5EIIA

Structural determination of an protein complex of a fab with increased solubility
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
220
Chain Sequence
b'VQLVESGGGLVQPGGSLRLSCAASGFNISYSSIHWVRQAPGKGLEWVASISSYYGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRGQASWDYWWAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Structural determination of an protein complex of a Fab with increased solubility
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 220
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiiA01
1QLFA 1IARB 5C6TH 4WDIB 1UA6H 1RZ8B 3EYQC 3CK0L 4JG1L 2QTEA 1CG9B 3FB7A 3WFCH 1OLLA 3WCYA 3LQMA 1Z3GL 1D5XB 2QQNH 2VSDA 4D8PB 3JWDH 5IKCA 4RIRA 3F7RA 5CLWA 3FFDA 5IFHL 1JGVH 4Q9CA 4P5TB 3WDJA 2XTJC 3HZVA 4OCMC 4PRNA 1CL7H 5CEZD 4RGNB 4Y7MA 5ID1B 5BVJB 5DDHA 1AP2B 1QA9A 2VUOA 1NC4A 3WIFA 1MCQA 2ICEB 5ENWB 3TF7C 1WIUA 1M7IA 2D4DA 3DURB 2FJFA 4U1IA 4HUVA 3GEWB 1FYTB 4Z7VE 3G5ZB 3TLRA 4LLVA 4WNQA 3L3KB 1S9VA 4OI7A 2FSEA 3HNSH 4PV9A 1MAKA 4N5UA 5DT1L 1GGBH 3TBWA 1NCTA 1S5IH 3KLHD 2GITA 4OLZH 4UQ3B 4HUNB 4MAUL 2WBJC 5BRZD 1SBBA 3O41A 4HIHB 3GHBH 7FABH 4PJFA 2GTZA 4X5LA 3TVMC 3MLTB 1LO0H 2O5ZH 3C08L 4FFVD 5EUKA 1FC1A 1KN2H 4H5SA 3K2UH 3UJIH 5JOFB 4G9FA 1A3LH 2AXGA 2JCCB 4HX1A 4LLWB 4KC3B 4LNRB 2DQEH 5L9DL 5DK3A 5J3HC 5ACZB 3GMRA 3HMXL 4JM2A 4LSQH 5TDOB 1UJTA 3LSOB 5CGYC 1HCFX 1NBZB 3MGTA 3M8OL 1VADB 1T5XA 2HKHL 3GI8L 3MACH 2CK0L 1JNLL 4P46B 3KLDA 2EH7L 4WI4A 1MCIA 2VZOA 4P2OD 3SCMB 4ACPA 3DO7A 2MQ0A 3I6KB 3VGFA 4UB0H 1DQQA 1EIBA 3LY6A 2FATL 3QDAA 1BREA 3O8XC 4F9PA 1GPOH 5FA4A 4WFFD 2X5PA 1DN2A 2QJDA 3ARED 3LZFH 3MRQA 4GSDL 4Y0GA 4PLNC 1YC8A 4TOYL 2IAMC 1NCWH 4ZDHB 5KVEL 1JGLL 3HAEG 4IMKA 1RULL 4YAQB 