5EHTA

Indirect contributions of mutations underlie optimization of new enzyme function
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
253
structure length
252
Chain Sequence
GHMATVKKLYFVPAGRCMLDHSFVNSALTPGKLLNVPVWCYLLETEEGPILVDTGMPESAVNNEGLNGTFGEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMTECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPMIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acyl homoserine lactonase
publication title Conformational Tinkering Drives Evolution of a Promiscuous Activity through Indirect Mutational Effects.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 84
structure length 252
sequence length 253
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ehtA01
1YCHA 5FQCA 4EYBA 2BC2A 2WYMC 2FU8A 5K4MA 4XUKA 5HIOA 2CBNA 4C1FA 1VMEA 5HH4A 5HIQA 1JJEA 3F9OA 4C1EA 3VPEA 4AX0B 3SW3A 3IE1A 2WYMA 4J5HA 3PG4A 1QH3A 1WUPA 4DIKA 3SRXA 1WUOA 3BK1A 3BC2A 5LCFA 2GCUA 2FM6A 4ZNBA 3ZWFA 5A0TA 2NZFA 3RKKA 3X2XA 1WRAA 2FU6A 3VQZA 3JXPA 1SMLA 1K07A 5LMCA 3I14A 5ACVA 4KEQA 1X8GA 3IOFA 3SD9A 4H0DA 4LE6A 1DDKA 4TYFA 1KO2A 5ACQA 4Z5ZA 3PY6A 4Z6XA 5ACUA 3R2UA 3DH8A 5A5ZA 5EW0A 1E5DA 2QDTA 2Y8BA 4TZFA 3FAIA 5ACRA 3X30A 1DXKA 2YNVA 3I15A 2Q42A 5A87A 2BG6A 4D1VA 5HISA 1BMCA 2DKFA 1M2XA 2YNVB 3X2YA 5EV6A 2FK6A 5B3RA 3ADRA 5ACXA 4UWRB 3G1PA 2AZ4A 4RL0A 1QH5A 4AWZA 1L9YA 2BIBA 1ZTCA 4ZO2A 1BVTA 4Z7RA 4EXYA 4TZBA 2NXAA 1ZKPA 1VGNA 2AIOA 4B87A 3TP9A 3X2ZA 5ACSA 2QDSA 2XF4A 3SFPA 3KNRA 1XTOA 4NQ2A 3QH8A 4DILA 5HH5A 4ZO3A 1YCFA 3Q6VA 5B15A 4UAMA 5K4KA 4NQ4A 2FU7A 2I7VA 3PY5A 3AF5A 2XR1A 5DPXA 2BTNA 3L6NA 2QJSA 5AXOA 1ZNBA 3DHAA 2M5DA 5LE1A 5EHTA 1VJNA 1KO3A 4D02A 3IE0A 4D1WA 1A8TA 2GFKA 5KILA 2BGAA 5LS3A 4D1UA 4AX1B 4XWTA 4EYLA 4UWPB 3LVZA 2Q0JA 5KIKA 3SPUA 2WYLA 3DHBA 5HIPA 4J5FA 3IE2A 1A7TA 3IDZA 3H3EA 4RL2A 3RKJA 2QINA 5AHRA 5FQAA 3IEKA 2ZNBA 4AWYB 1BC2A 1JT1A 5IQKA 3I11A 4F6ZA 2BFLA 2FHXB 4YSKA 2P18A 1WW1A 2A7MA 4C1HA 2H6AA 3SBLA 2GFJA 4FEKA 3WXCA 4O98A 4V0HA 2I7XA 5EH9A 1DD6A 3DHCA 4NQ5A 3KL7A 4Z5YA 5HH6A 4GYUA 4FR7A 4NQ6A 2E7YA 4XWWA 2NZEA 2YNWA 4CHLA 4AD9A 2YNUA 2R2DA 4P62A 2UYXA 2GMNA 1X8IA 1HLKA 4FSBA 1Y44A 1KR3A 2WRSA 3MD7A 2BFKA 3IEMA 3T9MA 4U4LA 4HKYA 4RAWA 4PVOA 4TZ9A 