5EIIA

Structural determination of an protein complex of a fab with increased solubility
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
220
Chain Sequence
b'VQLVESGGGLVQPGGSLRLSCAASGFNISYSSIHWVRQAPGKGLEWVASISSYYGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRGQASWDYWWAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
molecule tags Immune system
source organism Homo sapiens
publication title Structural determination of an protein complex of a Fab with increased solubility
rcsb
total genus 47
structure length 220
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiiA01
2R1XA 4WHDA 3O3EA 1DBKL 1IGMH 2D7MA 3K2UH 1CICC 1T2JA 4HLJA 3RY6A 2EDXA 3RWHA 3LPFA 3MLVL 2EDLA 3MV9E 1E6OL 5C0AA 2VL5B 4HXAH 4F57H 1YJDL 3NCEB 4X9GA 3CVHA 3BN9D 2RR3A 2WNGA 3TO2A 2F5BL 1I75A 1A6ZB 4ODTL 5T3XH 4YWGH 4FZEH 1EJOL 1FJ1B 2P4AB 3C60D 4N1CA 4N8VG 1XEDA 4B7IA 5C9JB 4YHZH 3N85L 4XNMB 4U1HB 2R9HD 1I4FB 1E4XL 2AK4B 3CVHB 3ARGA 3TYGL 3KPRA 5GRVL 5DMGD 3RA7H 1VACB 4LLDB 5EA0H 3RUGA 5L0QC 4ZAKC 1M7IB 3DIFB 3ISWA 1MNUH 4YHPB 1OCWH 4XNZB 3FQNB 4EI5B 3E6HA 5DHXB 4JZJA 1ZT4A 4GXUM 3OKDA 4YXKL 4F2MA 2XZZA 1N7ML 3I02A 4O2CA 3LMJL 4KTEH 4UTAL 1CZ8L 3EO1B 1VPOH 5JW5B 1FNEB 1JK8B 5LGHL 5BV7B 4L5FL 3FRPA 5IFAL 4UV7H 2O61A 1UACH 1EO7A 2V9RA 3B2UD 3QUYC 4FQ2L 4LCUB 4TPRL 1UKQA 4XWOD 1M4KA 2Q3ZA 1EJOH 3LY6A 1IAOB 2OTWA 4APQA 5D96C 1QYGL 5IROA 1ES0B 2C5DC 1I9IL 4XHJC 1VHPA 2GY5A 3TPUA 2WBJB 4MS8C 3SHSA 2VLJA 3LS4H 4K3HA 4HKXB 1KOAA 1WBXA 1CD1A 2NX5B 4KK6C 2B0SL 4YR6B 4LRNH 2VO5A 1T2XA 4BZYA 3GSUA 3MROB 3Q5TA 1CLOL 4LPUA 1F11B 4ZAKD 2VLRE 5E00B 3SKNA 3SKJH 4MCZA 1BAFH 1KIPA 1CWVA 1EGJA 5H37H 2IAND 4IIQA 1E4KC 4EI6A 5CFHA 3QEQA 2VZSA 4YHMH 5EIIB 1YMHB 2P44B 4TUKH 2MKWA 5E9DB 1J1XL 3K8KA 2X41A 5KVMC 4JREC 5C6TH 4Q9RL 2A83A 1W0VB 3B9DA 5FKAB 3TN0A 1FNAA 1I8KB 1EEZB 5C09B 5IMLB 1JN6B 1J0KA 4ERSL 1TVBA 5DRXA 3MGTB 1EBPA 1YPZF 2EDQA 1MUJA 2ZKHH 1JHKL 5BS0A 2BNQE 3IDMA 1S7UB 1AO7E 4PRIE 5CIPA 3K2UL 1F00I 1NCCL 2AXFA 2LTQB 4UI2A 4KKLC 1UWXH 3OAZK 4W4OC 3PWLB 4J3XA 1CQKA 4EBQL 2DBJA 4Q7DA 4JHWL 1AXTL 3V2AR 1RIUH 5ITBL 1V7ML 4E5XA 2ZSVA 3BD4A 4OV5B 1TZIA 2YPVL 4UB0L 3FB7B 4MB3A 2BJMH 3O9WB 5SX5H 2A9NH 2EE6A 2IADB 1JTOA 4OUOA 3KLDA 4LKXB 3TFKC 1DN0A 5L9DL 5I19L 1NCAH 5D1XB 3MCLL 3QEUB 1QFWL 1QSEE 3GSNH 3P9LB 4LNVA 3SGJA 32C2A 5D7JC 1NBZB 1SM3H 2CRYA 4D94A 4KVCH 5CSZB 2BHYA 5JPMA 3VWJC 1RZ7L 2EE3A 4NP4L 1VA9A 4W6WB 5A2LH 4XBEL 2ITCB 3TIDB 3VXSD 1LWRA 4KZDL 3E6FA 2BNRB 3W0WD 5ISZA 2VZ1A 1X5LA 5GGQL 2VITB 3FQWA 2PW1B 3EZJB 2XFXB 4Y2OA 3SDDD 2VQUA 4F9PA 2YUVA 2BXZA 4MAUL 4KVCL 4JZOA 4U1MA 3VXPB 1TXKA 1KV3A 4PG2C 5GZOC 4M7ZC 3P77A 5C70A 2F8XC 4PB9L 2ZUSA 3E6FB 1V3LA 2DWDA 4GQ9L 3OPZH 2PXYC 2H9GB 4ZOBA 2FB4L 2H8PA 5FUOH 5JOPE 3F7QA 3QJHB 4O51A 5DEGA 3WEXB 5FEBA 3D69B 4WTXA 2BC4A 5B3JE 3NA9L 4LCWB 2NY6D 4S0TD 5EB9A 3NBNA 4JY4A 4J23A 1RUKL 3R1GL 3ROLB 1FZJA 3QWOA 3DLQR 2EEDA 4JFZL 3CLFL 3VW3H 4P57B 4ODBD 3LD8C 4K7PY 2HJKB 4WWID 1UA6H 5HHXL 2XWTB 1D9KC 3U4BH 5GJTH 5BRZD 1XR8B 3RU8H 4DN3H 1GGUA 1WFOA 5JO5A 2VXUH 4JFOA 2IGFH 2JJSA 1NGXB 3VXQA 3HNSH 1AGFB 1AHWA 3CLFH 3IDIB 3ZZ1A 1QRNB 3NCMA 3QFJD 4JJ5B 1M71A 5DD0H 2G60L 4OFDA 1HSAB 1KCSL 3BPCB 3MBXH 4PJ9B 2V7NA 4V1DB 2G5RA 1BLNB 3CSYA 4U3XA 5A2KH 2EYSA 4G7VH 4YHKH 4U7MA 5CKGA 3DUSA 3IS1X 4XNYL 1QQDB 3V6ZB 1EUUA 2W9DL 5GPRA 1OSZB 4NZJA 3SKUD 1FNFA 1NLBH 4HJJL 2XA3A 1M6OA 1U92A 3QDHA 1SYVA 2XY1A 4HGWB 4X6DF 3C2AL 4XP9H 4NWUL 4LGPB 4I77L 3MOQA 5GRUL 4GBXD 5TPWH 3I50H 5C0EB 3STZA 1TQCB 4PS4H 5ADPL 4PRAB 3B2VL 3QZWB 5EN2B 5E6IC 1JV5A 4Y2DC 2AJZB 2A38A 4NQED 4Z7NF 1NKOA 4UIMA 2NYYC 4CVZA 1NMCB 4YDJA 3V7AE 1KBGL 4N8VB 5GGVY 1SY6H 2FR4A 3MCKA 2Z92B 4RA0C 3RVTD 3RY6C 1BOYA 1KFAL 5C86A 2YPLD 2GSIB 4Z7OE 1CFVH 2J5LB 4GS7B 3U1SH 2NY1C 4HZLB 3U0WL 4RWYL 1GL4B 3U30B 1MF2L 3L3HA 4WWKB 2JJTA 2GJZA 1MFBL 3T8XA 1JI2A 4M4PA 4JPWL 5L2JA 3D2UA 3PXJA 3JWDH 4YX2L 2C4XA 3X14A 4YIQB 4NUJA 5FECA 1UWEL 5IQ7L 1ZKAA 3N06B 4HC1L 1PKQE 2IANB 4LK4A 5C7XH 1KTLA 3T2NL 4I18C 1YN6A 3MRGA 4BKLA 1BZ7B 3QIUB 3IKCA 4P5TD 2FEDC 2BNRD 4TUJA 3NCFB 4NQXB 4JVUA 4Z7OF 4F7PB 1IGTA 1UCBL 5ESAB 3PHOA 2V5MA 4K8RH 3J7HA 5C8JA 1L9MA 3O6LH 5IMMA 5I9QC 1S7UA 2CJUL 4IRSD 5BS0B 1RZKC 4IMLB 4YC2B 3S35L 5SWQA 2YD8A 4QHUA 5CSBA 2V7HB 1FCGA 4JO1L 4RZCB 3CH8A 5T3XL 2NW2A 3ZYZA 3GSQB 4Y89A 1KT2B 2A6JB 3DETC 3UMTA 3O41A 1T1WA 2DQGH 2NY2B 1P7KA 4IRSC 4MAYB 4DKEH 3SKNB 3DV6B 1KJ2B 1CGTA 1KB9K 3S37X 1QSFB 4X8XA 1F3JB 1X4YA 3DO7B 5GRZA 1QLRB 2FIRT 1RFDH 3KLHC 4JFPB 3KJ4B 5IB5B 5DUML 1A3RL 3SJVE 5F1SA 1YN7A 3JV5A 2OMBA 3LN5B 2W9EH 1WEJH 1LP9B 1SJHA 3C9NB 3WO4B 1Y0LB 4L3EA 5KSVB 3D39B 3EYUL 2HN7A 1FV1A 4OF5A 1HNGA 2EDJA 5ILTL 3MV7A 2YSSA 2EH8L 4NRXB 4ODHL 4KC3B 4P2YA 2DQHL 1ORSA 1UADC 2VERN 4HMCA 3RWGA 4HLZG 4H20H 5J6HA 5C08D 3TZVB 4D0CA 1E4WL 4YK4C 2AJSL 3WUWB 3GMNA 2FGWL 1KPUA 2YPLA 5E99H 4N0FB 1KJVB 4CVUA 1NAML 4LSPH 2P7TB 3SQBA 4HJ0C 5IWLA 4LFHG 4QKXB 3EFDH 1QSVA 1IBGH 1MRDL 3REVB 5D7JD 3F12A 1MCPH 2BJML 1LO0H 5EU3A 4B50A 2VOTA 1CT8A 3SGDI 4LSDA 2PYEE 1X5ZA 2FZ3A 4WTWA 1U8IB 3V5HB 3VD7A 1M05A 5JDSB 