4LCWA 1FZJA 3BKYH 3LQZA 2NXYD 5LCVL 5H37H 1CIDA 3OR7B 4JZNB 2UY6A 3FZUC 2J5LC 3SE3A 5IMLA 2HT4C 4PLJD 4WHTB 3VFVA 3SKMB 4PJ8B 3DXAA 3QFDA 4YIQB 4D0DA 1A9BA 2CKBA 4NN7C 3T0EA 5J6GA 4U0RB 3OKLA 4NQTA 3PP3K 3FO2A 5GGQL 3QXAA 3SDDD 2FGZA 3HE6A 5D71H 4M6OH 5GJSH 1DZBA 1BZ7B 5DO2C 5IJKA 3MTRA 1FNGB 5F71A 1HCVA 1JTPA 2ICES 3GSXB 3QIWD 5CINH 3ZDYE 1AGFB 5DVOA 5K93A 2WP3T 4FQCL 2CLRA 1P7QD 4OFYD 2Z93A 2LVEA 2C4XA 1IC7H 4L4VA 1QRNB 3OKKA 3HE7A 3VXRA 1I4FB 3O6LH 2X4NA 4PJ7B 3BP6B 4Q7DA 1GXEA 1CLOL 3P11H 5HD8D 2D2OA 5DQJA 3AVEA 4L3EB 5SV3A 4UTBL 5TE6H 1UFUA 5CMAB 1JPGA 1PLGH 1R3LA 4K7PY 1OP3K 4BH7A 5IVNA 4EDWL 1GHFH 1SY6A 1PKOA 5E4IA 3WS3B 5HYSA 1AKJD 4LL9A 2UVEA 3VGAC 4GBXD 4HIEB 3U0WL 4Y2DB 3NFPA 3N1MC 2LV4A 4CVZA 5B4MD 5D1ZB 1P4LA 5CJ8A 1KGCD 2HTLC 3WNLA 3L5XL 2WBKA 1L6ZA 5B8CC 3RDTA 3WIHH 4JM2C 1A1MA 3EOAA 3SY0A 2DBJA 2EDXA 5HI4C 3B5GA 4LCYB 1GGCL 1LDPL 1VFMA 1JWMA 4GUPA 2NY3C 4JVUA 5I1IH 1A6ZA 3RVXC 3HRZA 1T1YA 3UPRA 4DUWA 3QEHA 5HGDB 5IVZB 3ARGB 1IEBB 5KG9B 1NCAL 1YN6B 4RGMC 5IB2A 3RIAF 5ALBH 5EZLB 3T2PA 4I3SL 3CSYA 4Y4KB 2IPUK 4O02L 4JFYA 2YPKA 3CX2A 4PJXB 3QUYA 5I1AA 1C5BL 3VGGA 2JELH 1SBSL 1RZFL 2G2RA 4JRXB 1JPSL 1KCLA 1YNKL 3BWAB 2Y5EA 1MI5D 1FNLA 1N5AB 3HPLB 3GB7A 4WV1B 4X7EC 1WBYA 4IMKC 3THML 3KJ4C 4G42A 4EUPA 3IKKA 1K4DA 4AM0B 2WWKO 3U46A 4KK6D 2EDTA 1TZIB 3MREB 4DUXA 5IJVB 2ZCHL 3CFBA 3SE3C 2V2XB 4JFHD 3BZ4B 5C09A 1KSRA 1FL5A 5DEGA 5EOCL 4M61B 4GMTL 3WNNA 1I1AD 4DN3L 3MLZL 2NMSA 3TN0B 3UTSA 2WUBL 1RU9H 2YD5A 2FZ3A 3T0EC 2VDOL 1IGFL 3IJHB 3WDIA 3NA4A 4YXLL 3QDMB 3STLB 1WQVT 1RZKC 1N2RB 1S9WB 3WO4C 1INEL 4S1DC 1CTNA 5JR1L 3RI5F 3WFBL 2VISA 1NCCL 5IJKC 3Q3GA 4QXGL 3LN9A 4WUUD 3O0RH 3GRWH 4MYWB 5B38G 1T03L 3KNBB 2YPLA 