  2HWC 3;  2YMZ A;  3ACF A;  4FQ4 A;  2XJS A;  1NXD 1;  3JQX A;  4NWW A;  4QX2 A;  2WAO A;  3W59 A;  3P6B A;  3ACI A;  4NRQ A;  5FZ9 A;  2VQA A;  1XSQ A;  3B5L B;  1IPS A;  3W5N A;  2D6M A;  2XB6 C;  2XG3 A;  5F2S A;  5F5C A;  3QOP A;  3PUS A;  4QT6 A;  5FYS A;  2I07 B;  1LOA A;  4NRO A;  1K45 A;  5FMO L;  5DQ0 A;  5A3O A;  1RHI 1;  3AP6 A;  4DY3 A;  2GZW A;  1JYV A;  1QJU 3;  4OI4 A;  1AR8 2;  3HNY M;  5F3C A;  4Q1R A;  4UWD A;  1YO8 A;  2QJV A;  4D0Q A;  4NHX A;  2BNM A;  4AI8 A;  3HEI A;  1JBC A;  5FYZ A;  2YG0 A;  4LK6 A;  4XAC A;  2JDP A;  1GP5 A;  1KS4 A;  4LLF A;  2B8M A;  3NRU A;  3ZDS A;  1B35 B;  1AL2 1;  3WP5 A;  3OYW B;  2Q1M A;  3GZT B;  1WA4 A;  2K9Z A;  1BBT 1;  4L97 A;  4MGT A;  2BVB A;  5JMO A;  3GM8 A;  2A73 B;  4LBM A;  1EV1 1;  4YM1 A;  3WG4 A;  2QDR A;  3WNN A;  4AOC A;  3MIG A;  1JYX A;  4LUM A;  4ZXK A;  1VRH 3;  3OEA A;  3WT3 A;  3AFK A;  4WM8 A;  1V6K A;  5FZB A;  2IFW A;  2BBV A;  1QHD A;  2JD9 A;  3OOX A;  1K5M B;  3WNM A;  1BLZ A;  4FXK B;  5FZC A;  4WVZ A;  5FZL A;  1GWK A;  2JG8 C;  2WBK A;  4RR3 C;  1W8H A;  3ZYH A;  3J8F 2;  2RVA A;  4HLT A;  4HN1 A;  3T0A A;  3LQC A;  4B29 A;  1J1L A;  1OF4 A;  2MHF A;  2ZKL A;  5FPV A;  4DZG A;  3VUO A;  2CTV A;  3MZH A;  4GJZ A;  5FXZ A;  4LE4 A;  2H6B A;  4DO0 A;  5LRS A;  5AVP A;  2BPA 2;  1WLW A;  3AM2 A;  1BVV A;  3PL0 A;  1ULG A;  4QXB A;  1POQ A;  2EXK A;  3VN4 A;  2EAA A;  1VR3 A;  1RHI 3;  2FDK A;  1RVF 1;  1VB4 A;  4BCU A;  4CU9 A;  5I91 A;  3H9A A;  4FOV A;  2FDG A;  3N7L A;  3SCG A;  4ZU7 A;  2PAK A;  1UF2 C;  1ACC A;  3GBW A;  4XJ8 A;  1C28 A;  5GAL A;  1W6M B;  2DV9 A;  1W9S A;  2A1X A;  4AAX A;  2WLP A;  3WQ1 A;  1AL2 3;  1U12 A;  1LU2 A;  1OQ1 A;  5K9Y A;  3BVC A;  3NNL A;  1LGB A;  1BBT 3;  5FZO A;  1AR7 1;  2WA4 A;  4LHS A;  2AR6 A;  3VL9 A;  3WNL A;  4B1M A;  2MNG A;  2VW1 A;  1EV1 3;  1VPH A;  2AYH A;  3RPQ A;  3TBD A;  3ZSK A;  3AVR A;  1XNK A;  3M70 A;  4MXW B;  1G9A A;  4CDQ C;  1W06 A;  3LDB A;  4AE2 A;  1FV3 A;  3VBO C;  4YG3 A;  4FBF A;  3CZU A;  4UW6 A;  3T2O A;  2C5D A;  3DCQ A;  4FPC A;  2HLE A;  2W87 A;  2X09 A;  3ORJ A;  1RTV A;  4X8N A;  1CAV A;  2W68 A;  2V4V A;  2ZHN A;  3NAP C;  1J58 A;  5HCH A;  3GJB A;  3E6B A;  2DWR A;  3NQH A;  4NAM A;  5FTT C;  1UL9 A;  1WMD A;  4Z1V A;  4QPI A;  5KBF A;  4R4X A;  4OZX A;  2CSG A;  1KQR A;  2WRA A;  2WDB A;  1NCR B;  4FVV A;  4AQ2 A;  2VUC A;  1W8O A;  1WW7 A;  1AVB A;  2B9V A;  1IPK A;  2J1A A;  2FCU A;  2P2K A;  3WF3 A;  1CAU B;  3AMQ A;  1JYW A;  3S5Q A;  1RVF 3;  4LT5 A;  5JOX A;  4AI2 A;  2Y0I A;  3B93 A;  3B01 A;  1AR9 2;  1NCQ B;  2CWS A;  3KB5 A;  1ZZ8 A;  3RZL A;  3LPG A;  4CCO A;  2DUR A;  5FO9 B;  1SG3 A;  1GKB A;  3E97 A;  4HKO A;  1NE6 A;  3NV2 A;  2ZCW A;  4GH4 B;  2KXL A;  1Q8P A;  3JBG 1;  1Y9M A;  4IGQ A;  4IUG A;  2J22 A;  3UKT A;  1AR7 3;  4BQX A;  1DCS A; 
#chains in the Genus database with same CATH homology
 1XE0 A;  1XB9 A;  1K5J A;  4N8M A;  3T30 A;  2VTX A;  4CA9 A;  2P1B A;  5EHD A;  2VTX J;  1NLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...