3MBEB 2VAAB 5IKCB 1YEKL 4XP9L 3TNMA 4CN1A 4WU7B 4FQCH 5EU3B 1FN4B 4JHZA 3DBXA 4PJXA 4HH9B 4MNGE 3O2DL 1H3PH 3H9SD 1ZEAH 3KHOA 4NRZB 1DCLA 4L8CA 5LVEA 4OD2A 2W1NA 5D8JL 1HILA 4S2SA 1DBBH 2ADIB 3IYLW 3BO8B 3ZDZE 4JN1L 4CJ0A 4K3DL 1U8KA 4HXAL 4MA7H 2Z35B 3NFPA 2K7QA 4PJGE 1O7SA 1H3PL 1JPTH 3GKZA 5IEKA 4BKLB 5DDHA 5I1KH 4NKMB 3V7MA 3IFLL 5CEXA 4HWEL 3ARFD 2IANA 4CMMA 3ZT6A 3SDCA 1AFVH 3RTQA 2A74A 1R5WB 1KXQE 4AK1A 2A6IA 4OBSA 1MOEA 4RAUA 1RUKH 4JKLA 4W4OA 4PTUA 2WBWB 1AXTH 5C0BD 4NHCH 1QA9B 5LQBL 2R4SH 4PRHE 4FTVD 3X3FL 1QR1B 3KXFA 3MLRL 2YN5A 2WLYA 5I73C 4RIRA 4W81A 5BZDA 1UB6A 1EH9A 4UUJA 3V0VB 1YZZA 2PXYD 4TRPL 1U8JA 4UU9A 4X80L 2FR4B 1CDIA 4MXVE 1ZHKA 4MAYA 3UYOD 1DANT 5ID1B 3HLAA 1YPZE 5K33A 4I8DA 1IAIH 1HXMB 4MD5B 1LNUB 4O9HL 4U49A 3GSOA 3S96B 1RMFL 2VB5A 2EC9T 3VXMB 1FBIL 4L8SC 4UV4H 4U6XA 3TO4D 5DO2C 5JMOC 3BPLC 2GAZB 1TIUA 1C16B 1KCLA 5FA3B 4NUGL 2YMXH 3U30C 1OT2A 1UXSB 4A2LA 4TOYL 2Q7NA 4P2OC 5FUZL 3OAZH 5J1TC 4P3WA 4Z8FH 2WANA 5D7LB 3C2AH 3FQRB 3L6FB 3ZL4H 2R0KH 1JF1A 1DR9A 5MHSE 3G6JE 4PB0L 3GMRB 2VDKL 2BOCB 1WTGT 5H94B 3ZO0A 1WJ3A 3HPJB 3PWNB 4PJFA 4YGVA 3GSXA 4PRPD 3UTTB 3O6KL 4GMSL 2P8LA 1SJEB 5E8EA 4P3DA 1YMMA 1WWWX 4MVBD 4OGYL 3WIFB 4XT1C 3FFCB 2P5WB 1S5HA 3EFDL 2AV7A 4NM8H 1UB5B 5D5MB 3FN9A 1X6NA 1NGYA 2LABA 3RHWK 2XIDA 5E8PA 1FDLL 1XIWA 4NZTL 2FHBA 4TPRH 4WW1A 2AI0L 1I3VA 2GCYB 3VXUA 5MEOB 1P6AB 1AP2A 4GSDL 4P57A 1LP9E 3QI9B 4XRCB 4U1GC 1QFUH 2R0ZL 3T0VA 2X89D 4U1IA 3FQXA 4AZ8A 3DUHA 2W0KA 4AL8H 4WUUE 4N8VA 1RJLB 4TUOB 1Z9OA 1OY3B 4PJIA 3H8NA 1F58H 1VFAB 3LKRB 4I1NB 5F72S 2BSRA 4JFEA 1JV5B 2AXJA 3PL6B 4C4KO 2I60L 4L9LB 4Y4FB 4JPKL 2BNQB 3QEGH 4OI7A 4WI5A 5ANMA 5DD1H 3CH1B 2DDQH 3DGGA 1XGPA 4CW1B 5DTFB 2X9XA 3FCTA 1IRAY 1KXTB 1N59A 5D1ZC 4Y8AA 2X4RA 2ICEB 3HMXH 3GKWH 4GW1B 3VU2A 5HPMA 3O2VL 2LV4A 4KI5F 3KS0H 2QV2A 4X99B 3V8OA 4XNQB 4S1RL 3TBVA 4FMFA 1MF2H 3L7FB 3HMXA 1BREA 2CJUH 5TQ0L 3GBML 2EYSB 1RAMA 1R24B 4RCAA 3KPLA 3SBWC 1HOCB 5D1QA 1Q1JL 2D03H 3FFCA 3KXFE 1CGUA 3HZMB 4X9HA 3L7FA 2XKSA 2VC2H 5F89B 4GKSA 1NH6A 3SDCC 2VZTA 2BOBB 5TDOA 4GG6E 3QEHA 3SOBH 3R8BB 1Q72H 3EUUA 2VLLB 1WGOA 2IJ0C 2YD9A 3Q48A 4X7CC 4XTRD 2NXZC 1EHAA 1GGCH 4FXKA 4F15C 3GRWL 2AJ3B 1G7JA 3MRHA 4KY1H 3VFGH 1DLHB 1SBSL 1U9KA 1FO0L 4Y1AE 1IT9L 5D71H 5JOEA 2W0LA 3VDAA 4KDWA 3SE8H 3T09A 3I75B 3TNNA 6FABH 4Y4KD 5F3BB 4Q2ZB 2YS4A 4I48A 3WN5B 1VGKA 1EFQA 4BH8B 1VGEL 3BGAA 5EZOL 5KSAC 3O0RH 4BFIB 5LGJB 3DVIA 2BHUA 2KQNA 3T04D 5IFJB 4KI5D 3GMOB 3KYNA 3VWJD 1DSFH 1E27A 4OLZL 1QLEL 1NEUA 3QXDB 4NO2A 1UB6B 4OLXH 3QIUD 3QHFL 1KJVA 3WLWC 3PDOA 4NPYB 3SDXB 1WISA 2FEEL 2IFGA 1BVLB 3MRMB 1B3JA 3GSXB 4XP5L 1G9EA 1C5DA 2LU7A 1IFHH 3QG6B 4IHOA 1NGWA 5C9KA 3I50L 2P5WA 1CLYH 3PGCB 5KN5B 4R0LA 1DP0A 1NCDH 2GJ6A 2L7JA 4UINL 3UTQA 1D5XB 1KYOK 1I9EA 1K4CA 1BQSA 4OZHA 3SKJL 3PE9A 4G6KH 1LK3H 4WO4A 1MCNA 3BAEH 3BYTA 3EDJA 3AS3A 1CG9B 3PABB 2R9HC 1HI6B 5I1HH 4APQC 3TBTA 1NUNB 1PZ5B 4FFYH 1AIFB 4S1QH 3BVNA 3X11B 3ET9F 1AJ7L 4K94L 4LSTH 5MENB 5I74C 4F58H 3O2WL 1O7VA 4OLZH 4X9FA 1JBJA 4OM0L 3SEPA 4I5BA 1FN4A 4U6VL 4AMKH 3JV4A 4P59L 2YK1H 5E56A 3QXTA 1HQRA 4QRTA 4P9HL 2CLVA 4XP4H 4G42B 1OARH 5ID1A 5GRVK 3S97C 1IC4H 1V8HA 3O8XD 1QNZL 1OWWA 3BXNA 3K4ZA 5KSBF 1OT1A 4PJ7E 5TFSH 1GXEA 2NZ9C 3R0MA 5IR1A 4KROB 2P5EB 4DVRH 5ESAA 3DX6B 4JQXA 5EIQA 1P1ZB 3CVHL 3BSZL 4HLZH 2UWEE 2R0WL 1FAKT 4HC1A 1U3YA 1IBGL 3HCVA 1AD0A 5HPOA 2WM0A 5FOBB 5GS0H 3T1FB 3GSWB 3MLTB 1M7XA 4KJQD 5LCVL 3MOBH 3OAYK 3RWJA 3MV7B 1CF8L 1KPUB 2YPLB 2HFFA 5DZOA 4QTHB 3SDAD 4WI7A 4YDLC 4EIGB 4NGHL 3FO1B 1J8HD 1VEPA 5IBUG 4KHTL 1LO5A 4N5EC 4GLRH 4JFFA 1MQKL 5L2KE 2EYRA 2OL3H 1TJHL 5CZVL 4BM7A 3W0WA 1RUML 4PG9B 3L3JB 3RVTC 3V0WL 2X4QB 1X4ZA 4WFFE 3QI9D 1XH3B 1F6FB 1WTLA 4QHKJ 5SWSA 5C92A 5IMOB 1U3HB 3S9DB 4XMKH 1J1PH 1FL6B 3P9MB 43CAB 5K9QI 2CGRL 4YHOL 1PG7X 3PL6C 2LTQC 5E6ID 5F1NB 5EORH 5KSUB 2Z8WC 1MH5B 5BS0E 2Y9RT 3GI9L 2X1OA 3GIVB 4PD4K 3WXWL 4F9LC 4U1JA 2CLRB 3U46A 1PAMA 1HKFA 4ZXBA 3OJ2C 3V5DB 3D25B 4BSWB 3LV3B 5JHLL 5DD5H 4NM4H 3REWB 2VIRB 3O4LE 4OQTH 2FSEB 3FN0L 5C0GA 2X4SA 5DJXB 4QRUA 2HH0H 2X10A 1Z5LB 4TULL 1E4JA 1A6VL 2J3SA 5CILL 4WO4D 1T21B 5B39G 3O6LL 5I76B 3T1FA 5J1AB 2X4TB 4EXPX 2Y4SA 1KTLB 2BOBA 1WV7T 1IGCL 1T66D 1GRWA 5CGMA 2E27H 5C2BH 1ITBB 3G6JA 2DMKA 3IVKB 4TULH 4OLXL 5AUMA 1D7FA 3MLTA 2XZCL 4OKVB 1Y18B 4HKJA 4NN6C 3V52H 5HYIA 4X8JA 4LEOB 2DM7A 3QFJA 3U79A 1T89C 1J8KA 3VWKA 3LZFH 5ABDE 2ERJB 1JGEB 1A7PL 4QRPA 2HA1A 4PGJA 35C8L 4M6NH 1DVFD 1J0YA 2IPKB 3HE7A 3QDJA 3UTZB 1L7IH 3IJSA 3SDXE 4YXHH 1X5FA 2NY5L 5HI3D 3FMGH 4FQ1H 1JI1A 3MYJA 4Z7UB 2A6JA 5FCUL 1JTPA 4FQXC 4RRPA 5E4IA 5AYUH 4ELKA 4ZO6A 5HTSA 2ARWA 3HS0A 4X7EC 5FXCH 5D7LD 3G08B 4JM2D 1ZS8B 2DBLL 3RWEA 1MI5D 2NXYC 4RMSA 3OAYH 3KYKL 8FABA 2ESVA 4N8CH 5IESL 5DSCA 3EKCA 1JNHA 2VR4A 1KLFA 5KVEL 1AIFA 1I1RA 3UTTD 1H3VA 4LAQL 4YHYC 3BH8B 1FE8H 4WU5B 3FFCD 4O2EB 3QDMB 3QUZC 5J6GB 1M6OB 4X9BA 1PD6A 5SX5K 5DA4A 3VXOA 3GSRB 3TZVC 5TQ0H 3LZFL 3HAEB 1L0XA 2NX5D 4BH7A 2IALB 5E8EB 4RFNB 5E8DL 4PJGB 5I1LB 2O26U 3WS3B 1EVTC 3CPLB 2IAMC 4JREB 1NMAL 1KIQA 4Q9CA 