4F6HA 5B1UA 2YNTA 5EWAA 2BG8A 2P1EA 5AHOA 3BV6A 4BP0A 4UWSB 4TYTA 3KNSA 2YNTB 2BG8B 2M5CA 2P97A 4BZ3A 5EVBA 2WHGA 2FU9A 3AF6A 4EXSA 4UWOB 5AEBA 4TZEA 5AYAA 1JJTA 4ZEJA 4RAMA 5EVKA 4HL1A 1YCGA 5K0WA 2ZO4A 4EFZA 5ACTA 4PVTA 3AJ3A 2ZZIA 2OHHA 2BG2A 2BR6A 5AXRA 4EY2A 4UBQA 3RPCA 2FHXA 4YSBA 4C1GA 2YZ3A 5LLDA 5ACPA 4GYQA 2Y87A 4HL2A 3IELA 2BG7A 4RM5A 3BK2A 2BFZA 2Q0IA 3A4YA 2OHIA 2BFZB 4C1DA 2NYPA 4Z67A 4GCWA 3I13A 4YSLA 4C09A 2VW8A 3ZNBA 2I7TA 4D1TA 2Q9UA 1P9EA 3I0VA 5LCHA 4EYFA 5EVDA 4JO0A 4WD6A 2DOOA 5A0VA 3FCZA 2QEDA 5LCAA 2YCBA 3ZR9A 3T3OA 4UA4A 2Y8AA 4KEPA 1MQOA 4Z60A 5K4NA 4C1CA 2ZWRA 2OHJA 3ESHA 1X8HA 3T3NA 5LSCA 5ACWA 2BMIA 2P4ZA 5EV8A 3IOGA 3P2UA 3ZQ4A 2HB9A 1XM8A 4RBSA 2GKLA 5LM6A 3S0ZA 5FQBA
chains in the Genus database with same CATH superfamily
1YCHA 5FQCA 4EYBA 2BC2A 2WYMC 2FU8A 5K4MA 4XUKA 5HIOA 2CBNA 4C1FA 1VMEA 5HH4A 5HIQA 1JJEA 3F9OA 4C1EA 2CFUA 3VPEA 4AX0B 3SW3A 3IE1A 2WYMA 4J5HA 3PG4A 1QH3A 1WUPA 4DIKA 3SRXA 1WUOA 3BK1A 3BC2A 5LCFA 2GCUA 2FM6A 4ZNBA 3ZWFA 5A0TA 2NZFA 3RKKA 3X2XA 1WRAA 2FU6A 3VQZA 3JXPA 1SMLA 1K07A 5LMCA 3I14A 5ACVA 4KEQA 1X8GA 3IOFA 3SD9A 4H0DA 4LE6A 1DDKA 4TYFA 1KO2A 5ACQA 4Z5ZA 3PY6A 4Z6XA 5ACUA 3R2UA 3DH8A 5A5ZA 5EW0A 1E5DA 2QDTA 2Y8BA 4TZFA 3FAIA 5ACRA 3X30A 1DXKA 2YNVA 3I15A 2Q42A 5A87A 2BG6A 4D1VA 5HISA 1BMCA 2DKFA 4AV7A 1M2XA 2YNVB 3X2YA 5EV6A 2FK6A 5B3RA 3ADRA 5ACXA 4UWRB 3G1PA 2AZ4A 4RL0A 1QH5A 4AWZA 1L9YA 2BIBA 1ZTCA 4ZO2A 1BVTA 4Z7RA 4EXYA 4TZBA 2NXAA 1ZKPA 1VGNA 2AIOA 4B87A 3TP9A 3X2ZA 5ACSA 2QDSA 2XF4A 3SFPA 3KNRA 1XTOA 4NQ2A 3QH8A 4DILA 5HH5A 4ZO3A 1YCFA 3Q6VA 5B15A 4UAMA 5K4KA 4NQ4A 2FU7A 2I7VA 3PY5A 3AF5A 2XR1A 5DPXA 2BTNA 3L6NA 2QJSA 5AXOA 1ZNBA 3DHAA 2M5DA 5LE1A 5EHTA 1VJNA 1KO3A 4D02A 3IE0A 4D1WA 1A8TA 2GFKA 5KILA 2BGAA 5LS3A 4D1UA 4AX1B 4XWTA 4EYLA 4UWPB 4NURA 3LVZA 2Q0JA 5KIKA 3SPUA 2WYLA 3DHBA 5HIPA 4J5FA 3IE2A 1A7TA 3IDZA 3H3EA 4RL2A 3RKJA 2QINA 5AHRA 5FQAA 3IEKA 2ZNBA 5AJLA 4AWYB 1BC2A 1JT1A 5IQKA 3I11A 4F6ZA 2BFLA 2FHXB 4YSKA 2P18A 1WW1A 2A7MA 4C1HA 2H6AA 3SBLA 2GFJA 4FEKA 3WXCA 4O98A 4V0HA 2I7XA 5EH9A 1DD6A 3DHCA 4NQ5A 3KL7A 4Z5YA 5HH6A 4GYUA 4FR7A 4NQ6A 2E7YA 4XWWA 2NZEA 2YNWA 4CHLA 4AD9A 2YNUA 2R2DA 4P62A 2UYXA 2GMNA 1X8IA 1HLKA 4FSBA 1Y44A 1KR3A 