2P24A 1MNUH 5GIRB 4S11A 5TQ2H 1BF8A 4G6FB 1AXSA 2V7NA 4PLKC 3GDBA 3B9DA 3TZVB 5BCAA 1ZT7A 3EJYC 2W07A 4J8RB 2FATH 3FN9A 4JPWL 2OSLB 2VDML 1FC2D 1EFQA 4IRSA 4Z95L 3P0VH 3MLVL 4R0LA 1A4JB 3LPGA 2EE6A 5HPOA 5T33L 5IWLA 5E1AA 3WIIH 5E8PA 5FECA 3KPRD 4LLAA 4O2CB 3TYGL 2Q7NA 3EFFB 3L6FB 2W9DL 1RULH 4KI5E 3V95A 1NEZG 2VLLB 3RDTC 3QPQD 3T2NH 3L1OH 4WU5A 3D85A 3B3IB 3EOTL 2P8LA 2AJZB 4X80H 1J0IA 1JF5A 3KGRA 2EDOA 1VFOA 5CIPA 1EGJL 4HDIA 3IXTA 4PJGA 5DD0L 5EOCJ 3EDKA 5AWNL 1LE5B 4K94H 3HKFA 1YEGL 4LQ1A 1KG0B 5FGSA 1FL6A 1J1XL 3RKDD 2OXHA 3MBED 4F57L 4NSKA 4Y5VB 4XMPL 3BH9B 5E8OA 5F96H 2IANB 1G7IA 2W59A 3TBSB 3QUYC 4MB3A 5F1IA 4NPYA 3TJHC 4FQCH 2O5XL 1G84A 4YHZL 4IM8A 5DMKA 5D7SH 1RJLA 4F58H 1FO0L 3B43A 1I85A 3S37X 4G5ZH 3BVNB 2YBRA 4U6TA 2AXFB 2UV3A 1ORSB 2APBA 1MIMH 3P73B 2KBGA 3QUXA 4FP8L 5IMOA 1G9EA 1IFHL 4BQCA 5IVXF 5F7DA 4RA3A 5HGAB 3MROB 3U0WH 2EYRB 3VI4E 1A6VH 4WU7A 1IL1B 1NGZB 2NPLX 5FYJH 2WLZA 1FIGL 3RIFF 3VFGH 5IEHB 1VFAB 1BLNA 3T0XA 4CN1A 2R2HB 4NKMB 1ACYL 1MUJA 1VGEL 4LVHC 1N0XL 2GHWB 1RSFA 2FL5B 1S7TA 3LS5H 4JFFE 4N5EC 4GG8A 3MJ7A 1O5DT 4JFED 4GRWH 3VA6A 1ND0A 4U1HB 4EI6A 3TIEA 2BOBB 2A9NL 4FFWC 4HCRA 1TENA 1K6QH 5T5FL 2HFGL 4IRSC 1RK0B 4MA8H 5A3ID 1NANI 1YPZB 4CDGC 4R0LC 4XBEH 1WLHA 3MRLB 1CD8A 3KLAB 3PL6B 5C0BD 3QNYA 4XBGB 3FCTB 5IWLC 1NGYA 2A6IB 1IGTB 4NO5B 1AD9A 2N7AA 3MJ9H 5ECJE 4MNHB 5JTWA 2OZ4A 1U8NB 4QF1A 5IIEB 1KB5B 4WVRA 4E41B 3AB0B 5IQ7H 2BK8A 4TUOB 1CZ8H 1BFOA 2H32A 1HEZA 4Y2OA 3F7YA 3CC5B 4EDXA 2C3XA 6CGTA 2CKNA 3Q5TA 4UMGA 3WFDL 5FKAA 2HT2D 5GRXG 4ALAL 4NQDA 4QXWA 3ETBF 4LSPL 3VMNA 3VD5A 4ONGL 4G6MH 5HYQA 3U83A 4YHNB 5K59E 2VQ1A 3IGAB 4KROC 1YMME 3QWRD 3ZE1E 2V17L 1CGYA 3HI5L 1TTFA 5C0FA 2FEEI 