3LPWA 4F9LA 4ZOEA 4LCWE 5FDWA 2VLKA 4Y2DB 2CLZA 5J9PA 5CD5D 4JB9L 4LLVB 4APQD 3ROLA 4GUPA 3PL6A 1HXYA 4IRZH 1S9XB 3QHFH 1ZGLM 1LGVA 2E6JA 2ICES 3VFPA 4KV5E 1GGYA 2NY6C 3UEZA 4CADA 2E8ZA 5KVEH 4LLYB 3MV7E 4PJBF 4GRLC 1LVEA 3T0EC 2Q8AH 1KEGL 4CRPA 1FYTD 5ECJE 2ZUQC 1ZHNA 4YZFE 3EYVB 4P2RE 5C0JA 4K8RL 2P8PB 4FTVE 1QEWA 2GK0B 3LOWA 3W9DB 3FRPG 4EI5D 1T1ZB 1CLCA 3OKMB 3KNBB 5D2LB 2J6EA 2R4RL 5FKAA 4Q9QH 1NL0L 1A1MA 2P49B 3JBG7 3WIFA 1N5AB 1CXKA 3MRBA 2WWMC 4G7YH 4ZUSB 3S6CA 4PGDA 1YN6B 1U0QA 5KS9B 5KANI 2AABL 2O5YL 1OM3H 3BMWA 4W4NA 4JM4L 4P5MA 3ARBB 1R24A 4QXTA 4G9FA 4K9EH 4PP2B 1AQDB 3B5GA 1AHWB 2QL1A 4UOJA 1C5DB 3B83A 3ROOB 4Z95H 4LFHD 4NP4H 5GXBB 5HYJA 4L5FH 1NFIA 3A6CH 3OGCA 4YR6A 4R90H 4HAFA 4CU8A 5JOFB 4G6JH 4A6YL 1W0YT 2XTLA 3ZDZF 4ALAH 5HGBA 2HWZL 4JRWA 2HAZA 2AEWA 4L8SB 1XR9B 1H3TA 4OZGF 2IBBA 3ARZA 4P99A 1FFRA 4CAGA 2XZAL 5GRUH 4GRLB 1N6UA 3KPMB 4FG6C 1IGFL 2Q76B 1A9EA 4AEFA 4BFIA 1ZHKB 1P4IL 2NY2C 4HS3A 1A6TA 5MERB 1FZJB 5B8CB 2R4RH 5JW5A 2HMID 4HIIB 2Z93A 3WN5A 1J1OL 4WU7A 5EU6E 3GJFB 5B22A 3GJEA 4FQJL 4Z7UA 3KWWA 2UWEB 4F7TB 3VFVB 1T4KB 2NY0D 2FJGB 5GGRA 3DECA 4OFVA 4EDWH 3MRQB 3P73B 3RZCD 4NKOB 2A0LC 5EU5B 2VZVA 5EG6C 5IHUH 5ISZB 3BDYH 1UZ8B 4K3DH 4IS6B 1PGRB 2BVQB 3S35H 4F7EA 3BIAX 3ORJA 1BLNA 5TDOB 4HCRH 4YBLB 4FFYL 4YQXH 3UBXI 2XQYK 4Z7VB 5GGVL 3BJ91 3NPSC 5GGUA 4LQ1A 4RWHA 4BQ9A 4P2QB 1UM5H 3MRFA 1JUFA 3ZKQD 1KN2H 1UJ3C 4J1UA 2C3WA 4JDZA 5CP7A 3MLWL 3VFOB 1I3RA 1UCBH 2OQJB 4G8GD 5BCAA 3MNZB 2FYYA 3X12A 4MMZC 1LQSR 1JMXA 3C9NA 3OJDA 2WINA 1HHKB 5IVXE 3VXUE 1XF1A 3MBEC 3GJFK 3RGVD 1M05B 1T20B 3GMLB 4LP5A 3SY0B 2PF6A 1FYHB 4ZD3L 4S0SD 4I4WA 3F7YA 1N8ZB 3BIBX 3DJ9A 1ZGLA 1P5UA 2ZNXA 2EO9A 3QQ3B 4ZPVB 2QKIB 1K4DA 5DVOA 4H1LA 3L7EB 3QUYB 1HYSD 3D0VA 1U8MA 3ZSSA 3BKJL 3AROA 1PQZB 2XPGB 2F74A 4U1MB 3VXPA 4GW5A 3PWUA 3TBWB 1MFAH 1S7RA 2HT4C 2OJZL 2A83B 2X5PA 4R7NA 3VD3A 5DJYB 5FYKH 4H1LH 2FRGP 3CSBA 3QUYA 2EIEA 1XF4B 1ZT4B 4K23L 3MV01 1U8OA 4AM0A 4G7YL 2CXKA 5D2NC 1AKJB 2OK0L 2CDGB 5INDB 3T0DA 3P9LA 2ENYA 4P3DB 5D70H 4XAKD 1ROWA 2HFFB 2D7TH 3OKOA 3PQYA 4JM2C 3VGEA 4OI9A 3GSVB 4D9QD 4XC3L 1FVEA 2J1KA 3I9GL 4NNYB 4JANA 5DGQA 5DEZA 3OXRB 2IG2H 3BP4B 4IRJC 3RWFA 4ETQB 2ARJB 2OQJA 5L2KD 3TA3C 5JHDD 3P0YL 3E8UH 5IGXH 3B6SB 4MCYB 2XZQH 4WW2C 2E6PA 3HHRB 4QXWA 3O3EB 4Y1AA 4OFPA 5HYSB 4QCIB 5JXAL 4DGVH 2K9UA 1R6VA 3L3IB 2NXZB 4KK8C 4UDTB 4PYGA 1N3NA 1HXMA 3HUJA 5C0IA 4PJ9C 4IS6A 4LSTL 1KJ3H 3TF7C 2X70A 1T2QH 5DS8B 4X6CA 2VH5L 2X6MA 5T3ZH 3RZCC 1FZOA 5EO9B 5D2NB 4BZ2H 1AI1H 3CXHJ 4O2FB 4LPXA 3LV3A 5ISZD 4JR9L 2Q20A 4KQ3L 3F58H 3HNVH 4PBWD 5KVDL 2GITA 4M1CD 4F7TA 4OCRH 1IGTB 1KPRA 4U1SB 3D0VB 1EZVX 3UAJC 3RUGB 4I0PD 5J12C 4LL9A 3OV6A 5AD0A 1MCPL 1EZVY 1G7PB 2A74B 4FQJH 4TNVK 1P84K 4HMEA 2WP3O 5GZND 4NOBA 1CDJA 3TZVA 4JKKA 2EDRA 3BQUA 5D7JB 4JFHD 3B9KA 2BVOB 4ACPA 4HH8A 2Y36L 5E08H 4ZNEA 1DQMH 2AVGA 3R8QA 3WXVL 1ZWIB 5IEKB 1XH3A 1B0RA 3EYQC 4NC1E 3NGBC 4NQCB 5BMFH 4H25B 2Z31A 3MNZA 5JOFA 1TTUA 3SO3C 3WIIH 2ZJSH 3AU1A 1RK0B 5F9AC 2GTWA 4M62H 5E08L 4M4RA 5DMJB 1I1AD 2J7LA 3EYQD 3MCKB 3VI3E 1YNTA 5D6DA 1FIEA 4XVUD 3OB8A 3QQ9D 5F9WC 5DFWH 5A2IH 4HHAA 2R0KL 3KYAA 5IFJA 3NA9H 3CVIL 3D9AH 3OHXA 1S78C 3RVUD 4PGDB 5IQ7H 1RIUL 4JEGB 2D31A 3L1OH 4XPAL 4JY4B 4QOKA 3QBTB 4ZYKB 5DRZA 5JXED 4P2RD 5C0CD 1BP3B 2BY1A 2I24N 4MQXC 5D7SL 1CFNA 1U8OB 3S36L 3PGDA 5GGRB 3HZKB 3EYOB 3DX9A 4P4RB 5HYJE 5DHYB 1U3HD 3GRWH 2MCG1 4HULB 3STBA 1CI5A 2YXMA 3WNMA 3IRZA 2X7LB 3KWWB 3M45A 4M7KH 4JY6B 2DI9A 4I3RL 1SBBA 2MHAA 5H2BB 5HHVH 5SWSE 4ZTOL 1LHZA 4LHQB 4S11A 3UZEA 4L8BA 1K4DB 3HZMA 3VXSA 5E2UL 1EFXD 2CQVA 3VG0L 5F88B 3VI3F 1RHHA 2AQ1A 3NH7L 1OSPH 4Y4HD 4D0DB 4HS3B 1F3RB 3T4YA 1A4JB 2ARJA 5DQDH 1I1FA 1CVSC 1M7DB 4ZFOL 3F7RA 3KPOB 4Q58C 4Y0GA 3EBAA 5LXGL 5EBMA 4LGSB 2WWKO 3NH7H 1QRNE 4P4KA 5JW4M 4CU7A 5LWYL 5I73B 1FL5B 4JFPA 3FB7A 1YMMD 1HQ4B 2FDBP 4IOIB 4E41E 2Y6SD 1XT5A 3RIFF 3VXME 5FOJA 1JYVA 5JA9A 1MRFL 2H41A 1N5AA 5E2VL 1T0MB 1NC2B 3FO2A 4Z7VA 4ZS6C 1VFAA 3ARDA 1D5IL 3QDGE 3ARBA 4OZHE 2UV3A 3TBWA 2VLRB 2VDRL 1UZ8A 3VFWA 2DQJH 3L7EA 4RGOH 1Z9SA 4RFOH 4XPHH 5JXEC 3TT1L 5EPMB 3V7AG 3NA4A 3MRQA 2OI9C 4LCIL 3UTPE 2YRLA 1V3MA 4DAGH 2NW3B 3S8WA 5J11B 1ADQH 3WNOA 5HGHB 5FYJU 3IDIA 1SYSA 3C5JB 3SGEI 1S5HB 2YD1A 3RGHA 3SGKA 1A7PH 1HXYB 1TMCB 4NKDA 4TSAH 5IBTH 4TTDD 1CK0H 2XRAH 4Z76B 3HC0A 1IM9D 3OKLB 3F58L 2J5LC 5D9SA 1U41A 1F4WL 3LHPH 4Q6YA 4KKLD 3O45A 1NGQL 1FO0B 2YPVH 3GBLA 4UB0H 3VXNA 2Q7YA 1KN2L 3C6SA 5DJCA 4QLRA 3RL1B 1Q0YL 4LHUA 3KGRA 1RZKH 3KYMB 1BX2B 1OQOA 4YHLL 3L3HB 1LE5B 1X5GA 4HKZA 3VFSA 4EKXA 4F80A 3MRDB 2F58L 4NO5B 4QRSA 2ZOKA 1DQJB 1WZLA 5L0QB 4L3ED 4L29A 3HZYA 2XWJB 1YUHB 1JWSB 1RULH 4D9RD 1S7VB 1ZWIA 3DHMA 5FV2A 2CIIB 1RJYB 1JNLH 3N1GC 1BBJB 3OR7A 5JQ6H 4PGCB 2CKBA 1SQ2N 3VI4E 2XWBA 4MB5A 4JFYB 4NKOA 2X4SB 2X4RB 2APVA 4NJAL 1BF2A 2XACC 2VIRA 5C09A 1SJVA 5IMLA 2DQEL 3NAAH 5L8LB 2ZUTA 4XNUH 1MNUL 1MAMH 4ENEC 1BD2D 1A5FH 15C8H 1S9VB 4HWBH 4Y4HA 2I9LA 3JV6A 5FO9A 2E3VA 3NFNB 5J7CC 3CFDB 4OF0A 1ZVYA 3C08L 2VITA 4J4PC 1R5WA 4QRRA 5LAXB 3VFUB 4ZXBD 4G43B 4L3CA 4WFED 