2WRSA 3MD7A 2BFKA 2CG2A 3IEMA 3T9MA 4U4LA 4HKYA 4RAWA 4PVOA 4TZ9A 4F6HA 5B1UA 2YNTA 5EWAA 2BG8A 2P1EA 5AHOA 3BV6A 4BP0A 4UWSB 4TYTA 3KNSA 2YNTB 2BG8B 2M5CA 5AIJA 2P97A 4BZ3A 5EVBA 2WHGA 2FU9A 3AF6A 4EXSA 4UWOB 5AEBA 4TZEA 5AYAA 1JJTA 4ZEJA 4RAMA 5EVKA 4PDXA 4HL1A 1YCGA 5K0WA 2ZO4A 2YHEA 4EFZA 5ACTA 4PVTA 3AJ3A 2ZZIA 2OHHA 2BG2A 2BR6A 5AXRA 4EY2A 4UBQA 3RPCA 2FHXA 4YSBA 4C1GA 2YZ3A 5LLDA 5ACPA 4GYQA 2Y87A 2CG3A 4HL2A 2CFZA 3IELA 2BG7A 4RM5A 3BK2A 2BFZA 2Q0IA 3A4YA 2OHIA 2BFZB 4C1DA 2NYPA 4Z67A 4GCWA 3I13A 4YSLA 4C09A 2VW8A 3ZNBA 2I7TA 4D1TA 2Q9UA 1P9EA 3I0VA 4AXHA 5LCHA 4EYFA 5EVDA 4JO0A 4WD6A 2DOOA 5A0VA 3FCZA 2QEDA 5LCAA 2YCBA 3ZR9A 3T3OA 4UA4A 2Y8AA 4KEPA 1MQOA 4Z60A 5K4NA 4C1CA 2ZWRA 2OHJA 3ESHA 1X8HA 3T3NA 5LSCA 5ACWA 2BMIA 2P4ZA 5EV8A 3IOGA 3P2UA 3ZQ4A 5A23A 2HB9A 1XM8A 4RBSA 2GKLA 5LM6A 3S0ZA 5FQBA
chains in the Genus database with same CATH topology
1YCHA 5FQCA 4EYBA 2BC2A 2WYMC 2FU8A 5K4MA 4XUKA 5HIOA 2CBNA 4C1FA 1VMEA 5HH4A 5HIQA 1JJEA 3F9OA 4C1EA 3VPEA 4AX0B 3SW3A 3IE1A 2WYMA 4J5HA 3PG4A 1QH3A 1WUPA 4DIKA 3SRXA 1WUOA 3BK1A 3BC2A 5LCFA 2GCUA 2FM6A 4ZNBA 3ZWFA 5A0TA 2NZFA 3RKKA 3X2XA 1WRAA 2FU6A 3VQZA 3JXPA 1SMLA 1K07A 5LMCA 3I14A 5ACVA 4KEQA 1X8GA 3IOFA 3SD9A 4H0DA 4LE6A 1DDKA 4TYFA 1KO2A 5ACQA 4Z5ZA 3PY6A 4Z6XA 5ACUA 3R2UA 3DH8A 5A5ZA 5EW0A 1E5DA 2QDTA 2Y8BA 4TZFA 3FAIA 5ACRA 3X30A 1DXKA 2YNVA 3I15A 2Q42A 5A87A 2BG6A 4D1VA 5HISA 1BMCA 2DKFA 1M2XA 2YNVB 3X2YA 5EV6A 2FK6A 5B3RA 3ADRA 5ACXA 4UWRB 3G1PA 2AZ4A 4RL0A 1QH5A 4AWZA 1L9YA 2BIBA 1ZTCA 4ZO2A 1BVTA 4Z7RA 4EXYA 4TZBA 2NXAA 1ZKPA 1VGNA 2AIOA 4B87A 3TP9A 3X2ZA 5ACSA 2QDSA 2XF4A 3SFPA 3KNRA 1XTOA 4NQ2A 3QH8A 4DILA 5HH5A 4ZO3A 1YCFA 3Q6VA 5B15A 4UAMA 5K4KA 4NQ4A 2FU7A 2I7VA 3PY5A 3AF5A 2XR1A 5DPXA 2BTNA 3L6NA 2QJSA 5AXOA 1ZNBA 3DHAA 2M5DA 5LE1A 5EHTA 1VJNA 1KO3A 4D02A 3IE0A 4D1WA 1A8TA 2GFKA 5KILA 2BGAA 5LS3A 4D1UA 4AX1B 4XWTA 4EYLA 4UWPB 3LVZA 2Q0JA 5KIKA 3SPUA 2WYLA 3DHBA 5HIPA 4J5FA 3IE2A 1A7TA 3IDZA 3H3EA 4RL2A 3RKJA 2QINA 5AHRA 5FQAA 3IEKA 2ZNBA 4AWYB 1BC2A 1JT1A 5IQKA 3I11A 4F6ZA 2BFLA 2FHXB 4YSKA 2P18A 1WW1A 2A7MA 4C1HA 2H6AA 3SBLA 2GFJA 4FEKA 3WXCA 4O98A 4V0HA 2I7XA 5EH9A 1DD6A 3DHCA 4NQ5A 3KL7A 4Z5YA 5HH6A 4GYUA 4FR7A 4NQ6A 2E7YA 4XWWA 2NZEA 