5EHTA

Indirect contributions of mutations underlie optimization of new enzyme function
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
253
structure length
252
Chain Sequence
GHMATVKKLYFVPAGRCMLDHSFVNSALTPGKLLNVPVWCYLLETEEGPILVDTGMPESAVNNEGLNGTFGEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMTECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPMIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Tinkering Drives Evolution of a Promiscuous Activity through Indirect Mutational Effects.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
molecule keywords N-acyl homoserine lactonase
total genus 84
structure length 252
sequence length 253
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ehtA01
2YNTB 4YSLA 4Z5YA 1VJNA 1P9EA 4XWTA 4B87A 4D02A 2XR1A 5FQBA 2GKLA 2R2DA 4C1FA 2FU7A 4FEKA 2QJSA 2WYMC 4TYTA 1JT1A 4AX0B 4RAMA 4V0HA 4AWYB 3JXPA 3SFPA 1QH5A 3SPUA 3X2ZA 3BK2A 5IQKA 2I7TA 2GMNA 4TZBA 3PY5A 3ZR9A 2OHIA 2YNWA 1VGNA 3ZNBA 3I11A 4RBSA 4ZNBA 5ACSA 1YCGA 2BIBA 5K0WA 1A7TA 5EHTA 3TP9A 2FU8A 3QH8A 5LSCA 5LCAA 2GFKA 1K07A 5LS3A 1X8HA 5AHRA 5A5ZA 4LE6A 1X8GA 3IEKA 2I7XA 2YCBA 5K4KA 2Y8BA 2FM6A 1DXKA 5B15A 2AIOA 2Q9UA 4EXSA 5LE1A 2H6AA 2BFLA 2HB9A 4BP0A 5AHOA 5EH9A 2BG8A 4Z7RA 2GCUA 5EVKA 3BK1A 4FR7A 2NXAA 2FK6A 3S0ZA 4UWSB 4P62A 2ZNBA 4XUKA 2QEDA 3AF6A 4NQ6A 5HH6A 3PG4A 4RL0A 3ESHA 3IE0A 5AXOA 5EV8A 4CHLA 3LVZA 5HIPA 4UWOB 3PY6A 3T3NA 3MD7A 1ZTCA 4F6ZA 1X8IA 1A8TA 3KL7A 2WHGA 4UA4A 2A7MA 5DPXA 3IELA 3DHAA 2BG8B 2BMIA 2QINA 2NZFA 3FAIA 3RPCA 2BC2A 4C1GA 3IDZA 1WUPA 2BG7A 1E5DA 2P18A 3IOGA 4PVTA 3DHCA 4EY2A 4KEQA 2WRSA 5ACRA 4O98A 4UAMA 5LLDA 3DH8A 1QH3A 1VMEA 2M5CA 5AYAA 1HLKA 5HH5A 3IEMA 3IE2A 3L6NA 3RKKA 1JJTA 3BV6A 4HL2A 3AJ3A 4KEPA 4HL1A 5EV6A 5FQCA 5HH4A 2NZEA 2M5DA 3SD9A 3FCZA 2BFKA 4RM5A 4EYLA 4D1WA 2FU9A 2BG6A 1L9YA 2BFZB 3ZQ4A 4EYBA 2FHXB 5ACUA 3I15A 5A0VA 4UBQA 5FQAA 4DILA 2I7VA 4FSBA 5ACXA 4UWRB 4YSKA 4D1VA 5AXRA 3H3EA 2QDSA 5LCFA 2Q0IA 3A4YA 1BMCA 2Y8AA 3R2UA 4RL2A 3F9OA 2YNUA 1YCHA 2P4ZA 4GYQA 4H0DA 4TYFA 1KO3A 1KR3A 2DKFA 4NQ2A 4D1TA 4RAWA 4JO0A 4C09A 4EXYA 5EVDA 4GYUA 5B3RA 4NQ5A 5LMCA 4Z6XA 5K4NA 3VQZA 2WYMA 2BG2A 2YNVB 3SRXA 3Q6VA 2DOOA 1BVTA 2BTNA 1XM8A 5AEBA 3ADRA 5EWAA 4TZFA 