3U2SB 4HMDA 3OB0H 4Z7VF 2R56L 2ITCA 5EH1A 1XGQA 2RIKA 1D5ZA 5GS1A 3ARDD 5SX4H 3BT2H 3MR9B 2HLFD 5FGBA 1VCAA 4UT6H 1A7BA 4IRJA 5C0BE 1UM4L 4PRBB 3CNKA 5ANME 3BKJH 2P5WE 3RU8L 2XT1B 1E4KA 4OF7A 4QRPB 5GS0D 5FDWB 1I3UA 4WHTB 3RHWF 4CBPA 1ED3A 1PEWA 1MHPH 2EDKA 3DI2B 3RVVD 4H0IA 3ARYA 3FMGL 3DSFH 1K85A 5T1LB 4PJXB 1YEKH 3IXTB 5DT1H 4CN6A 3VDBA 5F88A 1Q9OB 1S7XA 4GRMB 5AD0B 1A1OA 4CVXB 1KLUB 4PLJC 5ACZA 5HVFB 1IL1B 4KRNA 2XKUA 1NMCC 5EC1A 2NW3A 1CE6B 2H32A 1UXSA 5J1AA 1JN6A 5FKPB 1CGWA 4OUUA 3O3UN 2AJXH 2LFGA 1JZ4A 1Y6MR 4X6CB 3MLXL 1NCCH 3RBSA 3WO4C 4ZYKA 1IQWH 5CD3B 1PG7H 3MODL 3C60C 4F3FA 3TT1H 3JVGA 4HFWA 1WBYA 3HZKA 1WCQA 2ZJSL 2PW1A 4FXGB 4L4VD 3KPQA 3DYPA 1OOAA 4N0FA 3BKCL 1I9JL 3EOBA 1MI5A 1OAKL 2VXQH 5CZXC 1YNTB 3FT2A 3DSNA 4MJ4A 2A1WL 3X3GH 2MSPA 3MRPB 4Y2DA 1Q0XH 1N8ZA 2DM4A 5B21A 2IPUG 1DFBL 2QQKL 4ORGA 1KC5H 5EU4B 1LD9A 4S1RH 3RY4A 3WS6A 3OXRA 2EDHA 4PRIA 4KJWC 4GG6F 1P6FA 1QRND 1WBXB 1A21A 3H2WA 2Q3AA 5M94B 3BGFB 3JWDL 4KQ3H 5TE4H 3TPUB 4WI6A 5EU4A 2OJEB 1WFUA 3NPSB 1AD9A 2LQRA 4Y4HC 3VFMB 1I7UB 4HWEH 4EUPA 3I6KB 1OLZA 4O00A 1RIHL 1AQKH 2BCKB 4LPYA 4XCEA 3X13A 3F5WB 1DBJL 1AXSB 4AEHL 3M1BA 5KSBA 4MZ2A 2AJYH 1P4LB 5JW4Q 1GOGA 4D3CH 4YHLH 4YQXL 3GSWA 2UVEA 1U58B 4ODTH 1MFEL 1IEAB 1N64H 4PJDE 4P5TC 5SWSD 5A3IC 2R69H 3MO1A 2OI9B 4YHYB 3S36H 4FTVB 4JG1H 5JPNA 5DHYA 3FZUC 4XI5C 4KROC 4EI5A 5CJ5A 2VISB 5IROC 5HYEA 3BP6B 5DVKA 3VGAB 4ZSOB 3BW9A 1M7IA 3E0GA 4YXHL 2ITDA 1R3KB 4J4PA 3BHBA 3I3BA 4JKWA 1NCTA 4GXVH 1FNSH 1DVFC 2HLFC 3OG6B 3REVA 2X4UB 3S3SA 4AIXA 1CXHA 2XZCH 5KW9L 4ZODA 2P48B 4C56D 1IILE 1WBZB 4M48H 5AUMB 3ARPA 1Y6KR 4NJ9H 1CIUA 1I8IB 2BRRL 5J6HB 3LEYL 5HHPA 2ZSWB 4BUHA 2AP2A 2IGFL 4IHOB 1MFAL 4ZTPH 1IM3A 4ZQKB 5I2IB 4S1QL 5C0RH 1D5BA 3SCMA 3QIBB 4KMQA 5DJXA 4N0UB 5TE6H 1UVQB 1YY8B 3QDME 3NFSH 3REWA 5D7KD 8CGTA 4YLQT 2X4OB 4YBQD 3WNPA 5FO9B 4GG6A 2HKFH 2B1AH 4PJHE 3RWIB 2OXHA 4URTB 1S7WB 5DQDL 3O4OB 4HJJH 1T2QL 4I2XE 4OCWL 4DW2L 3QXDA 5MP6H 5IVZA 4YHPA 5BOPA 4HW6A 5F7DB 4UT9L 2GW5A 2QQNH 4R4BB 4HQQL 1CFQB 3LPGA 1WUNT 2J8UB 2DF3A 1MSPA 3TNNB 1HEZB 1YYML 1YEJL 4KTDH 3D3VE 3HI6H 2DICA 4MQ7B 4IOSD 4NBYB 4KUZH 2WP3T 4JFDE 2XWJA 4FQPA 3TESA 3RX7A 3BEVB 5F3BA 5JW3H 1F4AA 5D6CB 1CS6A 2XKNB 3EYSH 3JTSA 4X4XA 2NY1B 3LDBC 4M93C 3QNZA 1ETZA 4NOFA 3MRHB 4OZIF 3VXNB 1CF8H 2CDEA 4GRMA 1Q0YH 5DD3H 1KTDB 5EBWB 2BMKA 5K9QG 1U93B 3PWPB 3GNMH 4HWUA 3LKSA 1MJUH 1ADQL 1KEML 4R7DB 5IW6A 5BO1L 4E0RA 4WFEE 3O6FC 1J12A 4X99A 4KJYA 3IFPB 5IBTL 2GUOB 4NC2B 4EVNA 4WWKA 4MSWA 5D2LF 3BISA 3PV7A 3L3DB 2VZOA 1JTTA 2R69L 3QUXD 2PR4H 1E0OB 1KTKE 4P49A 3TO4C 1FIGH 5ESQB 2DTSA 5BMFL 3MLSL 1INQB 1RUAH 3BGMB 4EI5C 5FYKD 1NFDA 5ESVB 3VWKD 4MMXC 4IRZL 1RJLA 2XICA 5IFAH 5TGBA 1AR1D 2GQHA 2EXYC 1UXWA 2AABH 3GSNA 1MFEH 2FL5A 4XPGL 3U82B 3WFEH 2IQ9H 3F7YB 3LN4A 5DQ9B 5KW9H 1DVFA 3K81A 3W2DL 3ALXA 4I48B 5TE7H 4RIRB 1HI6A 2H3NA 1FP5A 1UJ3B 4HIEA 1JNNH 4MYWB 4XNXL 3QO1B 1FNSL 4GMTH 1NFDB 4TUOA 4GRLA 2XA8L 2ICWB 4AENA 2XTJE 1QA9A 5MEQB 4M43H 4TVPD 1W8OA 4MLSA 2COQA 5GSVB 3TWCH 3O3DB 4X5XB 4FHBD 1RZ8B 5D71L 1FNGB 1RUPL 3TT3L 1BPVA 1R3LB 4NJAH 4IRSB 3O8XA 4RMVA 4EQ2A 4U0QB 2QSTA 3VJ6A 5IHLB 5IW1A 2BMKB 4FP8L 2NY0C 4LRNL 2CK2A 3ARFB 3L3OA 2VWEC 4L4TA 1DQJA 4RNRB 3MA9L 4YEEA 2EDTA 3BKMH 1HNFA 1I9RL 3GO1H 1QYGH 1T5WA 4PJEA 4DFHA 3K0WA 5E1HB 3PQYE 2BVQA 1UQSA 4RGNB 1A6UL 1ND0A 5IFHH 3LEXB 3P4MB 1A22B 1Z5LA 1G6VK 1MIEL 2QQLL 1J05A 2I5YH 4LLUA 1EO5A 1JPFA 4X7TB 3THMH 5KS9E 4X6BA 4WW2B 1Q8MA 3CX2A 3VFTB 3AS1A 3MA7A 5HD8C 2HJFB 3C6LD 4DK6A 4KI5C 4U2YA 2VDKH 1VFOA 1QSZA 3BEWA 3LS5L 2XQBL 4OGAC 3FB6B 3RDTA 1EO8H 3EFFB 4LU5H 1PKOA 4RISL 4PRID 2HFTA 3DSFL 5I1DA 2EDFA 4E41D 3VMOA 4RWYH 3WE6B 5EU6D 1CGXA 4FQXD 4DUXA 1BM3L 1NCBL 2VZUA 5CZVH 1L6ZA 1TDQA 1FL6A 4JFDB 5T33H 3MJ7A 3OB0K 1C7TA 1MCJA 1C08A 5DHVB 1N64L 2X4QA 5DK2A 1CD1B 4OV6F 2YC1B 4JKPL 4OD1H 3L95A 1J0IA 5IVXA 2ZCKH 1O5DT 3VXOB 1R3IL 5DJZA 4FABL 5HY9B 5IW1B 4AG4L 1HINH 5I1GL 4ZQKA 1PG7L 5GGTH 2EDEA 1DJSA 5I1IL 4AEIH 1OLLA 5FGSA 4R7DA 5IW6B 5D7IA 2OJEA 5T3XD 3S36X 1JWUA 1SJEA 4AIZB 5J1SC 3H6JA 1JZ6A 1DBML 2APFA 4WWKC 4K3EL 3K46A 3RNQB 3QT2A 1RZIB 5HGGS 5I1AB 5GRJL 4N68A 3CFKB 4TSAL 5JZ7D 4I3GA 1JL8A 3IAPA 1MJ8L 2NY6B 2UUDK 4MWFB 1KF9B 3L5HA 4LVNB 4GW4B 1TCMA 5CP3A 4NDMB 4KY1L 3EHBC 2QTEA 3N9GH 1F90H 1T0NA 4G8GB 1P7KB 2DKUA 1N0XL 3P9MA 43CAA 4C56A 1TVDA 1J87A 1N3NB 3QI9A 4RZCA 4K8RD 3FFDB 3ZDYF 1PY4A 1K5NA 3LQZA 2P43B 4Y1AB 1NKRA 1CU4H 4HV8B 2IPKA 3HE7B 4R96A 4QY8A 5E95B 3CLEL 3PGFL 4CU6A 2PTTA 2HT3C 2HG5B 4R8WL 25C8H 4WUKH 5IIEB 2QADD 2CIKA 1B90A 3ECBB 2KH2B 1U95B 3O6KH 4GMSH 2X4OA 4GG6B 2B1AL 3T2NH 2VTFA 4MQSB 4Q9RH 1IQDA 4F7MB 5GRYA 1KTDA 1XGUA 2PXYB 1HSBA 2ESVE 3NIGF 1IGJB 3IJYA 4XNXH 1BMGA 4NN7C 1MAML 1KYOJ 4ZUUA 4U1LA 1BOGA 3WNKA 2RFXA 1F6LL 3GSRA 1O0VA 5JIIA 4UNTA 5ADOL 4ETYA 1NGZA 3VRJA 2VSDA 4AM0B 4EOWH 1BBDH 4PJ8C 4KJQC 2O5ZH 4JKMA 4DOHB 3MJ6A 2YBRA 5CGYC 3MRCB 2EYTB 1UACL 2UY6A 3TA3B 2W0FB 3NZHL 3OZ9L 3BT2L 2E7LA 1P7QD 4XVUC 5JTWA 2LAAA 4P3CL 5CBAA 4WFHD 5F96L 2A6DB 4YO0A 4G8GA 3O6FD 4J3SA 1WLHA 3MNWA 2ZZUT 5T1MB 