2YNWA 4CHLA 4AD9A 2YNUA 2R2DA 4P62A 2UYXA 2GMNA 1X8IA 1HLKA 4FSBA 1Y44A 1KR3A 2WRSA 3MD7A 2BFKA 3IEMA 3T9MA 4U4LA 4HKYA 4RAWA 4PVOA 4TZ9A 4F6HA 5B1UA 2YNTA 5EWAA 2BG8A 2P1EA 5AHOA 3BV6A 4BP0A 4UWSB 4TYTA 3KNSA 2YNTB 2BG8B 2M5CA 2P97A 4BZ3A 5EVBA 2WHGA 2FU9A 3AF6A 4EXSA 4UWOB 5AEBA 4TZEA 5AYAA 1JJTA 4ZEJA 4RAMA 5EVKA 4HL1A 1YCGA 5K0WA 2ZO4A 4EFZA 5ACTA 4PVTA 3AJ3A 2ZZIA 2OHHA 2BG2A 2BR6A 5AXRA 4EY2A 4UBQA 3RPCA 2FHXA 4YSBA 4C1GA 2YZ3A 5LLDA 5ACPA 4GYQA 2Y87A 4HL2A 3IELA 2BG7A 4RM5A 3BK2A 2BFZA 2Q0IA 3A4YA 2OHIA 2BFZB 4C1DA 2NYPA 4Z67A 4GCWA 3I13A 4YSLA 4C09A 2VW8A 3ZNBA 2I7TA 4D1TA 2Q9UA 1P9EA 3I0VA 5LCHA 4EYFA 5EVDA 4JO0A 4WD6A 2DOOA 5A0VA 3FCZA 2QEDA 5LCAA 2YCBA 3ZR9A 3T3OA 4UA4A 2Y8AA 4KEPA 1MQOA 4Z60A 5K4NA 4C1CA 2ZWRA 2OHJA 3ESHA 1X8HA 3T3NA 5LSCA 5ACWA 2BMIA 2P4ZA 5EV8A 3IOGA 3P2UA 3ZQ4A 2HB9A 1XM8A 4RBSA 2GKLA 5LM6A 3S0ZA 5FQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCH A;  5FQC A;  4EYB A;  2BC2 A;  2WYM C;  2FU8 A;  5K4M A;  4XUK A;  5HIO A;  2CBN A;  4C1F A;  1VME A;  5HH4 A;  5HIQ A;  1JJE A;  3F9O A;  4C1E A;  3VPE A;  4AX0 B;  3SW3 A;  3IE1 A;  2WYM A;  4J5H A;  3PG4 A;  1QH3 A;  1WUP A;  4DIK A;  3SRX A;  1WUO A;  3BK1 A;  3BC2 A;  5LCF A;  2GCU A;  2FM6 A;  4ZNB A;  3ZWF A;  5A0T A;  2NZF A;  3RKK A;  3X2X A;  1WRA A;  2FU6 A;  3VQZ A;  3JXP A;  1SML A;  1K07 A;  5LMC A;  3I14 A;  5ACV A;  4KEQ A;  1X8G A;  3IOF A;  3SD9 A;  4H0D A;  4LE6 A;  1DDK A;  4TYF A;  1KO2 A;  5ACQ A;  4Z5Z A;  3PY6 A;  4Z6X A;  5ACU A;  3R2U A;  3DH8 A;  5A5Z A;  5EW0 A;  1E5D A;  2QDT A;  2Y8B A;  4TZF A;  3FAI A;  5ACR A;  3X30 A;  1DXK A;  2YNV A;  3I15 A;  2Q42 A;  5A87 A;  2BG6 A;  4D1V A;  5HIS A;  1BMC A;  2DKF A;  1M2X A;  2YNV B;  3X2Y A;  5EV6 A;  2FK6 A;  5B3R A;  3ADR A;  5ACX A;  4UWR B;  3G1P A;  2AZ4 A;  4RL0 A;  1QH5 A;  4AWZ A;  1L9Y A;  2BIB A;  1ZTC A;  4ZO2 A;  1BVT A;  4Z7R A;  4EXY A;  4TZB A;  2NXA A;  1ZKP A;  1VGN A;  2AIO A;  4B87 A;  3TP9 A;  3X2Z A;  5ACS A;  2QDS A;  2XF4 A;  3SFP A;  3KNR A;  1XTO A;  4NQ2 A;  3QH8 A;  4DIL A;  5HH5 A;  4ZO3 A;  1YCF A;  3Q6V A;  5B15 A;  4UAM A;  5K4K A;  4NQ4 A;  2FU7 A;  2I7V A;  3PY5 A;  3AF5 A;  2XR1 A;  5DPX A;  2BTN A;  3L6N A;  2QJS A;  