4C1HA 2QDTA 4AWZA 4EYFA 1WRAA 5ACWA 4ZO3A 2AZ4A 4EFZA 3IOFA 5LCHA 1YCFA 4J5HA 4C1EA 4Z67A 2Q0JA 4D1UA 5KILA 2ZWRA 2Y87A 1BC2A 5ACPA 3VPEA 5ACVA 2ZZIA 4U4LA 3IE1A 1WW1A 2XF4A 4HKYA 4TZEA 2GFJA 3G1PA 2CBNA 3RKJA 4BZ3A 5KIKA 5ACTA 2NYPA 1XTOA 4UWPB 3BC2A 3P2UA 4YSBA 5K4MA 5HIOA 1JJEA 1MQOA 4NQ4A 4WD6A 1M2XA 1Y44A 2WYLA 4F6HA 2BR6A 3KNRA 1DDKA 5A0TA 5ACQA 5EW0A 4J5FA 5B1UA 5A87A 2E7YA 3KNSA 1KO2A 2BFZA 2BGAA 4AX1B 5HIQA 3T3OA 2ZO4A 5EVBA 2OHJA 4C1DA 2Q42A 4C1CA 4Z5ZA 2P97A 3T9MA 4DIKA 1SMLA 4XWWA 2P1EA 3I0VA 2YNTA 4ZEJA 1DD6A 1ZKPA 3X2XA 2YNVA 3AF5A 1ZNBA 2FU6A 3SW3A 1WUOA 2UYXA 4PVOA 3X2YA 2VW8A 2YZ3A 3I14A 4GCWA 3X30A 3I13A 4ZO2A 3SBLA 3WXCA 5HISA 3DHBA 4TZ9A 2OHHA 2FHXA 3ZWFA 5LM6A 4AD9A 4Z60A
chains in the Genus database with same CATH superfamily
2YNTB 4YSLA 4Z5YA 1VJNA 1P9EA 4XWTA 4B87A 4D02A 2XR1A 5FQBA 2GKLA 2R2DA 4AV7A 4C1FA 2FU7A 4FEKA 2QJSA 2WYMC 4TYTA 1JT1A 4AX0B 4RAMA 2CFUA 4V0HA 4AWYB 5AIJA 3JXPA 3SFPA 1QH5A 3SPUA 3X2ZA 3BK2A 5IQKA 2I7TA 2GMNA 4TZBA 3PY5A 3ZR9A 2OHIA 2YNWA 1VGNA 3ZNBA 3I11A 4RBSA 4ZNBA 5ACSA 1YCGA 2BIBA 5K0WA 1A7TA 5EHTA 5A23A 3TP9A 2FU8A 3QH8A 5LSCA 5LCAA 2GFKA 1K07A 5LS3A 2CG3A 1X8HA 5AHRA 5A5ZA 4LE6A 1X8GA 3IEKA 2I7XA 2YCBA 5K4KA 2Y8BA 2FM6A 1DXKA 5B15A 2AIOA 2Q9UA 4EXSA 5LE1A 4PDXA 2H6AA 2BFLA 2HB9A 4BP0A 5AHOA 5EH9A 2BG8A 4Z7RA 2GCUA 5EVKA 3BK1A 4FR7A 2NXAA 2FK6A 3S0ZA 4UWSB 4P62A 2ZNBA 4XUKA 2QEDA 3AF6A 4NQ6A 5HH6A 3PG4A 4RL0A 3ESHA 3IE0A 5AXOA 5EV8A 4CHLA 3LVZA 5HIPA 4UWOB 3PY6A 3T3NA 3MD7A 1ZTCA 4F6ZA 1X8IA 1A8TA 3KL7A 2WHGA 4UA4A 2A7MA 5DPXA 3IELA 3DHAA 2BG8B 2BMIA 2QINA 2NZFA 3FAIA 3RPCA 2BC2A 4C1GA 3IDZA 1WUPA 2BG7A 1E5DA 2P18A 3IOGA 4PVTA 3DHCA 4EY2A 4KEQA 2WRSA 5ACRA 4O98A 4UAMA 5LLDA 3DH8A 1QH3A 1VMEA 2M5CA 5AYAA 1HLKA 5HH5A 3IEMA 3IE2A 3L6NA 3RKKA 1JJTA 3BV6A 2YHEA 4HL2A 3AJ3A 4KEPA 4HL1A 5EV6A 5FQCA 4NURA 5HH4A 2NZEA 2M5DA 3SD9A 3FCZA 2BFKA 4RM5A 4EYLA 4D1WA 2FU9A 2BG6A 1L9YA 2BFZB 3ZQ4A 4EYBA 2FHXB 5ACUA 3I15A 5A0VA 4UBQA 5FQAA 4DILA 2I7VA 4FSBA 5ACXA 4UWRB 4YSKA 4D1VA 5AXRA 3H3EA 2QDSA 5LCFA 2Q0IA 3A4YA 1BMCA 2Y8AA 3R2UA 4RL2A 3F9OA 2YNUA 1YCHA 2P4ZA 4GYQA 4H0DA 4TYFA 1KO3A 1KR3A 2DKFA 4NQ2A 4D1TA 4RAWA 4JO0A 4C09A 4EXYA 5EVDA 4GYUA 5B3RA 4NQ5A 5LMCA 4Z6XA 5K4NA 