3ZE0F 5JO5B 3FOMB 5CD3A 3V8CA 5E00B 5I0DA 4PRHD 1A5FH 1L0QA 2BNRA 2VQTA 2AEQH 3T4YA 1MCOL 1PX4A 3QXDB 5M7QA 5JMRA 4XP5H 2CDFA 4U6XA 4M4RA 3K1DA 2VXQL 4UT9L 5DMGC 1KIRB 5IFJB 1I85C 1X7QA 3U30B 4XWGL 1JVKA 4TPRH 1QLRB 3CFCH 4LQFH 4HWEL 4NKOA 3MUJA 4L4TE 3VWJB 1JZ4A 3HR5B 2QQKL 2G75A 2VH5H 2R9HD 4ZXBD 1VPOH 2HMID 1DBKH 1OB1A 3STZA 3QUXC 9CGTA 3JTTA 1TVDA 3WD5H 3MV7B 3OWEA 3MFFB 2P8PA 3FHAA 3LN5B 1MLBA 2W9EL 5CILH 3DX8B 5J0BA 1YEKH 4UAOB 3AU1B 4LLUB 1CLYL 3CVHL 4NRXB 4PJ5E 1HI6A 1CVRA 3U1SL 1VKXB 3QXWA 4BSWA 1JMZA 3ELAT 3DHMA 4NT6A 4POZC 4CRPA 3PGDB 3U6RB 4JVWA 3KXFD 3BXNB 4LVNB 3VXME 4JHBA 3U7WL 1JRHL 5IK3A 5BRZA 1J1XH 3RAJL 1X5YA 1T2QH 5SWSD 4PY7B 3RWDA 1S9YA 5EO0B 1AH1A 3BO8A 5C3TA 5JLZA 4OLWH 3MNWB 4E42A 5E9DB 5I1EH 1BIIA 1EUTA 5GGTL 2XQYG 3HC0B 3X13A 2PW2A 2VXVH 5BS0E 4NM8H 4JG0H 4XHJC 2F53B 3FT2A 4MJIE 2JK5A 5DHXB 4LFHD 3VD9A 1CU4L 1UEYA 1IEHA 3VW3H 1LP9E 1PZUB 2XWBA 4P2OA 4BFBD 3GJEA 3EYUH 3K0WA 2EDYA 2EXYD 3MRGB 5JA8B 3O2WL 4K94C 3DV6A 5D93C 3P3YA 4ZUTA 2A74A 3IVKB 2Y72A 3GMQB 4ONFH 1M1SA 5JDSB 1ONQB 3CSBA 4JY4A 5IEKB 3GSRB 3MSPA 4XVTH 3IAPA 1P7KA 5DQ9A 3LB6D 1XF2A 1S9XB 1TQCB 3GSUA 1NBYA 5DHVA 1B4JL 2NW3B 3GJFK 4XCYB 5I8EB 3E2HC 1YEHL 3I02A 32C2A 4J3TA 4QHUB 1DUZB 4OI9A 1BAFH 4PG2A 3QZWB 2DWDB 5C0CE 1PFCA 4XNZB 5I2IB 4OM1L 1MLCB 4AIXA 4P23B 1LO3L 4JLRA 1A6PA 5E6IB 2FX7L 2KZ1B 4KRPB 2QKIA 4OUUB 5L0QB 2AV1B 4MD4B 3OKDA 4FS0A 4P2YA 3L3JA 4YFDB 1E28A 4AL8H 1IVLA 4ORGA 4XCEA 3HAEA 3CH1A 3SDDA 3KPPB 2Y9RT 4FFYL 4LKXA 5TDNB 5A16B 3V6OA 3QIWA 4HIJA 1QACA 1CFTA 3O45A 5ILTL 4U1JB 4J6RH 2XKUA 2DL9A 4GW4A 4HWUA 4U1SB 1P7QA 2PYEE 2EEAA 3MXWH 5DD1L 4WWKB 2BY2A 4OCWL 3SDAB 4Y4FD 4ALAH 3KLHC 1RJYB 2AJYL 1X5AA 2FX9L 1AGBB 4Z76B 