5AXO A;  1ZNB A;  3DHA A;  2M5D A;  5LE1 A;  5EHT A;  1VJN A;  1KO3 A;  4D02 A;  3IE0 A;  4D1W A;  1A8T A;  2GFK A;  5KIL A;  2BGA A;  5LS3 A;  4D1U A;  4AX1 B;  4XWT A;  4EYL A;  4UWP B;  3LVZ A;  2Q0J A;  5KIK A;  3SPU A;  2WYL A;  3DHB A;  5HIP A;  4J5F A;  3IE2 A;  1A7T A;  3IDZ A;  3H3E A;  4RL2 A;  3RKJ A;  2QIN A;  5AHR A;  5FQA A;  3IEK A;  2ZNB A;  4AWY B;  1BC2 A;  1JT1 A;  5IQK A;  3I11 A;  4F6Z A;  2BFL A;  2FHX B;  4YSK A;  2P18 A;  1WW1 A;  2A7M A;  4C1H A;  2H6A A;  3SBL A;  2GFJ A;  4FEK A;  3WXC A;  4O98 A;  4V0H A;  2I7X A;  5EH9 A;  1DD6 A;  3DHC A;  4NQ5 A;  3KL7 A;  4Z5Y A;  5HH6 A;  4GYU A;  4FR7 A;  4NQ6 A;  2E7Y A;  4XWW A;  2NZE A;  2YNW A;  4CHL A;  4AD9 A;  2YNU A;  2R2D A;  4P62 A;  2UYX A;  2GMN A;  1X8I A;  1HLK A;  4FSB A;  1Y44 A;  1KR3 A;  2WRS A;  3MD7 A;  2BFK A;  3IEM A;  3T9M A;  4U4L A;  4HKY A;  4RAW A;  4PVO A;  4TZ9 A;  4F6H A;  5B1U A;  2YNT A;  5EWA A;  2BG8 A;  2P1E A;  5AHO A;  3BV6 A;  4BP0 A;  4UWS B;  4TYT A;  3KNS A;  2YNT B;  2BG8 B;  2M5C A;  2P97 A;  4BZ3 A;  5EVB A;  2WHG A;  2FU9 A;  3AF6 A;  4EXS A;  4UWO B;  5AEB A;  4TZE A;  5AYA A;  1JJT A;  4ZEJ A;  4RAM A;  5EVK A;  4HL1 A;  1YCG A;  5K0W A;  2ZO4 A;  4EFZ A;  5ACT A;  4PVT A;  3AJ3 A;  2ZZI A;  2OHH A;  2BG2 A;  2BR6 A;  5AXR A;  4EY2 A;  4UBQ A;  3RPC A;  2FHX A;  4YSB A;  4C1G A;  2YZ3 A;  5LLD A;  5ACP A;  4GYQ A;  2Y87 A;  4HL2 A;  3IEL A;  2BG7 A;  4RM5 A;  3BK2 A;  2BFZ A;  2Q0I A;  3A4Y A;  2OHI A;  2BFZ B;  4C1D A;  2NYP A;  4Z67 A;  4GCW A;  3I13 A;  4YSL A;  4C09 A;  2VW8 A;  3ZNB A;  2I7T A;  4D1T A;  2Q9U A;  1P9E A;  3I0V A;  5LCH A;  4EYF A;  5EVD A;  4JO0 A;  4WD6 A;  2DOO A;  5A0V A;  3FCZ A;  2QED A;  5LCA A;  2YCB A;  3ZR9 A;  3T3O A;  4UA4 A;  2Y8A A;  4KEP A;  1MQO A;  4Z60 A;  5K4N A;  4C1C A;  2ZWR A;  2OHJ A;  3ESH A;  1X8H A;  3T3N A;  5LSC A;  5ACW A;  2BMI A;  2P4Z A;  5EV8 A;  3IOG A;  3P2U A;  3ZQ4 A;  2HB9 A;  1XM8 A;  4RBS A;  2GKL A;  5LM6 A;  3S0Z A;  5FQB A; 
#chains in the Genus database with same CATH topology