3VQZA 2WYMA 2BG2A 2YNVB 3SRXA 3Q6VA 2DOOA 1BVTA 2BTNA 1XM8A 5AEBA 3ADRA 5EWAA 2CFZA 4TZFA 4C1HA 2QDTA 4AWZA 4EYFA 2CG2A 1WRAA 5ACWA 4ZO3A 2AZ4A 4EFZA 3IOFA 5LCHA 1YCFA 4J5HA 4C1EA 4Z67A 2Q0JA 4D1UA 5KILA 2ZWRA 2Y87A 1BC2A 5ACPA 3VPEA 5ACVA 2ZZIA 4U4LA 3IE1A 1WW1A 2XF4A 5AJLA 4HKYA 4TZEA 2GFJA 3G1PA 2CBNA 3RKJA 4BZ3A 5KIKA 5ACTA 2NYPA 1XTOA 4UWPB 3BC2A 3P2UA 4YSBA 5K4MA 5HIOA 1JJEA 1MQOA 4NQ4A 4AXHA 4WD6A 1M2XA 1Y44A 2WYLA 4F6HA 2BR6A 3KNRA 1DDKA 5A0TA 5ACQA 5EW0A 4J5FA 5B1UA 5A87A 2E7YA 3KNSA 1KO2A 2BFZA 2BGAA 4AX1B 5HIQA 3T3OA 2ZO4A 5EVBA 2OHJA 4C1DA 2Q42A 4C1CA 4Z5ZA 2P97A 3T9MA 4DIKA 1SMLA 4XWWA 2P1EA 3I0VA 2YNTA 4ZEJA 1DD6A 1ZKPA 3X2XA 2YNVA 3AF5A 1ZNBA 2FU6A 3SW3A 1WUOA 2UYXA 4PVOA 3X2YA 2VW8A 2YZ3A 3I14A 4GCWA 3X30A 3I13A 4ZO2A 3SBLA 3WXCA 5HISA 3DHBA 4TZ9A 2OHHA 2FHXA 3ZWFA 5LM6A 4AD9A 4Z60A
chains in the Genus database with same CATH topology
2YNTB 4YSLA 4Z5YA 1VJNA 1P9EA 4XWTA 4B87A 4D02A 2XR1A 5FQBA 2GKLA 2R2DA 4C1FA 2FU7A 4FEKA 2QJSA 2WYMC 4TYTA 1JT1A 4AX0B 4RAMA 4V0HA 4AWYB 3JXPA 3SFPA 1QH5A 3SPUA 3X2ZA 3BK2A 5IQKA 2I7TA 2GMNA 4TZBA 3PY5A 3ZR9A 2OHIA 2YNWA 1VGNA 3ZNBA 3I11A 4RBSA 4ZNBA 5ACSA 1YCGA 2BIBA 5K0WA 1A7TA 5EHTA 3TP9A 2FU8A 3QH8A 5LSCA 5LCAA 2GFKA 1K07A 5LS3A 1X8HA 5AHRA 5A5ZA 4LE6A 1X8GA 3IEKA 2I7XA 2YCBA 5K4KA 2Y8BA 2FM6A 1DXKA 5B15A 2AIOA 2Q9UA 4EXSA 5LE1A 2H6AA 2BFLA 2HB9A 4BP0A 5AHOA 5EH9A 2BG8A 4Z7RA 2GCUA 5EVKA 3BK1A 4FR7A 2NXAA 2FK6A 3S0ZA 4UWSB 4P62A 2ZNBA 4XUKA 2QEDA 3AF6A 4NQ6A 5HH6A 3PG4A 4RL0A 3ESHA 3IE0A 5AXOA 5EV8A 4CHLA 3LVZA 5HIPA 4UWOB 3PY6A 3T3NA 3MD7A 1ZTCA 4F6ZA 1X8IA 1A8TA 3KL7A 2WHGA 4UA4A 2A7MA 5DPXA 3IELA 3DHAA 2BG8B 2BMIA 2QINA 2NZFA 3FAIA 3RPCA 2BC2A 4C1GA 3IDZA 1WUPA 2BG7A 1E5DA 2P18A 3IOGA 4PVTA 3DHCA 4EY2A 4KEQA 2WRSA 5ACRA 4O98A 4UAMA 5LLDA 3DH8A 1QH3A 1VMEA 2M5CA 5AYAA 1HLKA 5HH5A 3IEMA 3IE2A 3L6NA 3RKKA 1JJTA 3BV6A 4HL2A 3AJ3A 4KEPA 4HL1A 5EV6A 5FQCA 5HH4A 2NZEA 2M5DA 3SD9A 3FCZA 2BFKA 4RM5A 4EYLA 4D1WA 2FU9A 2BG6A 1L9YA 2BFZB 3ZQ4A 4EYBA 2FHXB 5ACUA 3I15A 5A0VA 4UBQA 5FQAA 4DILA 2I7VA 4FSBA 5ACXA 4UWRB 4YSKA 4D1VA 5AXRA 3H3EA 2QDSA 5LCFA 2Q0IA 3A4YA 1BMCA 2Y8AA 3R2UA 4RL2A 3F9OA 2YNUA 1YCHA 2P4ZA 4GYQA 4H0DA 4TYFA 1KO3A 1KR3A 2DKFA 4NQ2A 4D1TA 4RAWA 