4ODWB 4IBLT 2FLRT 5I8OL 3DVFA 3BRGC 1XF5B 4HPOL 3HUJF 1PZ5A 4CVWA 3RDTB 3CX5K 5IVOA 5CBAB 1JIBA 2FIKA 2BY2A 3KPQB 2DYPD 3SCMC 1G7MB 1FRGL 1NLDL 1KG0A 2NY7H 1VFBB 3HI1A 3G5XA 2LE9A 2IH3B 3FT4B 5DLML 1BJ1J 5EZLA 1HIMH 5I74B 3UROR 2H6PB 2ED7A 5I1KL 3QFJE 2NTFA 5JLZA 1RZIA 3GI8L 3MRRA 3DMMA 5EC2A 5F7LB 4D8PA 1T6VN 1YUHA 3RTQC 3HCVB 1T5WB 4PJEB 4D0CB 3ULUF 5IVXB 3OKNA 2Z35A 2DIAA 4KWUA 2CIKB 2RFXB 5E03A 4ZTOH 5HHVL 2D2OA 4U7SA 4YHNB 1KLUA 4OZ4A 3KLAA 1KJ2L 1U8QB 2PXYA 3HG1E 4YDKL 3VCLA 1CL7I 1R0AL 4LASH 3ZT5A 4NN5C 2XN9D 5JIKA 5DK2B 3U6RA 1G6RA 5DHVH 2Y06L 3KYOB 1T7YA 5D9SB 2SEBA 2J6EL 5KSAA 2VNCA 4YC2C 3MV8B 4DK3A 2BSTA 3U46B 4GBXA 1BFOB 3O4LD 5F1KC 1IC5L 2DJUA 5LAXA 3VFUA 4YNYB 1CT8B 2DQIH 1A3LL 5T3ZD 1VDGA 4WFGD 3VFTA 1XGQB 4I5BB 5KSUA 2ICWJ 5EBLA 4JFEB 4NCC1 3CFKA 4XPAH 3UP1A 2FB4H 1FAIL 1S7RB 1OSPL 4MD4A 2BNUA 5D2LE 5F1IB 4ZNEE 3EOAA 4YE4H 3QH3A 1RZJC 4U1IB 3S4SG 2QADB 3QEQE 1J8HA 1I7TA 3WKMH 3T0EA 4KRLB 2XZAH 2WIIA 5BV7C 1A6AB 4Q74A 4R0LC 4TN9A 5I17B 3R4DA 1KIUA 4QRPE 4RNRA 3T77A 5KJRL 5D5MF 5A43C 1U8LB 2C9AA 3U7WL 4KJYB 3ULUC 3LQMA 3NPZB 2R56H 2YC1A 1QHPA 3WKML 1FVDB 5INCA 5FYLE 2QHRH 4H8WC 4G9FB 4L4TB 4G8FB 3LN5A 2EKSB 5CEYB 3GGWA 3MQIA 4LU5L 4MLIA 4BQCA 4R6UA 3SDDC 2DM2A 2V7NB 4TOYH 3D39E 3ULVC 1FO0A 2HFEA 1CL7H 3TVMC 2VLJD 4KRPD 3AGVA 1QFPA 3EDEA 4J1UB 3QIWB 2W65A 1BX2A 1GZPB 3FOMB 3KYMA 1B4JL 3WS6C 5DVMA 1S7TA 1CQYA 3JTTB 1S7SA 1LK2B 1A2YA 1YEIH 4LCIH 3HNVL 1AO7D 4U7KA 1DQQA 2B5IB 2PKDA 4JHAL 4OGAD 4U6XB 1GYAA 3TFKD 4W68A 2N1KA 4LLYA 2VXUL 1ZLVK 1DQTA 1C1EL 2DRUA 2Y1VA 2AJZA 3DVNB 2J8HA 2R23B 3HMXL 4GO6B 2OZ4H 2OR7A 2YHGA 1CE6A 2H32B 1MJJB 2CUMA 2NNAA 1CICB 3PJSB 5FA4A 2FH6A 1QPXA 4P46B 1G9MH 2DTML 3KG5A 3HE6B 1YJDH 4NQDD 5C0FA 3IKCB 2V9TA 1HN1A 3PIQB 3MV9B 5DJ6B 5EO1B 5AG8A 5D1QC 2HFGL 3WS3A 3MFFA 2Z9TA 3IFPA 2F19L 2EE9A 1CL7L 2H32H 5GHWL 2E9BA 1AGEA 3IDYB 5EZJB 4JRYB 1CVRA 1JGUL 4H26A 2NY3B 4Y8DC 3RL2B 1JF1B 5IQ9A 1MFBH 3GRWA 1D5BB 3MUY1 5KSAD 3EO9H 5E94A 5CZKA 3GMQA 5GGTA 1B6UA 2DLFL 1BVLA 1WIOA 3QWRA 1TJIH 3NTCL 3V6FB 1DFBH 2QQKH 5IP4A 2M1KA 12E8H 2EEBA 1UJ3A 4YBQC 5JA8B 1PJ9A 4QRQA 4ZS7H 1UM4H 1SY6L 2YD7A 1EUTA 3ROOA 4NZDA 4PRNB 4F37K 1LNUA 2DIJA 3HC3H 1ZLWK 3BQUB 5D7JA 4EN3B 2Z8VC 3KJ6H 3HI5L 4R4BA 5EO0A 2WW8A 3TBYA 4AEEA 1IMHC 1RPQA 2FHCA 4JFED 1VB9A 3H9YA 3MBEA 1QR1A 4XB8A 5HHQB 4NQSB 1X7QA 5F7FA 4OI8A 4P5TB 5EUOF 4TNWK 5FUOL 4XMLH 5D2NA 3WHE1 5IF0B 4JY6A 1YPZB 3IXAB 3AS0A 4HWBA 5CGYD 2CUHA 2CO7B 1OF2A 1WZMA 4G6AC 5JHDB 3DYOA 1NL0H 2GT9B 3PXHA 3SPVA 1JWSA 4XTRC 5EIIA 4YPGA 5D1ZD 5KAQG 2YMXL 1A6UH 3FQWB 4U6VH 5B4MC 3FO2B 1BWMA 1WFTA 4GKOA 1G6RH 2V17H 4HHAB 5IM7B 2NX5E 5TQ2L 3TIDA 2OX5A 3QIBA 2R2EB 3CUPB 3ULSA 3MLUL 1RULL 5E9DA 2BCKA 5DC0A 3RWGB 3MRLB 2ADIA 5HDBF 1FHGA 2J88H 5BXFA 5F9OH 4KAQH 1YEHL 3QXAB 4JG0H 3QG7L 3HNSL 4KDTA 7FABL 1CE1H 4PJFF 3E8UL 3BP7A 2DJSA 4FQQA 1CN4A 1B0RB 4NQCA 1TZHA 5LBSL 4HEPG 4MQ7A 1RK0A 2G9HB 3PQYB 4KK8D 4L1DA 2QQNL 1NC4B 3WEXA 4P0DA 2X2YA 4DWHA 4OCXH 1RHHB 1XF5A 4M9PA 5I1CH 4ODUA 3ZE1E 3EGSA 1RIVH 2VDOH 3BX7C 3CXDH 5T1MA 4Z0BH 1KENL 1KJ2A 4HUWB 1BFOA 1G7IB 1H0DA 3GMMA 4L4TE 1UH4A 1ZXQA 4JN2B 5I8OH 2IBZX 4JLRB 2FJHA 4AEIL 2CKBL 2DQFB 3IDMB 3NCYS 4YZFF 3P4OA 5C0CA 5TQ2H 2F15A 4ISVA 2CK0H 4JQVA 4M5YL 1EHLL 2W38A 5CEXB 4FQCL 1IEAA 2DWEB 2BVTA 4OTXL 2Y5EA 4I0CC 3TO4A 5C8JB 4NRXA 3OX8A 2ZUVA 1MJ7L 4YFLF 2F54E 3S3JA 3WL9B 3PP4L 4QCIA 4XNMA 3IU3B 5TF0A 4Y5YA 4ZUUB 1JRHL 3QPQC 5F7NC 1IKNC 1Y0LA 2Q6WB 4N5UA 5DJ2A 1WVZA 5I1EL 1SM3L 4EI6B 1QBLL 1HHKA 4OZGA 4Y4KC 1H9VA 5ALCL 5TJWK 5F9JB 3LS5H 1A64A 1YC7A 4HIJB 1EMTL 1A4JA 2JKXA 2ZNWA 1ZANL 5E7FA 2FBOJ 3CFJA 4NSKA 4N90D 3I2CH 4XWOC 5IV2B 1V3KA 3NZ8B 2Q6WA 4Z7WE 2FIKB 3IDXH 4QYOA 3CDYA 3TO2B 2D7OA 4EN3D 2AXGB 3ARGC 3BP4A 2X4UA 5DD3L 4AJ0A 4H25A 1JF6A 4AMKL 2E27L 3TPKA 5TF1H 3NGBB 5C2BL 1FVEB 1D5ZB 5D6DC 5GS1B 1TNMA 1YQVH 3HI5H 2V5YA 1BZ9B 4KTYA 2IBZY 2D4FA 1LDPL 4MD5A 3EZ8A 1E28A 4ZFGL 5MEPB 4R7NB 1RIHH 2X1PA 4RMQA 4UU9B 3CMGA 3P4OB 5C0CB 3D18B 4OF8A 4NN6B 1FVCA 2F74B 5CIPH 4ENED 1PG7W 1IL1A 4JCLA 1PZUB 1J1XH 5CILH 5KANG 5DMKB 4OQTA 5AAMA 4QOKD 2EIZB 4KKAD 5BVPL 1NGZB 1NEZB 4HZAA 2Y06H 1I3GL 4BZ1L 2GJ6B 3NN8B 1J8HE 3WSQH 3J8F7 3QQ4B 1K8DA 5CP3H 2BVUA 2PCPA 1MAKA 1ORSB 5C71A 4GLRI 4KRMB 1RUPH 4LDEB 5L2JB 5DRNA 2OBGA 5KTEH 1RZGB 1MELA 3V0AC 1JZ7A 2J88L 4PG9A 1P9MA 5FHBH 4OZFG 4DN3L 5DXWA 1CFTA 1EEQA 1Z2KA 4PJ9D 3QRGL 3VH8A 4DCQA 4FQHB 1CE1L 4APQB 1W2KT 5IV2A 4YAQA 5CCKH 5F3HA 1EFXA 3VXRB 2GFBB 5K9OB 2YKLH 4JDVB 2AV1A 4NM8L 5DR5H 2RGSA 5EULV 3WMSA 4IIQC 2VXSL 3P0GB 4ZPTB 4PP2A 4DOHE 4UIMB 3O3BA 4KRPC 3P4NA 2VQ1A 4L4VE 4JO3H 5KVGH 4OFKA 5ADPH 4TVPL 5JDSA 5IKCA 1D9KA 3QUYD 4MVBC 4D0BA 3AB0B 3UYRH 4ELME 2GITB 3T0AA 1NMAH 1BQHB 1A9BB 1J11A 1GGBL 2P5EA 4M7ZB 1VPOL 3UPRA 2NW2B 1N4XL 3HMWH 3OAUH 4MQTB 3DX8B 1BQHG 2F8VA 1GOHA 3D1MC 5DS8A 5JHDA 3ULVE 4PJCA 1CFVL 4BA8A 1S8DB 4M62L 4CVXA 1U58A 3ALWA 3GIZL 3ARBD 2UUDH 1ZA3B 4R3SA 3TYFB 1B9ZA 3K1KC 2QADC 4R26H 2EZ0D 3OSKA 1NAMA 5D7IB 3PP4H 1FH5H 4BQBA 2R15A 1KFAH 1MFNA 4UIKH 1WAAF 3C8DA 2DYPB 4N8CL 2YSSB 4BFGA 1NCNA 5EO0B 