5E94A 4JDVB 4N0YH 4P59L 2X4UB 4JQXA 5F6HI 2V9TA 1I3VA 4P2RD 4TNVF 4HBCL 4KAQL 1DN0A 5HBBA 1KNOB 1OHQA 1H8OA 1UQSB 1WJ3A 1YYLL 3W39B 4NQCA 1HXMA 1UJ3C 3HI6L 4O51A 1AKJA 1RVFH 4RBPH 4GBXA 1QLEH 4F7EB 3VCLA 1A1OA 3QCUH 4WFHD 1U95A 2V2WA 4FTVE 5IROC 2H8PB 1RUQL 3BGMB 1F6AB 1EEQA 1WCBB 3CFDB 1KTLA 1NC2B 5IB3B 4JO2H 5HGHB 1FBIL 2QQKH 4H0HB 2D9QB 2CUMA 1AXTL 4DAGL 3BX7C 2XTJB 3FFCD 2ZKHL 2NX5D 3C2AH 3O2DA 2XPGB 2V5TA 1BQHG 4M62H 1KEGL 5BZDA 2BC4B 1R0AL 3AXLA 4IJ3C 1T1XA 5C9JA 1W72B 4BZ1H 4TVPH 4HPOL 1A7RH 4RFOL 3UYPA 3DV4B 2CGRH 3X3FL 2EYTA 4UIKL 2X44D 1BZ9B 3T09A 2WBJB 1MH5A 5T3XH 4PG2C 3BW9A 2VAAA 3TBYA 3CVIH 1HHIB 2XACC 2YK1H 4QHKI 5DFTA 3U7AA 3VFTA 3VFNA 3G5YA 4Z78A 2W60A 1REIA 4U1GC 3VDBA 1HQRA 3PWVB 1ZLUK 3TVMB 1WSST 5SV4A 1C5DB 4Z7NF 4MWFA 1KPUB 1I1AA 5HHOE 4QOKD 2NY2C 1QR1B 4W70A 5DK0B 2NQCA 4MA1C 2VWEC 2X9YA 3DTXB 4JCMA 5AZ2L 1FNSH 1LK2A 5HHME 5IVXA 5D8JH 1NAML 3GO1H 4OF6A 1VHPA 5JW3H 2COQA 3BPLC 1ES0B 3SDDC 2BRQA 5BV7C 1EK3A 1LEKA 2BVYA 4AIZA 1PQZB 5ELIA 1U8HA 3V6OC 3QIWC 3MLYL 5DQDL 1CDGA 5J06A 3CH8A 4RAVB 1JWSB 4O58H 1S5HA 3HNVH 5DMYA 1J88A 4U6HB 5EUOF 1VA9A 5C0DB 4L9LA 2Z8WC 2DQHH 3QEUA 4OZ4A 4W68A 5DJCA 4Q6YA 1NCDL 3O8XB 5CUSL 4PREA 5HD8C 1ZLWK 4DEPB 5JNYA 2YKLH 3PABB 2X41A 1X9QA 3SGKC 2A77H 5E2UH 3NCMA 1NCBH 3U0PA 3QJHB 4ZTPL 3O11A 3VXTA 2Q76A 3ARVA 1FZKB 2LE9A 2GTWA 2IAMB 4O00A 3VA2C 4FQJH 4RZCB 4GBXC 5B38A 2QQLL 2Z0BA 1W0YT 3J7HA 1YEHH 5ITFA 1K2DB 3FO0L 2HTKD 1MF2L 2EEBA 3ZLQC 1QLFB 4PJDA 2IBZX 1CDBA 3OGOE 4FZEH 4Y88A 4P9HL 4I3GA 1I8LC 4ODWB 2KZWA 5I1DB 1U8JA 3DUUA 1ZGLP 1UM5H 2J5LB 1PY4A 3CSPA 1MFDL 1RZKL 3VG9B 3MUZ1 3HI1B 3VU2A 4J1UB 1BBDH 5JUEH 4PRAB 5I75B 1TVBA 2Q3ZA 3V9FA 2DS4A 2E6PA 3MBEA 3GUTB 3K81A 