4JO0A 4C09A 4EXYA 5EVDA 4GYUA 5B3RA 4NQ5A 5LMCA 4Z6XA 5K4NA 3VQZA 2WYMA 2BG2A 2YNVB 3SRXA 3Q6VA 2DOOA 1BVTA 2BTNA 1XM8A 5AEBA 3ADRA 5EWAA 4TZFA 4C1HA 2QDTA 4AWZA 4EYFA 1WRAA 5ACWA 4ZO3A 2AZ4A 4EFZA 3IOFA 5LCHA 1YCFA 4J5HA 4C1EA 4Z67A 2Q0JA 4D1UA 5KILA 2ZWRA 2Y87A 1BC2A 5ACPA 3VPEA 5ACVA 2ZZIA 4U4LA 3IE1A 1WW1A 2XF4A 4HKYA 4TZEA 2GFJA 3G1PA 2CBNA 3RKJA 4BZ3A 5KIKA 5ACTA 2NYPA 1XTOA 4UWPB 3BC2A 3P2UA 4YSBA 5K4MA 5HIOA 1JJEA 1MQOA 4NQ4A 4WD6A 1M2XA 1Y44A 2WYLA 4F6HA 2BR6A 3KNRA 1DDKA 5A0TA 5ACQA 5EW0A 4J5FA 5B1UA 5A87A 2E7YA 3KNSA 1KO2A 2BFZA 2BGAA 4AX1B 5HIQA 3T3OA 2ZO4A 5EVBA 2OHJA 4C1DA 2Q42A 4C1CA 4Z5ZA 2P97A 3T9MA 4DIKA 1SMLA 4XWWA 2P1EA 3I0VA 2YNTA 4ZEJA 1DD6A 1ZKPA 3X2XA 2YNVA 3AF5A 1ZNBA 2FU6A 3SW3A 1WUOA 2UYXA 4PVOA 3X2YA 2VW8A 2YZ3A 3I14A 4GCWA 3X30A 3I13A 4ZO2A 3SBLA 3WXCA 5HISA 3DHBA 4TZ9A 2OHHA 2FHXA 3ZWFA 5LM6A 4AD9A 4Z60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNT B;  4YSL A;  4Z5Y A;  1VJN A;  1P9E A;  4XWT A;  4B87 A;  4D02 A;  2XR1 A;  5FQB A;  2GKL A;  2R2D A;  4C1F A;  2FU7 A;  4FEK A;  2QJS A;  2WYM C;  4TYT A;  1JT1 A;  4AX0 B;  4RAM A;  4V0H A;  4AWY B;  3JXP A;  3SFP A;  1QH5 A;  3SPU A;  3X2Z A;  3BK2 A;  5IQK A;  2I7T A;  2GMN A;  4TZB A;  3PY5 A;  3ZR9 A;  2OHI A;  2YNW A;  1VGN A;  3ZNB A;  3I11 A;  4RBS A;  4ZNB A;  5ACS A;  1YCG A;  2BIB A;  5K0W A;  1A7T A;  5EHT A;  3TP9 A;  2FU8 A;  3QH8 A;  5LSC A;  5LCA A;  2GFK A;  1K07 A;  5LS3 A;  1X8H A;  5AHR A;  5A5Z A;  4LE6 A;  1X8G A;  3IEK A;  2I7X A;  2YCB A;  5K4K A;  2Y8B A;  2FM6 A;  1DXK A;  5B15 A;  2AIO A;  2Q9U A;  4EXS A;  5LE1 A;  2H6A A;  2BFL A;  2HB9 A;  4BP0 A;  5AHO A;  5EH9 A;  2BG8 A;  4Z7R A;  2GCU A;  5EVK A;  3BK1 A;  4FR7 A;  2NXA A;  2FK6 A;  3S0Z A;  4UWS B;  4P62 A;  2ZNB A;  4XUK A;  2QED A;  3AF6 A;  4NQ6 A;  5HH6 A;  3PG4 A;  4RL0 A;  3ESH A;  3IE0 A;  5AXO A;  5EV8 A;  4CHL A;  3LVZ A;  5HIP A;  4UWO B;  3PY6 A;  3T3N A;  3MD7 A;  1ZTC A;  4F6Z A;  1X8I A;  1A8T A;  3KL7 A;  2WHG A;  4UA4 A;  2A7M A;  5DPX A;  3IEL A;  3DHA A;  2BG8 B;  2BMI A;  2QIN A;  2NZF A;  3FAI A;  3RPC A;  2BC2 A;  4C1G A;  3IDZ A;  1WUP A;  2BG7 A;  1E5D A;  2P18 A;  3IOG A;  4PVT A;  3DHC A;  4EY2 A;  4KEQ A;  2WRS A;  