4JAMB 1KBGH 4LNRA 5FYLD 2C26A 1QRKA 1PY9A 2BHZA 3MFGB 4JPIA 4PBXA 5F70A 2DQUH 1CDGA 3IDNB 4LIQE 5A16B 5IB1B 2AJYL 4WUUA 4X0KA 4PTTB 5GRXG 3RZCB 3GMPA 5KZCB 3G04B 4OCRL 5I15H 3DARA 4FQ1L 2Q7YB 2R1XB 3QXWA 3OXSB 4ZS6D 5DD1L 2CKNA 2GEEA 3VRIB 3ULUH 4N9GA 1F8TH 1M7DA 5GS2H 3AMKA 3UJTH 2AXHA 1DUYB 1FRGH 1EHNA 3B3IB 1A7QH 4PRAA 4L9LA 3DV6A 1DBMH 3WIHH 1GC1H 3SQOL 4YBLC 2X9YA 4DKEL 3D3VA 5ICYA 5FYLL 4GAGH 4ZO8A 2BFVH 2I26N 4PJ8A 4WNQA 3DGCR 3AC0A 3DOSA 4MAYD 4JG0L 5K9KA 1RJYA 3WFBH 1INEH 1XGYH 4NFBA 2L4OA 4V1DE 1FG9C 1AR2A 1EVUA 5EOQH 4JGJA 4WTZG 3WFDL 3SKOA 3WFZA 1J88A 1DUZA 3I9GH 4M7JH 2AKRA 2RJMA 4TUJB 5MENE 4PP1D 4L4VA 1S7XB 2D31B 2P8LB 2YOCA 4QXUL 5TDNA 2JB5L 4GOSA 5HHOE 2FX9L 3IGAA 3O11A 2BNRE 2P5ED 1BQUA 3FO9A 2AEPL 4U1GB 4Q9QL 1NC2D 2XA8H 3DXAE 4GXVL 1SEQL 3VMPA 1ZLUK 4Z76A 2GTWB 4IMKC 4IRJB 5FB8B 1XR8A 2VXTL 3AMLA 5HI5D 3CFCL 1TQBB 4X7SL 4MXQC 2GK2A 5DJ8A 3CZFB 4PUBH 2QEJA 3P11H 4TTDC 3RZCA 3MJ9L 1A6PA 5DJDB 4OZFA 4Z95L 3GSOB 3S96A 1HINL 5I1GH 3M17A 1YQ2A 5DFTA 3HKFA 4QHNB 1Z3GH 2HJLA 4CVZB 1TENA 2YPLE 4R4FH 2BC4B 4PJEF 2IC2A 2DBLH 4NT6B 2KQMA 3VGAC 1LO4H 2H8PB 2AEQH 1KENH 3PGDB 3QCVL 4MD4B 3NIFE 1E6OH 2P8MB 1A1MB 1S8DA 1C5CL 2RCSH 3RPIA 3DX7B 1GOFA 2DI7A 4QOKB 2R2CA 1U92B 1TJIL 3NTCH 4P4KD 3C5ZC 4WIQA 3S88L 5JPMB 2P8PA 5I66A 5I6XB 4E0RB 3ILPA 4IIQB 4N1HB 5E8OB 2VH5H 2BNRA 2PYFB 4M02A 3QB7C 3WLBA 1S9KC 3DURB 1FZKA 1KNOB 1UFUA 2J2ZA 3FQUB 4NNXA 3GMPB 1BVZA 1DN0B 2C7UA 2F54A 2HLAB 4JR9H 5I2IA 1BQLH 5E1AA 5JQ6L 4QF1B 4NNPL 1MAJA 4NBXB 3V4PH 4Z7WB 1Q9KA 1J1PL 3B5TA 5L2KB 3UAJD 4EQ3A 1OTTD 3QYCA 5FO7B 3BN9C 5F8RC 5K9OA 5KVFL 3QA3A 1ETZB 3D6GA 1XCTA 5F3HB 1CU4L 4Q97A 3NACL 1Z3GL 4LOUD 1JHLL 3ZTNL 1BIHA 4IJ3B 2WLZA 1D9KD 3BEVA 3BPOC 2GTZB 1KIRA 2F58H 4E5XB 3MLYL 4RDQF 3WIHL 5D7SH 2OMNA 5LJYH 2ED8A 3PWLA 3QPXL 1RUQL 2OL3A 3NN8A 5B39A 2EDYA 1G1YA 5C0GB 3QSKB 1FZMB 4XPTL 5BV7H 2X4NB 4PIRF 4F7CB 4YXLH 2WSKA 2IQ9L 3WFCL 2ZG3A 2M2DA 4MD0B 4MAUH 4MZ3A 1RZFH 2X7LA 1J8HB 5DJYA 3GK8L 1BJ1H 3BD5A 3QPXH 3ESVF 3CVIH 4NKIH 4PB9H 5GISL 3Q5YA 2QJDA 5ITFB 3DX8A 2WBKA 5C0DA 1FZOB 2IH1A 4QHLA 1NBQA 3WFEL 1MHEA 4JKPH 2D4DA 4XX1G 5FUZH 3RWEB 1AGCB 1ZLSL 3BESR 4O9HH 5EUKA 4ZS7L 1G9MC 3QUMA 2MOVA 1VENA 2B39A 3GIVA 3P4LA 5GGSB 4Z7QF 2BZDA 5DO2D 3MV8A 2ADJA 3H0TB 2NY5H 1ZLVH 5E70A 1FFPB 3WNLA 3VXRA 3FRUA 4PGBA 3KYOA 4I3SL 4M9OA 4PTTA 1A14L 1QSED 3Q2CA 3HAEA 3C6LC 4UAOC 4ETQA 4IMKA 3RWFB 5J89A 4BYHA 4ORGB 2ZSVB 5DURB 1FNEA 4YXLL 1MCQA 5EWIL 2F53B 3ZKMD 3TBSA 5CMAB 5LWYH 4KJWD 1GH7A 1A7NH 3RFZC 4PBVC 4LCUA 1MFCL 1QLFB 1TNNA 4BZ1H 3TYFA 3QHZL 5LXGH 3QFDA 1FVCB 3RUGF 2PYED 3QUZA 1XGUB 3THML 1JFQL 1W72A 2NTFB 4Z18A 4PR5B 2W60B 2V7HA 4MNQD 1KB5A 3UBXG 4LSQH 3MLPA 1GAFH 2NZIA 4H1LB 1C8PA 1JCKA 1YYLH 4K7FA 4UT9H 4RFNC 1AGBB 3S7GA 3TVMA 1JGLH 3BXNB 1X5YA 5D1XD 4S1DC 3D25A 5J57B 3H7BA 1XMWA 3MUGB 1YYMH 2X70B 1J18A 4MXVF 4PRDB 4X6EB 1R3JB 2R2BA 5CS7A 5CKAA 4UQ2B 5E8NA 4LCCA 3DVGA 3PQYD 4TUKL 4FNLL 4JQIL 1L7IL 2YRPA 2GFBA 5EWIH 2P7TA 1MCSA 4U1KB 3CFIC 2IANE 2AAVA 4NQTA 3QWRD 4XXDA 1QG3A 4P9HC 3FO0L 3VH8B 4QRQB 4K3JL 3ARXA 1RK1A 4LARH 2R39A 4Y5YB 5GGTL 5EORL 4JVPA 4M1DL 4QWWC 4XAKE 5GGUB 3SDAA 3WV0A 1PX4A 1U42A 4NIKB 4OZGB 3V6OA 3NZHH 3OZ9H 3KYKH 2GSIA 4P9HH 4Z0XA 1OAYL 1DL7H 2HLAA 4X6CE 2IWGA 2V2XA 4PJHA 4LLWA 4ELMA 1YDPB 3KPRD 4TVPE 2XTJD 2OL3L 3BI9X 1P69B 4AEHH 4TRPH 4XBPA 4N0CD 2B4CH 1AD0B 3WUWG 3IFOA 3BPLB 2HH0L 3LB6D 1D3CA 3MRBB 1CYGA 1PYWB 1YPZA 4NWTL 4J8RA 3MOBL 1MCWW 1IAKA 3MJ7B 3KDMA 3ZYJA 1N26A 4BH8A 1QEWB 4W6YB 4XBGA 4GRWB 3EAKA 1I1YA 1U8MB 4BSVB 5LQBH 1NUDA 4Z6AT 2V2TB 1I1CA 2ZUYA 3ZHKA 5EOQL 1F4XH 1F5WA 1JF5A 3GJFH 1K9TA 3W9EA 3DXAB 4XXCA 1L4IA 3O8XC 5E6IB 1DQQB 1NANI 3ETBF 4G7VL 4HUXA 3KLHD 2ZUXA 4FXKB 25C8L 4WUKL 4LDOB 5H35B 3K3QA 4RGMC 2QQLH 4OFIA 1NAKL 5H37G 3QEHB 2X89A 5J9PB 3EJYD 4ODHH 5JO5B 3C5SB 5IT2L 4DGYH 3LKOB 3SDYH 5IB3A 1MVUB 1OP9A 1I1AA 4R2GD 3V6OE 2H2PC 1GCFA 1XFPA 3HC0B 3HA0A 3MJ8B 3VD5A 4RA3A 3KLSA 2XN9B 4JRYA 1MVFA 4N9OB 1C5BH 2FX7L 3SE4C 4Z7QE 3QAZC 3MFFB 4O51B 43C9A 1D6VH 2ICEA 3DMMD 5DJ6A 5EO1A 5KSBE 2EDWA 4NQSA 4KK5D 4WTZA 3UPCA 3RPIB 3VD4A 3EYVA 5IWLC 1XGPB 4ISVB 2VDPH 4DAGL 1A7RH 5D2LA 1I9IH 3BZEB 4LIQL 4U3CA 4X5XA 1VESA 5ENWA 2I25N 2V2WB 3L5JA 1A9EB 1FL3A 4XCCH 4JM2A 3T1WA 1MWAH 1K2DB 2I9TA 1U91A 1FG2A 4RQQA 3B2UC 3WXVH 3QIWC 4HIHA 3VXRD 5L8JB 3O2WH 4GH7B 4UZGA 4X4YA 4YNYA 3RUGE 4GAFB 1A2YB 4LARL 2N56A 4AT6B 3MA7B 2FECI 4GT7A 1KIQB 2ZCHH 4WV1B 4WEBH 3RL1A 3QXVA 1XF3B 3BP7B 3KR3H 2GCYA 3VXUB 3U4EB 3LEXA 3P4MA 4Z78A 4LDLB 5BRZE 1KELL 4OLWH 1PKQA 1U6AL 1Y18A 1QVOA 1WC7A 3MUJA 1LEKB 2YEZB 4RISH 2RBLA 2VLJE 3BSZH 1ZHBA 4JQVC 3KLAB 4DKAA 4R2GC 2WBJD 1HKLL 4MDJA 1CLZH 3OL2A 4FOMA 2WWMD 1CGSL 4NZRH 4FXLA 5AWNH 1ZLWH 5KS9A 3HFMH 3PHQA 2GT9A 4MA7L 1JNHB 5C0JB 5H94A 5F9OL 1A6AA 4KU1A 1OVZA 3KJ4C 4Y5VA 5EZLB 3I6GB 2W9LA 3L5IA 3MPCA 4UT7H 4NQCE 2VLRA 3MACH 1LDPH 3U0PA 2G5BB 4NZRL 5AWNL 1F90L 2JF1A 1KCRH 4HUVB 4HKBA 3LDBB 4M93B 1JYNA 5FGBC 3VFRA 1CFQA 1ZHLB 3K1DA 3VFNB 2CLRA 4C55A 5I8KL 4HIXL 4RFEA 5BW7A 1MFDH 4BELD 3RTQD 4H0HB 1L0QA 3KXFB 4RAHA 1TTGA 