 1YCH A;  5FQC A;  4EYB A;  2BC2 A;  2WYM C;  2FU8 A;  5K4M A;  4XUK A;  5HIO A;  2CBN A;  4C1F A;  1VME A;  5HH4 A;  5HIQ A;  1JJE A;  3F9O A;  4C1E A;  2CFU A;  3VPE A;  4AX0 B;  3SW3 A;  3IE1 A;  2WYM A;  4J5H A;  3PG4 A;  1QH3 A;  1WUP A;  4DIK A;  3SRX A;  1WUO A;  3BK1 A;  3BC2 A;  5LCF A;  2GCU A;  2FM6 A;  4ZNB A;  3ZWF A;  5A0T A;  2NZF A;  3RKK A;  3X2X A;  1WRA A;  2FU6 A;  3VQZ A;  3JXP A;  1SML A;  1K07 A;  5LMC A;  3I14 A;  5ACV A;  4KEQ A;  1X8G A;  3IOF A;  3SD9 A;  4H0D A;  4LE6 A;  1DDK A;  4TYF A;  1KO2 A;  5ACQ A;  4Z5Z A;  3PY6 A;  4Z6X A;  5ACU A;  3R2U A;  3DH8 A;  5A5Z A;  5EW0 A;  1E5D A;  2QDT A;  2Y8B A;  4TZF A;  3FAI A;  5ACR A;  3X30 A;  1DXK A;  2YNV A;  3I15 A;  2Q42 A;  5A87 A;  2BG6 A;  4D1V A;  5HIS A;  1BMC A;  2DKF A;  4AV7 A;  1M2X A;  2YNV B;  3X2Y A;  5EV6 A;  2FK6 A;  5B3R A;  3ADR A;  5ACX A;  4UWR B;  3G1P A;  2AZ4 A;  4RL0 A;  1QH5 A;  4AWZ A;  1L9Y A;  2BIB A;  1ZTC A;  4ZO2 A;  1BVT A;  4Z7R A;  4EXY A;  4TZB A;  2NXA A;  1ZKP A;  1VGN A;  2AIO A;  4B87 A;  3TP9 A;  3X2Z A;  5ACS A;  2QDS A;  2XF4 A;  3SFP A;  3KNR A;  1XTO A;  4NQ2 A;  3QH8 A;  4DIL A;  5HH5 A;  4ZO3 A;  1YCF A;  3Q6V A;  5B15 A;  4UAM A;  5K4K A;  4NQ4 A;  2FU7 A;  2I7V A;  3PY5 A;  3AF5 A;  2XR1 A;  5DPX A;  2BTN A;  3L6N A;  2QJS A;  5AXO A;  1ZNB A;  3DHA A;  2M5D A;  5LE1 A;  5EHT A;  1VJN A;  1KO3 A;  4D02 A;  3IE0 A;  4D1W A;  1A8T A;  2GFK A;  5KIL A;  2BGA A;  5LS3 A;  4D1U A;  4AX1 B;  4XWT A;  4EYL A;  4UWP B;  4NUR A;  3LVZ A;  2Q0J A;  5KIK A;  3SPU A;  2WYL A;  3DHB A;  5HIP A;  4J5F A;  3IE2 A;  1A7T A;  3IDZ A;  3H3E A;  4RL2 A;  3RKJ A;  2QIN A;  5AHR A;  5FQA A;  3IEK A;  2ZNB A;  5AJL A;  4AWY B;  1BC2 A;  1JT1 A;  5IQK A;  3I11 A;  4F6Z A;  2BFL A;  2FHX B;  4YSK A;  2P18 A;  1WW1 A;  2A7M A;  4C1H A;  2H6A A;  3SBL A;  2GFJ A;  4FEK A;  3WXC A;  4O98 A;  4V0H A;  2I7X A;  5EH9 A;  1DD6 A;  3DHC A;  4NQ5 A;  3KL7 A;  4Z5Y A;  5HH6 A;  4GYU A;  4FR7 A;  4NQ6 A;  2E7Y A;  4XWW A;  2NZE A;  2YNW A;  4CHL A;  4AD9 A;  2YNU A;  2R2D A;  4P62 A;  2UYX A;  2GMN A;  1X8I A;  1HLK A;  4FSB A;  1Y44 A;  1KR3 A;  2WRS A;  3MD7 A;  2BFK A;  2CG2 A;  3IEM A;  3T9M A;  4U4L A;  4HKY A;  4RAW A;  4PVO A;  4TZ9 A;  4F6H A;  5B1U A;  2YNT A;  5EWA A;  2BG8 A;  2P1E A;  5AHO A;  3BV6 A;  4BP0 A;  4UWS B;  4TYT A;  3KNS A;  2YNT B;  2BG8 B;  