5ACR A;  4O98 A;  4UAM A;  5LLD A;  3DH8 A;  1QH3 A;  1VME A;  2M5C A;  5AYA A;  1HLK A;  5HH5 A;  3IEM A;  3IE2 A;  3L6N A;  3RKK A;  1JJT A;  3BV6 A;  4HL2 A;  3AJ3 A;  4KEP A;  4HL1 A;  5EV6 A;  5FQC A;  5HH4 A;  2NZE A;  2M5D A;  3SD9 A;  3FCZ A;  2BFK A;  4RM5 A;  4EYL A;  4D1W A;  2FU9 A;  2BG6 A;  1L9Y A;  2BFZ B;  3ZQ4 A;  4EYB A;  2FHX B;  5ACU A;  3I15 A;  5A0V A;  4UBQ A;  5FQA A;  4DIL A;  2I7V A;  4FSB A;  5ACX A;  4UWR B;  4YSK A;  4D1V A;  5AXR A;  3H3E A;  2QDS A;  5LCF A;  2Q0I A;  3A4Y A;  1BMC A;  2Y8A A;  3R2U A;  4RL2 A;  3F9O A;  2YNU A;  1YCH A;  2P4Z A;  4GYQ A;  4H0D A;  4TYF A;  1KO3 A;  1KR3 A;  2DKF A;  4NQ2 A;  4D1T A;  4RAW A;  4JO0 A;  4C09 A;  4EXY A;  5EVD A;  4GYU A;  5B3R A;  4NQ5 A;  5LMC A;  4Z6X A;  5K4N A;  3VQZ A;  2WYM A;  2BG2 A;  2YNV B;  3SRX A;  3Q6V A;  2DOO A;  1BVT A;  2BTN A;  1XM8 A;  5AEB A;  3ADR A;  5EWA A;  4TZF A;  4C1H A;  2QDT A;  4AWZ A;  4EYF A;  1WRA A;  5ACW A;  4ZO3 A;  2AZ4 A;  4EFZ A;  3IOF A;  5LCH A;  1YCF A;  4J5H A;  4C1E A;  4Z67 A;  2Q0J A;  4D1U A;  5KIL A;  2ZWR A;  2Y87 A;  1BC2 A;  5ACP A;  3VPE A;  5ACV A;  2ZZI A;  4U4L A;  3IE1 A;  1WW1 A;  2XF4 A;  4HKY A;  4TZE A;  2GFJ A;  3G1P A;  2CBN A;  3RKJ A;  4BZ3 A;  5KIK A;  5ACT A;  2NYP A;  1XTO A;  4UWP B;  3BC2 A;  3P2U A;  4YSB A;  5K4M A;  5HIO A;  1JJE A;  1MQO A;  4NQ4 A;  4WD6 A;  1M2X A;  1Y44 A;  2WYL A;  4F6H A;  2BR6 A;  3KNR A;  1DDK A;  5A0T A;  5ACQ A;  5EW0 A;  4J5F A;  5B1U A;  5A87 A;  2E7Y A;  3KNS A;  1KO2 A;  2BFZ A;  2BGA A;  4AX1 B;  5HIQ A;  3T3O A;  2ZO4 A;  5EVB A;  2OHJ A;  4C1D A;  2Q42 A;  4C1C A;  4Z5Z A;  2P97 A;  3T9M A;  4DIK A;  1SML A;  4XWW A;  2P1E A;  3I0V A;  2YNT A;  4ZEJ A;  1DD6 A;  1ZKP A;  3X2X A;  2YNV A;  3AF5 A;  1ZNB A;  2FU6 A;  3SW3 A;  1WUO A;  2UYX A;  4PVO A;  3X2Y A;  2VW8 A;  2YZ3 A;  3I14 A;  4GCW A;  3X30 A;  3I13 A;  4ZO2 A;  3SBL A;  3WXC A;  5HIS A;  3DHB A;  4TZ9 A;  2OHH A;  2FHX A;  3ZWF A;  5LM6 A;  4AD9 A;  4Z60 A; 
#chains in the Genus database with same CATH topology