4UDUA 4OZIA 2FWOA 4Y88A 4B53A 2BVPA 1JNNL 1FYTA 3BE1H 1QO3A 1B88A 4XNUL 1I7ZB 3BOVA 3EOTH 1F11A 4LVNC 5I8KH 4NQUA 2CLZB 3QI9C 5BOZG 5SWSB 4PJ5D 5L8KB 4KKAC 1JPGB 2A9ML 3I6LD 2BX5A 3MREB 1Z0MA 4HPYH 1CGYA 3UTSA 4PJHB 1U8LA 4ZOCA 2UVFA 1DSFL 2AJUH 4O4YL 1JWMA 1IAOA 4OTXH 5AG9A 5EOCL 1NFDE 3O9WD 1CD9B 2VSCA 1KCUL 5IBLC 5GIRA 4HK3J 3C60A 5L6YL 2P24A 2YUXA 5J13C 3QIBC 4OD2B 1QR4A 3ARGD 4WU5A 5DMKA 4PJCB 2B1HL 3BO8A 4LEXH 3SKMB 4QRRE 1KG0B 3HI1B 3QIWD 3OKEA 3LQAH 3UYRL 1K3ZA 5CEZH 2FX7H 5FHAL 2L7UA 1OGTB 4JFFD 3DIFA 4FA8A 3QDGB 3OAUL 3G08A 1YEEH 3FL7A 4NQEA 2NY0B 35C8H 2MCPH 2RAMA 2SEBB 4LCCB 3T3ME 2XQBH 4WY7L 4CN4A 1ZSDB 2NY4D 4PRDA 4FFVD 5GGRY 1D5IH 1S9XA 5EA0L 4DUWA 1MUJB 1A7OL 3CDCA 4N0YH 4X8JB 3JTTA 5ISZE 2Z8SA 3P9WB 1G7QA 4F58L 1E4WH 3NVQA 1JGDA 2EE2A 2YD6A 3O2DA 4JDTL 3P4NB 4IEFB 2VAJA 5CEZE 1JGEA 2RB8A 4ODWA 1FGVH 3QFDB 3WUWA 3TBTB 2KBGA 3O2VH 5DJAA 5H8DA 5CD5C 4R9HA 3G5VB 2YWZA 2I07B 3GSNL 3U0TA 4G8IB 1UYWL 1LK3L 3VFMA 4J3UA 1CIDA 3RNQA 4D9LL 2IALA 3W5NA 2J8OA 2KDGA 2H6PA 1MCLA 4TNWF 4K3GA 4PPTA 4Q6IA 3L5XH 3RP1A 4MCZB 1J5OL 2AGJH 4XZUB 3X14B 3HG1B 1QACA 2APBA 3KPNA 1H3XA 5I15L 1I7UA 2VDNH 1JWMB 3MX0A 3TO4B 2GI7A 3QUKB 5KOMC 2NX5A 2IMMA 5JNYB 4PG2A 3UJTL 2B2XL 4ZXBB 4QRUB 2B8OT 2VQTA 4GRWE 3SDXA 2MTPA 5IB5A 5KSVA 3P30L 1HZHH 3MC0A 4O2FA 2QR0B 4E41A 4NUGH 5DSCB 3IS0X 1I9JH 3C6LB 5D8JH 4UQ3A 2VE6A 2WQ8A 4M3JA 3HR5A 5T1DH 3BIKB 3KPTA 1CLOH 3P2TA 5CWSA 3HPLB 1LE9B 1G7LA 3W2DH 1FYTB 3QCTL 3FFDA 5IT2H 2A1WH 3X3GL 1KJMB 2XNAA 2OSLA 3VMNA 3QISA 1R5IB 3R06B 3VE0B 3CMOL 4X6FB 5EN2A 2QR0A 5FYJE 3TA3A 4E41B 4JFEE 4X6EA 3SGJC 1G7QB 3BW9B 3FB8A 1OGTA 3AAZA 3NIFF 4EOWL 3LH2H 3T3PE 4EJ1C 1UKSA 2ILLA 2P47B 4OZHB 2VABB 3GFUA 3LN9A 3UBXA 2YA1A 3DWTA 4G6AD 3L3JA 4MJ5A 3IF1B 4F7PA 4P2RB 5IB2A 4R0LB 2HRLA 1KB5B 2EYRB 4FZ8L 3I2CL 1P5VA 4E9LA 2XG5A 1N7MH 3WFHA 3DRQB 3B5HA 4JM4H 1D5XA 1K4CB 2QHLA 1NCWL 3TCXA 1GHFL 3HZVA 4LSUH 5L6YH 4OT1H 1JGVL 3HG1A 3MZGB 3OGOE 2O5XL 3M1BB 4QGYA 3T08A 5FAAA 3S34H 5T3ZL 2E9JA 2QHRL 4A2MA 2JCCA 4XI5D 3AM8A 2EDBA 3DX6A 2DQDL 1MHPL 4OB5H 3ULVF 5J06A 4JHWH 5DJZB 2FLBT 4G8GE 4A6YH 1IGYB 1ED3B 4NUJB 5F1OB 5FECB 3F7PC 3MREA 4H20L 1PFCA 2ZUWA 5JXAH 2CO6B 3CLEH 4XNQA 2NXZD 3ZKND 4ERSH 5IJVB 3UJJH 1HHGB 3JV4B 1UENA 1KACB 3FQUA 4NNXB 3L3KB 3H9SE 1UKTA 4DZBB 5CCKL 4O5LH 5CUSH 2ERJC 2Y36H 3LMJH 2AEIT 1QHOA 5GHWH 3ILPB 4NM4L 1BJ8A 3BH9B 4R4ND 2Z31C 4HIHB 1G9NH 4ESKA 5HBBA 3EO9L 4NDMA 5E7BA 4BZ2L 2VN7A 3MNWB 4JN2A 3UDWC 5TGBB 4EN3A 3O41B 4OZIB 4XCNB 5BRZB 1U8NB 4G80B 1C5BL 4PRNA 4HGMA 1AC0A 4P23C 1XR9A 1N2RA 1ZT1A 4ODSL 5DYOB 1WICA 3B8SA 4PRHA 4U4BA 3VXTA 4XP1H 3W39B 4LSPL 1ADQA 1HH6B 1T1YA 4H88L 2D7QA 5DJDA 4FZEL 1YEDB 5DJ8B 1T04B 4JRYE 2J8UF 5IK3B 3D39A 5C0ND 3HC4L 4JGUA 4W6XB 3LKQA 3TP4A 2YEZA 4FFWC 3ARFA 1LEKA 5ACMA 3CSYB 4ZFZB 4GXUN 3VJ6B 1BFSA 4N0RA 1TVHA 1V05A 4OD1L 4HC1H 2J4WH 3LB6C 1FAIH 1HYSC 4P2QE 4JZJC 4LCYB 3VXQB 2AEPH 3BRFA 5HPMB 3LRGA 5ALCH 5IEHA 5JDJA 5FA4B 1T1ZA 3QEQD 1OCWL 1T4KA 3F6LA 4HJ0D 4MJ6A 5DC9B 1T5XA 5IOPB 2OS7A 4YK4B 2Q86B 3FCTB 4F37F 3VFRB 2QSCL 4DQOL 5L2KA 2BSSB 1ZANH 4YXKH 2EDOA 3BWUC 2JCCF 2QSQA 4YHIA 1IC7L 2C7UB 4KMTL 4C56B 5DQ9A 3H3BC 3N1MC 2Q87A 2QLVB 4K23H 2I9TB 3CMOH 1ZHLA 5EPMA 3BEWB 5GS3A 3VFNA 2HTKC 3VFPB 2VR9A 4FFWD 1H3UA 3QO1A 3Q3GB 2BSSA 2IPTL 4JO1H 4POUB 3HUJE 2H2PD 4QHKI 1EK3A 3LN4B 4L9LC 1AP2B 2AJ3A 5ESVA 3LEVL 3ZKSD 4WENB 5LGHH 4K94C 4I77H 3K4AA 1RZJL 3MBED 5FK9B 4DN4L 3MLZL 4M5ZL 1FLRH 2R29H 4Y2DD 3D85D 1NCAL 3GGWB 1PLGH 3B2VH 4M6ML 4NC1C 5I8CB 2Y5TA 3TV3L 3N1QC 3WJJC 1IC5H 1OW0C 2IPUK 4HWZB 2VDPL 2W0PA 4KZEH 3AM8C 1NGWB 4P4KB 4XC3H 4G3YL 2H45A 2GJZB 1H8SA 4NKMA 3MV9A 4WW2F 5CLWA 1NDGA 1NBZA 4K2UL 1LO3L 5ICZB 4O5LL 2YPKB 2PO6B 3CH1A 1U8PB 1MIML 1MWAA 3VGGA 1MCRA 4HUNB 3MRIB 3AREB 2PUQT 5E9DD 2G2RB 2GK0A 2R2HA 2FX8L 2DD8H 4JCMA 3S4SA 5I1IH 3Q1SL 3EO0B 4PJAA 5B4MD 1KTRL 3MRKB 4EIZC 3WO3B 4WUUD 4RX4A 3IDJB 4C83B 5C0RL 4ODVL 4OCSL 5AZ2H 2WBJC 5H35A 4QGTA 2ZG2A 3FFCE 4NQEE 1JPSH 5HI5C 4XC1L 1G9NC 1XIWB 3EDDA 4EEEA 3MZTA 3UYPA 4JFZH 3QDJB 2IFFL 4UUJB 3V0VA 1E6JH 4KPHH 3KAAA 4Z77A 2HVKB 3P77B 5I9QB 2AK1H 2APXA 1LK2A 4OSUH 3OWEA 4U0RC 4PJ5A 4ZFZA 4DVRL 4RAVA 1QZ1A 2FHFA 2VQ1B 1UH2A 1DE4B 5F7KC 1EERB 1GGCL 2ZOLA 3DROB 1S9WB 4CNIB 2IFFH 3UPRB 4FQLL 4QNPE 3LQAL 5GQBA 3KJ6L 4ALAL 1IT9H 3SDCD 3RWDB 2JJUA 1U8KB 5D5ME 1MRCL 2ORBH 3AUVA 4XCEB 2F8OA 4PGEB 2OR8A 4PJFB 4YGVB 4H1LG 1HILB 2W59A 5FA3A 2ESVD 3ZE2E 4J7RA 3LKQB 4F9PC 4O2EA 3OKKA 1I7RB 4QT5B 2VLJB 1FV1B 5GGVH 3MCLH 1OARL 5D7LA 3EYSL 2VC2L 5DRNB 2JJVA 3S35X 5HD8D 1P7QB 4LPTA 5HVHB 3FTGA 2ICWI 2VKWA 2PCPB 3S5LB 1I1FB 4KGLA 1MCBA 5GISH 5JORA 4O02L 1X5XA 4J12A 4ODXB 4C58B 4EDWL 4JFQA 3VXMA 5JQHC 5A2FA 2A9MH 3Q6FA 2GYSA 4OLYL 4J2XA 1KEMH 1U8NA 3X3FH 1OGAE 1S7WA 4YUEL 4PJIB 5SV3A 4PRHD 4V1DD 2AXFB 3T0ED 3L9RB 1KEGH 2C3VB 4NBZB 1QBAA 3PGFH 15C8L 5CIPB 3RZWA 4GQ9H 3PWJB 2XG4A 5MEOA 2R29L 3HE6D 7FABH 4P2OA 2D9QB 4I9WD 1OAXH 3JV0A 4KZEL 1E28B 1WT5C 1KN4L 3CCHA 3PL6D 2CUIA 4HK0B 4PR5A 3E3QC 4Z0XB 3V0WH 5A40E 1EEYB 3FAXA 5FKPA 4X9IA 3VXSE 3R0NA 3VW3L 5IVNA 