2M5C A;  5AIJ A;  2P97 A;  4BZ3 A;  5EVB A;  2WHG A;  2FU9 A;  3AF6 A;  4EXS A;  4UWO B;  5AEB A;  4TZE A;  5AYA A;  1JJT A;  4ZEJ A;  4RAM A;  5EVK A;  4PDX A;  4HL1 A;  1YCG A;  5K0W A;  2ZO4 A;  2YHE A;  4EFZ A;  5ACT A;  4PVT A;  3AJ3 A;  2ZZI A;  2OHH A;  2BG2 A;  2BR6 A;  5AXR A;  4EY2 A;  4UBQ A;  3RPC A;  2FHX A;  4YSB A;  4C1G A;  2YZ3 A;  5LLD A;  5ACP A;  4GYQ A;  2Y87 A;  2CG3 A;  4HL2 A;  2CFZ A;  3IEL A;  2BG7 A;  4RM5 A;  3BK2 A;  2BFZ A;  2Q0I A;  3A4Y A;  2OHI A;  2BFZ B;  4C1D A;  2NYP A;  4Z67 A;  4GCW A;  3I13 A;  4YSL A;  4C09 A;  2VW8 A;  3ZNB A;  2I7T A;  4D1T A;  2Q9U A;  1P9E A;  3I0V A;  4AXH A;  5LCH A;  4EYF A;  5EVD A;  4JO0 A;  4WD6 A;  2DOO A;  5A0V A;  3FCZ A;  2QED A;  5LCA A;  2YCB A;  3ZR9 A;  3T3O A;  4UA4 A;  2Y8A A;  4KEP A;  1MQO A;  4Z60 A;  5K4N A;  4C1C A;  2ZWR A;  2OHJ A;  3ESH A;  1X8H A;  3T3N A;  5LSC A;  5ACW A;  2BMI A;  2P4Z A;  5EV8 A;  3IOG A;  3P2U A;  3ZQ4 A;  5A23 A;  2HB9 A;  1XM8 A;  4RBS A;  2GKL A;  5LM6 A;  3S0Z A;  5FQB A; 
#chains in the Genus database with same CATH homology
 1YCH A;  5FQC A;  4EYB A;  2BC2 A;  2WYM C;  2FU8 A;  5K4M A;  4XUK A;  5HIO A;  2CBN A;  4C1F A;  1VME A;  5HH4 A;  5HIQ A;  1JJE A;  3F9O A;  4C1E A;  3VPE A;  4AX0 B;  3SW3 A;  3IE1 A;  2WYM A;  4J5H A;  3PG4 A;  1QH3 A;  1WUP A;  4DIK A;  3SRX A;  1WUO A;  3BK1 A;  3BC2 A;  5LCF A;  2GCU A;  2FM6 A;  4ZNB A;  3ZWF A;  5A0T A;  2NZF A;  3RKK A;  3X2X A;  1WRA A;  2FU6 A;  3VQZ A;  3JXP A;  1SML A;  1K07 A;  5LMC A;  3I14 A;  5ACV A;  4KEQ A;  1X8G A;  3IOF A;  3SD9 A;  4H0D A;  4LE6 A;  1DDK A;  4TYF A;  1KO2 A;  5ACQ A;  4Z5Z A;  3PY6 A;  4Z6X A;  5ACU A;  3R2U A;  3DH8 A;  5A5Z A;  5EW0 A;  1E5D A;  2QDT A;  2Y8B A;  4TZF A;  3FAI A;  5ACR A;  3X30 A;  1DXK A;  2YNV A;  3I15 A;  2Q42 A;  5A87 A;  2BG6 A;  4D1V A;  5HIS A;  1BMC A;  2DKF A;  1M2X A;  2YNV B;  3X2Y A;  5EV6 A;  2FK6 A;  5B3R A;  3ADR A;  5ACX A;  4UWR B;  3G1P A;  2AZ4 A;  4RL0 A;  1QH5 A;  4AWZ A;  1L9Y A;  2BIB A;  1ZTC A;  4ZO2 A;  1BVT A;  4Z7R A;  4EXY A;  4TZB A;  2NXA A;  1ZKP A;  1VGN A;  2AIO A;  4B87 A;  3TP9 A;  3X2Z A;  5ACS A;  2QDS A;  2XF4 A;  3SFP A;  3KNR A;  1XTO A;  4NQ2 A;  3QH8 A;  4DIL