 2YNT B;  4YSL A;  4Z5Y A;  1VJN A;  1P9E A;  4XWT A;  4B87 A;  4D02 A;  2XR1 A;  5FQB A;  2GKL A;  2R2D A;  4AV7 A;  4C1F A;  2FU7 A;  4FEK A;  2QJS A;  2WYM C;  4TYT A;  1JT1 A;  4AX0 B;  4RAM A;  2CFU A;  4V0H A;  4AWY B;  5AIJ A;  3JXP A;  3SFP A;  1QH5 A;  3SPU A;  3X2Z A;  3BK2 A;  5IQK A;  2I7T A;  2GMN A;  4TZB A;  3PY5 A;  3ZR9 A;  2OHI A;  2YNW A;  1VGN A;  3ZNB A;  3I11 A;  4RBS A;  4ZNB A;  5ACS A;  1YCG A;  2BIB A;  5K0W A;  1A7T A;  5EHT A;  5A23 A;  3TP9 A;  2FU8 A;  3QH8 A;  5LSC A;  5LCA A;  2GFK A;  1K07 A;  5LS3 A;  2CG3 A;  1X8H A;  5AHR A;  5A5Z A;  4LE6 A;  1X8G A;  3IEK A;  2I7X A;  2YCB A;  5K4K A;  2Y8B A;  2FM6 A;  1DXK A;  5B15 A;  2AIO A;  2Q9U A;  4EXS A;  5LE1 A;  4PDX A;  2H6A A;  2BFL A;  2HB9 A;  4BP0 A;  5AHO A;  5EH9 A;  2BG8 A;  4Z7R A;  2GCU A;  5EVK A;  3BK1 A;  4FR7 A;  2NXA A;  2FK6 A;  3S0Z A;  4UWS B;  4P62 A;  2ZNB A;  4XUK A;  2QED A;  3AF6 A;  4NQ6 A;  5HH6 A;  3PG4 A;  4RL0 A;  3ESH A;  3IE0 A;  5AXO A;  5EV8 A;  4CHL A;  3LVZ A;  5HIP A;  4UWO B;  3PY6 A;  3T3N A;  3MD7 A;  1ZTC A;  4F6Z A;  1X8I A;  1A8T A;  3KL7 A;  2WHG A;  4UA4 A;  2A7M A;  5DPX A;  3IEL A;  3DHA A;  2BG8 B;  2BMI A;  2QIN A;  2NZF A;  3FAI A;  3RPC A;  2BC2 A;  4C1G A;  3IDZ A;  1WUP A;  2BG7 A;  1E5D A;  2P18 A;  3IOG A;  4PVT A;  3DHC A;  4EY2 A;  4KEQ A;  2WRS A;  5ACR A;  4O98 A;  4UAM A;  5LLD A;  3DH8 A;  1QH3 A;  1VME A;  2M5C A;  5AYA A;  1HLK A;  5HH5 A;  3IEM A;  3IE2 A;  3L6N A;  3RKK A;  1JJT A;  3BV6 A;  2YHE A;  4HL2 A;  3AJ3 A;  4KEP A;  4HL1 A;  5EV6 A;  5FQC A;  4NUR A;  5HH4 A;  2NZE A;  2M5D A;  3SD9 A;  3FCZ A;  2BFK A;  4RM5 A;  4EYL A;  4D1W A;  2FU9 A;  2BG6 A;  1L9Y A;  2BFZ B;  3ZQ4 A;  4EYB A;  2FHX B;  5ACU A;  3I15 A;  5A0V A;  4UBQ A;  5FQA A;  4DIL A;  2I7V A;  4FSB A;  5ACX A;  4UWR B;  4YSK A;  4D1V A;  5AXR A;  3H3E A;  2QDS A;  5LCF A;  2Q0I A;  3A4Y A;  1BMC A;  2Y8A A;  3R2U A;  4RL2 A;  3F9O A;  2YNU A;  1YCH A;  2P4Z A;  4GYQ A;  4H0D A;  4TYF A;  1KO3 A;  1KR3 A;  2DKF A;  4NQ2 A;  4D1T A;  4RAW A;  4JO0 A;  4C09 A;  4EXY A;  5EVD A;  4GYU A;  5B3R A;  4NQ5 A;  5LMC A;  4Z6X A;  5K4N A;  3VQZ A;  2WYM A;  2BG2 A;  2YNV B;  3SRX A;  3Q6V A;  2DOO A;  1BVT A;  2BTN A;  1XM8 A;  5AEB A;  3ADR A;  5EWA A;  2CFZ A;  4TZF A;  4C1H A;  2QDT A;  4AWZ A;  4EYF A;  2CG2 A;  1WRA A;  5ACW A;  4ZO3 A;  2AZ4 A;  