3WJJA 1P2CA 3BWAB 3C8KA 4LLWB 3BKML 2IAMD 4EUPB 5DDHB 1HSBB 2NY4C 2F53A 3QNXB 5CINH 1SMAA 1Q94B 1B4JH 3GHEL 3PDDA 5JR1H 3WD5L 4FP8H 3LEYH 4M6OL 2JCCB 5HDQL 2NY7L 4LGRB 3KPPB 5T5NF 3MODH 3FT4A 2HMIC 4AIOA 4NO0B 1UEMA 2O5YH 1OM3L 3O0RL 3GB7B 1I85A 1L7TL 3W11D 3WFCH 4OGYH 4I3SH 5LGKA 4XP6L 3I84A 4EUPH 3IU3A 1HWHB 4HUUA 2ADJB 4FQXB 3H42L 5F9JA 1EPFA 5HI4C 4NO3B 5DA0B 2CRZA 4K7FB 4PV8B 1HEZA 4P5KA 4FTVA 2GJJA 1I1AC 1GGBH 5C6WH 3E2HC 1W72H 2A6DA 1JZ2A 2EEAA 2PW2A 3NCCB 5CHNB 1OP5K 4JVWA 1KT2A 3BZFB 4MNQE 5E99L 4QTIH 3OQ3B 2FO4A 3IDYC 4OCYH 4ZUTA 4IMLA 5IVXF 3RI5K 1ZLUH 4KHTH 5JNYA 3EGSB 4ODVH 1WEJL 2W9EL 4M5YH 3MLRH 2VXVL 3DTXA 4ODSH 3DRTB 3D18A 4K07A 2OP4L 4YFEA 1H3GA 3KPNB 5EC1B 4M1DH 4I18A 4XCYB 5GIRB 4ZO9A 2OL3B 1MCFA 4LAJH 3BN3B 2ZUUA 2HFGH 1AE6H 4OZFB 4ZG1A 3CXDL 4WJ5A 2ICCA 4F7MA 2X42A 3GM8A 1G9NL 4V1DA 4S1DD 3UC0L 2KUTA 1T20A 3GMLA 2PTUA 1QRNA 1BOGB 3QXAA 5DURD 1IVLA 1NBYB 4PRPA 3GUTA 4JO4H 4XPGH 1JZ5A 3F7VA 1NAKH 4HBQA 3KPPA 1A0QH 3WDHA 4JDTH 1RUMH 3SDYL 3D0LA 5GGSA 1JHLH 1JNLL 3ILQC 4MNGA 4HFWB 1TJGL 2Q8BH 4PJHF 4RFEB 4H88H 3QA3B 2KKQA 4PJ7F 1T83A 1ULVA 5E6YA 1I8LA 3T0EE 4YPJA 1A6VH 2PYFA 3WLBB 2WUCH 3MR9A 2X4PB 4K8RC 3DUUA 3U4BL 2DL2A 5D93C 3JZ7A 3X11A 5FYKE 4BFBD 4P5TA 4MA1B 3U36B 1PEZA 1H8NA 2WMPA 3H9HB 5IW3A 4RGNE 4Y5VB 4OZGE 4B0MM 5CJOL 1W72B 3PHQB 3PHOB 1P4LA 3C60B 3H7LA 3VFVA 1IFHL 1TQBC 1GSMA 3X13B 4ZMAT 3OR7B 1Q9WA 3AY4C 3GJFA 1A1OB 1NBVL 1ZGLB 4DTGH 4Y16A 3BP5B 5IG7B 3QP3A 4PRBA 1M71B 2OR9L 4HZLA 1AO7A 4YIQA 4HJGA 2V5RA 4NYLB 3OGCB 4PJ8D 3QJFA 5E1AB 3ULUE 3QRGH 1MRFH 4L3EE 3WJLA 1GGIL 5DMIH 5E94B 2X05A 5C08B 1Y6NR 2YPKA 4ZFOB 1I7RA 4QT5A 4AT6A 4UDUB 1YNLL 3PNWA 1EXUB 4OQ1A 5EUOE 5F7YC 4QRRB 4C4KT 4JDZB 5CP7B 1QFWM 4N1EA 3ZE2F 5I1DB 4ONFH 4OQTL 1EA9C 5I0DA 3BPNC 3BAEL 2Z92A 3FB6A 3O3AB 1FZKB 1KNOA 5F93C 1PDKA 3H9ZA 2AKRB 3O45B 3I3EA 5CBEA 4YDVB 3GSQA 1S7QB 3OKLA 1INDL 1UM5L 3SE4A 1DLHA 4QXGL 3GDBA 3I6GA 2DMCA 2OTUB 2Y25A 5FDYA 1NQBA 1A4KB 3EDFA 2X4NA 4F7CA 4LPWA 2XV6B 1MJJA 4LQFH 3SO5A 3HI6L 3D3VB 5HYQA 3QAZB 2C1OA 2WIMA 1HSAA 3BPCA 4PJ9A 2R1YA 2DLIA 5HDLA 4F57L 2AS5M 4OM0H 2CKBB 5DRZB 2FECL 5K9JH 1NGXA 4DEPC 4HIIA 4HCRL 3E3QE 1XF2A 5FGRA 4N8PA 4CMHC 5CSZA 1MREH 3FHQA 4CADB 4WGVB 1QKZL 2MNUA 1KPVA 3CSPA 4MHHG 3OXSA 1OPGH 2FEDD 4AYFA 4Y7MA 3L3OB 3VXMD 4YJZL 4YX2H 4G8FA 3L3GA 2YD4A 5FO7A 2NXYD 3T4AA 2NPLX 4HJGB 5MEND 1SBSH 1LEGA 2G75B 1ODAA 1FG2B 3ULUD 4WV1A 5GSVA 1XAUA 1AKJD 2QSVA 5HDBE 3QDMA 2BY3A 3U2SA 3BRDA 1UWGL 3F6IA 4L8BB 4PJ8B 3O6FA 3SE9H 5HGHA 4QXTB 2YZ8A 2O61B 3BGMA 3CFEB 2BDNL 4MXQD 4U6TA 4Q6IC 3FQXB 4U1NB 1J0JA 1OTSC 3STZB 3EO1A 5M95B 1UXWB 3GSNB 4AG4H 1F13A 4U6HA 3IRPX 4FRWA 3GZKA 3VXSB 4NN7B 4X80H 3SJVB 5CJBA 4ZAKA 1SEQH 1WWCA 1ZA6B 4BQ8A 4K7PX 4PJDB 4TSBH 3GHBH 2DMBA 5HI4D 3RRQA 1TLKA 3QZWG 4OIBA 2MKLC 1X3DA 2DQIL 4WFFD 3LKSB 4PGZA 4HG4K 2VDQL 5MEPA 1RUQH 3UZQA 3BDBA 4ZD3H 5GZNC 3AY4A 4NHUA 1C12A 3QEQB 3A6BH 3LRSA 3VWKB 3EYFB 3K8LA 3L3GB 1OQXA 4MJ6B 1KJ3L 1I8IA 5C9JA 3B8YA 5IHBA 1DDHA 3GUTB 4YAQB 5IJVA 1N6VA 5HDQH 3EW3B 1VEMA 4IDJH 3MXWH 5DVNA 1C7SA 3PNWB 4NKQB 1V5JA 3NCJH 1V3JA 4TSCH 3HR6A 3CXHK 1OAXL 4D0DA 3TN0C 5KTEL 2VL5A 3W9EB 1KCRL 4PLKD 2OTWB 1MIMH 2VWEE 1CICD 4XPBL 1QP1A 4L4VB 5DJ2B 4BH7B 2FATL 2Y6SC 4GKNA 1EAPA 2JK5A 3QHZH 1LO2L 4QXGH 3CU7A 1UZ6E 3R1GH 3ARSA 1MLBA 3TJHC 1HH6A 3RNKA 3CCHB 4A6YB 5F71A 1IJ9A 3ZDXF 1JYWA 1B0GA 1IZJA 3QH3B 4NRYB 4JPWH 2UYLA 5E4EC 5CSGA 4ZPTA 4JPKH 3BDXA 4XMKL 1NC2A 3IFLH 1ZAGA 3ARGB 4YO0B 5FM5M 1BEYL 3SCMB 4Y4KA 1UYWH 3STLB 1VACA 4AL8L 3GSUB 3MROA 2DQUL 3CIQA 1IM3B 5T1LD 2EZ0C 2R1WA 4JFQB 3TM6A 1U8HA 1ZOXA 4WV1C 1QPPA 1RURH 3PUCA 2IBGA 1DQLH 2D0GA 1KIPB 5ERWB 3VG9B 5IHZA 5D1XA 5DUBB 4UAOB 5BZWA 3UO1H 4P5KB 2NZ9D 4RSVA 1KGCE 4WUUB 4X0KB 1A1NA 4M6AA 1IAII 4MJ2A 4OBRA 4R26L 3BMVA 3RVVC 3OG4B 4HIJA 2P5WD 1HZHL 4QHMB 5ERWA 5IHZB 1REIA 4NNYA 3G6AB 2R0WH 3GKWL 3GNML 3NZ8A 1F4WH 1IC7H 4NFDA 4QEGA 4Z7VE 1JUFB 4X6DA 3PP3H 2VAAA 4HDIB 5LCVH 2EIDA 2BVOA 3RX5A 1YNKH 4QOKE 3G5YA 2Z0BA 3AS2A 4DEPB 4Z7NE 5E2TL 3IT8D 2O93L 3AREC 4KH2A 4JANB 4OD3H 5B38A 1HHJA 3M07A 5IMKB 4R8WH 4BK4A 3ULVH 3OKOB 2WUCL 2D03L 1N5YH 4M03A 3SJVD 2PNDA 2D7PA 1BD2E 2FO4B 4PJIE 1OTUD 2DQFA 1LILA 5C0AD 3TYGH 1EDQA 1OP5H 5F97E 4KV5F 2OM5A 1JZ3A 2DQCH 1ORQB 1A3QA 1CBVH 3WFBL 1GC1L 4D0BB 4R4NC 5F44A 5B38G 4WDIB 1BIIB 4WFGE 1DN2A 1TTFA 3OHXB 5IGXL 3I6KA 2W60A 1CD8A 4G9FE 5FF6A 5A1AA 1MFCH 4NO3A 1MY5A 4TYUA 4P48A 5EOCJ 4N90E 3H3KA 5E2JA 1T6WA 1G7LB 3N1PC 1ACYL 4P46C 1UH3A 5SWZD 5C09D 2G9HA 2VUOA 5I16A 4OLYH 1HH9B 3MV9D 1U3ZA 1YNKL 4AIZA 2VLMD 2A6KB 1I3GH 1I3RB 1LO0L 2A77L 4M5ZH 3PG2A 1NMBL 4U6YB 3SGDH 2B5IC 1K8IA 2H2SD 2B4CC 3QG6A 5HVHC 3MRPA 3OJDB 4D2NA 5T5FH 1BD2A 4OCLC 5DD0L 5FO8A 4KQ4H 4PJDF 4LVHB 3FOLB 4ONFL 4I18B 4XCYA 1KB5H 4HT1H 4DZ8B 1IM9B 1LEIB 4JFDA 1L6XA 5EOCH 1UGNA 4RMWA 2AI0H 1ZA6A 4HS8H 3IU4H 4JFFE 1DQML 4MD0A 1PSKL 3QUXB 4KQ4L 3BZDA 1C08B 1OD9A 1BM3H 4K3JH 1FORH 2R8SL 3KHQA 1E27B 2PW2B 3KVQA 4XWGH 1B0GB 1OF2B 4DJMA 3WJLC 3QDGD 1NLBL 3QXUA 4KPHL 4KROD 3C09B 3T2OA 2N7AA 5D96B 2A9NL 3TH3T 1RV6X 5MENA 4JJ5A