4YXKL 1T21A 2CIKA 2Z8RA 5MEND 3TT3H 5AZEL 3L5WA 4TVPE 1AIFB 4XVSL 2FJHB 4NFCA 4HFUH 2DQTL 2FJFB 4U1IB 2DYPD 3QO0A 4HUVB 1I7TA 4Y1AD 5LGHL 2VDNL 1JK8B 1BVZA 1NGXB 1TZGH 1WUNT 2J8UE 5IG7A 5DS8A 1S9VB 3BZFA 1H3PL 2FSEB 1A6UL 4M6ML 4IHOB 4QRSB 3RHWK 4MB5A 1KYOJ 3NH7H 3MLWL 3MZGB 2AJYH 2H3NA 1SY6L 3VXNA 4PLOB 3HMWH 3O41B 4ELME 5KS9A 2AI0L 2XZZA 4BUGA 5FCUH 2BSSA 4QO1A 4PJFB 3RUGE 3SKNA 4PJAE 2G60H 1G9NH 4JFZH 3MRRA 4XX1E 4Z8FL 3UAJD 1QKZH 2VABA 4OQTL 4X4MA 7CGTA 5EORL 4M02A 5DMJB 4G9FB 3VGAB 4LLDA 4NWUH 2VN4A 5KSBE 4PP2A 3RWIB 1R5IB 4I2XE 4KVCL 5B8CB 4U1KA 4JM2B 5JXAH 1QEWB 4LPWA 5F9JB 4M4PA 1T5XB 2DD8H 4XC3H 1P5VA 1VESA 5C0GA 1LNUB 2NY3B 2R8SL 3FTGB 4HK0B 3DX7A 2K1MA 3NIDF 1OGTA 2XXMB 2NYYD 3ZSSA 3FQNA 2OQJA 4L9LC 4YGVB 2EDRA 4RGMB 5FUZH 4JFEA 1YA5A 1DQQB 4NJ9H 2XV6B 3PHQA 5B3JE 3T1WA 5FO9B 1Q9WA 2ZUWA 3DIFA 3V7AE 2I07A 1TJIL 4JO4L 2HA1A 4GQPH 1OPGH 1IGMH 3TPUA 1BWWA 1HHGB 4GXVL 4OLEA 4P2CG 2ZSWB 4M43L 5FO8B 5DJXA 3V6FB 5EBWA 5C0BA 1RPQA 1WBZB 4WGWB 3I50H 1PZ5B 4X9IA 4K55A 4OLVL 1T7YA 2G9HA 5D7JC 3G6JA 2GCYA 3KJ4B 5C0EA 4XNXL 1IT9H 1J10A 5TH2A 3EYFB 1PKQE 1X5FA 5E99L 5DHYA 4PUBH 3CXDL 4F15B 5IMLB 4OZIE 2ARJQ 3UP1A 4WO4A 2HG5A 4D0DB 2ZZUT 1UEMA 5LQBH 3QWQB 5IB5A 3PWLA 2AJ3A 3BRFA 4H1LG 4OZHF 1SHMA 3GMOA 3OKLB 2ZSVA 3RKDC 3AC0A 1DLHA 3MBEC 3FO2B 1G9MH 3QPXL 3WO4B 5I17A 1BJ1J 2Q8BH 1NAMH 1ZSDB 5E8NB 3QWRA 3LRSA 4P48A 2AJSL 1ADQH 1YDPB 2HLFD 4LSRL 3GIZL 4PRHA 1L4IA 2YZ8A 5ESQB 4Z7OF 1MFCH 4MS8C 2OJEB 3MLSH 4PTUA 4M00A 3PNWA 1LE9A 3ZTJG 1QBML 2H1PH 4L4VB 3KPSA 4MNQD 3OKKB 2X42A 4HUWB 5IM7B 2X4NB 4ODVH 2EKJA 2EDLA 1KBGH 3A6BL 4I13B 3U48A 4YXHH 4ZXBA 1CXKA 5HYIA 1XGYH 4GG6B 4ZUSA 4LVOB 4RBPK 3OJVC 2UYLA 4PJEA 3MJ8A 5ISZE 2UZYB 