4EFZ A;  3IOF A;  5LCH A;  1YCF A;  4J5H A;  4C1E A;  4Z67 A;  2Q0J A;  4D1U A;  5KIL A;  2ZWR A;  2Y87 A;  1BC2 A;  5ACP A;  3VPE A;  5ACV A;  2ZZI A;  4U4L A;  3IE1 A;  1WW1 A;  2XF4 A;  5AJL A;  4HKY A;  4TZE A;  2GFJ A;  3G1P A;  2CBN A;  3RKJ A;  4BZ3 A;  5KIK A;  5ACT A;  2NYP A;  1XTO A;  4UWP B;  3BC2 A;  3P2U A;  4YSB A;  5K4M A;  5HIO A;  1JJE A;  1MQO A;  4NQ4 A;  4AXH A;  4WD6 A;  1M2X A;  1Y44 A;  2WYL A;  4F6H A;  2BR6 A;  3KNR A;  1DDK A;  5A0T A;  5ACQ A;  5EW0 A;  4J5F A;  5B1U A;  5A87 A;  2E7Y A;  3KNS A;  1KO2 A;  2BFZ A;  2BGA A;  4AX1 B;  5HIQ A;  3T3O A;  2ZO4 A;  5EVB A;  2OHJ A;  4C1D A;  2Q42 A;  4C1C A;  4Z5Z A;  2P97 A;  3T9M A;  4DIK A;  1SML A;  4XWW A;  2P1E A;  3I0V A;  2YNT A;  4ZEJ A;  1DD6 A;  1ZKP A;  3X2X A;  2YNV A;  3AF5 A;  1ZNB A;  2FU6 A;  3SW3 A;  1WUO A;  2UYX A;  4PVO A;  3X2Y A;  2VW8 A;  2YZ3 A;  3I14 A;  4GCW A;  3X30 A;  3I13 A;  4ZO2 A;  3SBL A;  3WXC A;  5HIS A;  3DHB A;  4TZ9 A;  2OHH A;  2FHX A;  3ZWF A;  5LM6 A;  4AD9 A;  4Z60 A; 
#chains in the Genus database with same CATH homology
 2YNT B;  4YSL A;  4Z5Y A;  1VJN A;  1P9E A;  4XWT A;  4B87 A;  4D02 A;  2XR1 A;  5FQB A;  2GKL A;  2R2D A;  4C1F A;  2FU7 A;  4FEK A;  2QJS A;  2WYM C;  4TYT A;  1JT1 A;  4AX0 B;  4RAM A;  4V0H A;  4AWY B;  3JXP A;  3SFP A;  1QH5 A;  3SPU A;  3X2Z A;  3BK2 A;  5IQK A;  2I7T A;  2GMN A;  4TZB A;  3PY5 A;  3ZR9 A;  2OHI A;  2YNW A;  1VGN A;  3ZNB A;  3I11 A;  4RBS A;  4ZNB A;  5ACS A;  1YCG A;  2BIB A;  5K0W A;  1A7T A;  5EHT A;  3TP9 A;  2FU8 A;  3QH8 A;  5LSC A;  5LCA A;  2GFK A;  1K07 A;  5LS3 A;  1X8H A;  5AHR A;  5A5Z A;  4LE6 A;  1X8G A;  3IEK A;  2I7X A;  2YCB A;  5K4K A;  2Y8B A;  2FM6 A;  1DXK A;  5B15 A;  2AIO A;  2Q9U A;  4EXS A;  5LE1 A;  2H6A A;  2BFL A;  2HB9 A;  4BP0 A;  5AHO A;  5EH9 A;  2BG8 A;  4Z7R A;  2GCU A;  5EVK A;  3BK1 A;  4FR7 A;  2NXA A;  2FK6 A;  3S0Z A;  4UWS B;  4P62 A;  2ZNB A;  4XUK A;  2QED A;  3AF6 A;  4NQ6 A;  5HH6 A;  3PG4 A;  4RL0 A;  3ESH A;  3IE0 A;  5AXO A;  5EV8 A;  4CHL A;  3LVZ A;  5HIP A;  4UWO B;  3PY6 A;  3T3N A;  3MD7 A;  1ZTC A;  4F6Z A;  1X8I A;  1A8T A;  3KL7 A;  2WHG A;  4UA4 A;  2A7M A;  5DPX A;  3IEL A;  3DHA A;  2BG8 B;  2BMI