A;  5HH5 A;  4ZO3 A;  1YCF A;  3Q6V A;  5B15 A;  4UAM A;  5K4K A;  4NQ4 A;  2FU7 A;  2I7V A;  3PY5 A;  3AF5 A;  2XR1 A;  5DPX A;  2BTN A;  3L6N A;  2QJS A;  5AXO A;  1ZNB A;  3DHA A;  2M5D A;  5LE1 A;  5EHT A;  1VJN A;  1KO3 A;  4D02 A;  3IE0 A;  4D1W A;  1A8T A;  2GFK A;  5KIL A;  2BGA A;  5LS3 A;  4D1U A;  4AX1 B;  4XWT A;  4EYL A;  4UWP B;  3LVZ A;  2Q0J A;  5KIK A;  3SPU A;  2WYL A;  3DHB A;  5HIP A;  4J5F A;  3IE2 A;  1A7T A;  3IDZ A;  3H3E A;  4RL2 A;  3RKJ A;  2QIN A;  5AHR A;  5FQA A;  3IEK A;  2ZNB A;  4AWY B;  1BC2 A;  1JT1 A;  5IQK A;  3I11 A;  4F6Z A;  2BFL A;  2FHX B;  4YSK A;  2P18 A;  1WW1 A;  2A7M A;  4C1H A;  2H6A A;  3SBL A;  2GFJ A;  4FEK A;  3WXC A;  4O98 A;  4V0H A;  2I7X A;  5EH9 A;  1DD6 A;  3DHC A;  4NQ5 A;  3KL7 A;  4Z5Y A;  5HH6 A;  4GYU A;  4FR7 A;  4NQ6 A;  2E7Y A;  4XWW A;  2NZE A;  2YNW A;  4CHL A;  4AD9 A;  2YNU A;  2R2D A;  4P62 A;  2UYX A;  2GMN A;  1X8I A;  1HLK A;  4FSB A;  1Y44 A;  1KR3 A;  2WRS A;  3MD7 A;  2BFK A;  3IEM A;  3T9M A;  4U4L A;  4HKY A;  4RAW A;  4PVO A;  4TZ9 A;  4F6H A;  5B1U A;  2YNT A;  5EWA A;  2BG8 A;  2P1E A;  5AHO A;  3BV6 A;  4BP0 A;  4UWS B;  4TYT A;  3KNS A;  2YNT B;  2BG8 B;  2M5C A;  2P97 A;  4BZ3 A;  5EVB A;  2WHG A;  2FU9 A;  3AF6 A;  4EXS A;  4UWO B;  5AEB A;  4TZE A;  5AYA A;  1JJT A;  4ZEJ A;  4RAM A;  5EVK A;  4HL1 A;  1YCG A;  5K0W A;  2ZO4 A;  4EFZ A;  5ACT A;  4PVT A;  3AJ3 A;  2ZZI A;  2OHH A;  2BG2 A;  2BR6 A;  5AXR A;  4EY2 A;  4UBQ A;  3RPC A;  2FHX A;  4YSB A;  4C1G A;  2YZ3 A;  5LLD A;  5ACP A;  4GYQ A;  2Y87 A;  4HL2 A;  3IEL A;  2BG7 A;  4RM5 A;  3BK2 A;  2BFZ A;  2Q0I A;  3A4Y A;  2OHI A;  2BFZ B;  4C1D A;  2NYP A;  4Z67 A;  4GCW A;  3I13 A;  4YSL A;  4C09 A;  2VW8 A;  3ZNB A;  2I7T A;  4D1T A;  2Q9U A;  1P9E A;  3I0V A;  5LCH A;  4EYF A;  5EVD A;  4JO0 A;  4WD6 A;  2DOO A;  5A0V A;  3FCZ A;  2QED A;  5LCA A;  2YCB A;  3ZR9 A;  3T3O A;  4UA4 A;  2Y8A A;  4KEP A;  1MQO A;  4Z60 A;  5K4N A;  4C1C A;  2ZWR A;  2OHJ A;  3ESH A;  1X8H A;  3T3N A;  5LSC A;  5ACW A;  2BMI A;  2P4Z A;  5EV8 A;  3IOG A;  3P2U A;  3ZQ4 A;  2HB9 A;  1XM8 A;  4RBS A;  2GKL A;  5LM6 A;  3S0Z A;  5FQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...