A;  2QIN A;  2NZF A;  3FAI A;  3RPC A;  2BC2 A;  4C1G A;  3IDZ A;  1WUP A;  2BG7 A;  1E5D A;  2P18 A;  3IOG A;  4PVT A;  3DHC A;  4EY2 A;  4KEQ A;  2WRS A;  5ACR A;  4O98 A;  4UAM A;  5LLD A;  3DH8 A;  1QH3 A;  1VME A;  2M5C A;  5AYA A;  1HLK A;  5HH5 A;  3IEM A;  3IE2 A;  3L6N A;  3RKK A;  1JJT A;  3BV6 A;  4HL2 A;  3AJ3 A;  4KEP A;  4HL1 A;  5EV6 A;  5FQC A;  5HH4 A;  2NZE A;  2M5D A;  3SD9 A;  3FCZ A;  2BFK A;  4RM5 A;  4EYL A;  4D1W A;  2FU9 A;  2BG6 A;  1L9Y A;  2BFZ B;  3ZQ4 A;  4EYB A;  2FHX B;  5ACU A;  3I15 A;  5A0V A;  4UBQ A;  5FQA A;  4DIL A;  2I7V A;  4FSB A;  5ACX A;  4UWR B;  4YSK A;  4D1V A;  5AXR A;  3H3E A;  2QDS A;  5LCF A;  2Q0I A;  3A4Y A;  1BMC A;  2Y8A A;  3R2U A;  4RL2 A;  3F9O A;  2YNU A;  1YCH A;  2P4Z A;  4GYQ A;  4H0D A;  4TYF A;  1KO3 A;  1KR3 A;  2DKF A;  4NQ2 A;  4D1T A;  4RAW A;  4JO0 A;  4C09 A;  4EXY A;  5EVD A;  4GYU A;  5B3R A;  4NQ5 A;  5LMC A;  4Z6X A;  5K4N A;  3VQZ A;  2WYM A;  2BG2 A;  2YNV B;  3SRX A;  3Q6V A;  2DOO A;  1BVT A;  2BTN A;  1XM8 A;  5AEB A;  3ADR A;  5EWA A;  4TZF A;  4C1H A;  2QDT A;  4AWZ A;  4EYF A;  1WRA A;  5ACW A;  4ZO3 A;  2AZ4 A;  4EFZ A;  3IOF A;  5LCH A;  1YCF A;  4J5H A;  4C1E A;  4Z67 A;  2Q0J A;  4D1U A;  5KIL A;  2ZWR A;  2Y87 A;  1BC2 A;  5ACP A;  3VPE A;  5ACV A;  2ZZI A;  4U4L A;  3IE1 A;  1WW1 A;  2XF4 A;  4HKY A;  4TZE A;  2GFJ A;  3G1P A;  2CBN A;  3RKJ A;  4BZ3 A;  5KIK A;  5ACT A;  2NYP A;  1XTO A;  4UWP B;  3BC2 A;  3P2U A;  4YSB A;  5K4M A;  5HIO A;  1JJE A;  1MQO A;  4NQ4 A;  4WD6 A;  1M2X A;  1Y44 A;  2WYL A;  4F6H A;  2BR6 A;  3KNR A;  1DDK A;  5A0T A;  5ACQ A;  5EW0 A;  4J5F A;  5B1U A;  5A87 A;  2E7Y A;  3KNS A;  1KO2 A;  2BFZ A;  2BGA A;  4AX1 B;  5HIQ A;  3T3O A;  2ZO4 A;  5EVB A;  2OHJ A;  4C1D A;  2Q42 A;  4C1C A;  4Z5Z A;  2P97 A;  3T9M A;  4DIK A;  1SML A;  4XWW A;  2P1E A;  3I0V A;  2YNT A;  4ZEJ A;  1DD6 A;  1ZKP A;  3X2X A;  2YNV A;  3AF5 A;  1ZNB A;  2FU6 A;  3SW3 A;  1WUO A;  2UYX A;  4PVO A;  3X2Y A;  2VW8 A;  2YZ3 A;  3I14 A;  4GCW A;  3X30 A;  3I13 A;  4ZO2 A;  3SBL A;  3WXC A;  5HIS A;  3DHB A;  4TZ9 A;  2OHH A;  2FHX A;  3ZWF A;  5LM6 A;  4AD9 A;  4Z60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...