1KFAL 1T1WA 2WINA 4C55A 4JRYA 3NPZB 3RZWA 5EZJA 1P4LB 4KU1A 1F42A 3ULSA 3LPFA 4UILH 3EOAB 3SY0B 1S7XB 43C9B 3O3BA 2CO7B 2ZJSL 1I1FA 5I1LA 2ESVE 3QEGH 2A6KB 2GAZA 2BSRA 1A6ZB 2E27L 3HG1E 3HRZB 1T1YB 2AJXL 3OHXA 4P5MA 4B7IA 5CJ5A 1JZ2A 3UPRB 2HFFB 1Q0YH 2XG5A 3QEHB 3KXFA 4WW2C 1DBAL 3PWPA 3K4ZA 2WAHA 1AR1D 4DFHA 2VLRD 4ZMAT 4G8EA 4PJBF 2D7QA 3FQXB 2GUOA 5SWSA 3BEWB 5C2BL 4FNLH 4WY7H 1G7HA 5CSGA 4U6YA 3WHXA 2NZIA 4KGLA 3OR6A 2NY1D 2YPKB 3QDGE 3QUYB 3QCVL 4K8RH 4X6BA 5DFWH 5EO1B 3GKWL 4KY1H 1UZ8A 4JREC 4G9DA 3TNMA 4YE4L 4U6VL 3MV9B 2IFFH 2Z91B 5C9KA 4NHCL 2RHEA 3QWOB 4JKPH 1S3KH 1X5JA 2FO1A 1TQBB 4G42B 4LU5H 4I8DA 4W6WB 5E08H 2VLME 3GSWA 1YMHA 3C60D 3JV6A 1OGAE 2AI0H 3LIZL 1X5KA 1Q0XL 1H15B 4Z8FH 5C09B 1MFEL 3QO1A 4YQXH 2PETA 4OQTH 4QTHA 4WO4C 5IW1B 1IAOB 3TA3B 3UTSB 3VJ6A 4KPHL 3MRJA 3U4EA 1NCNA 1HXYA 4G8GA 2Q8AL 4JFDE 1C16B 3U4BH 5FOBA 4QNPF 2D03L 5AAWA 2VISB 4GW5A 1AGCA 3Q3GB 3GM8A 2J4WL 1ADQA 4XP4H 2DIJA 2PTUA 3L5HA 1WAAA 3HFML 1KLUA 1DSFL 4H26B 4LVHB 4HCRL 5MEOA 5T1MA 4BSJA 2YPLB 1HHKB 2FX8H 2V7NB 3TV3L 1A7NL 1W2KT 4KDVA 3S88H 5BXFA 2GIYA 1BQLH 4LCUA 3MMEA 3SGEH 1TJIH 1WWBX 2OZ4L 4Y8AA 4L3AA 3MYJB 1G9NC 4X9GA 1RZJL 4UBDD 5T3ZL 3FRUB 2DWEB 3SOBL 4AY0A 2O61A 4KUCD 4Y4HD 2VXUL 4D9LH 5E1AB 1QYGL 2X70B 3BRDA 5TGBA 4CW1A 1MHEA 3MLPA 1TCMA 4FZ8H 2X6MA 3L3DB 1J11A 3JV5A 4XNMB 4PJHF 3T3ME 5DMIH 2K9UA 2P8LB 1YEDA 3VGBA 4TNWK 2MJWA 2OLDA 3FHQA 4TQEH 4PJGB 4OD1L 3V4VH 1TJHL 1HH9A 3UO1H 3WFHA 5CJQL 3C87A 1NBVH 1MRDL 2J3SA 2SEBA 5CHNA 4KROB 1U3ZA 1VEOA 4HT1L 2EDHA 3TYFA 3G5VA 4RWHA 3VXRE 2OTUA 4J4PD 1LEIB 1K8IB 4KK9D 3VFUB 1X5IA 4K7FA 5E8OB 5I6XC 3TFKD 1U3YA 5MHSE 1VGKA 2FRGP 4NPYB 4J3WA 2AGJH 3TT1L 1C08B 2Q86A 2CXKA 4NQED 5I16A 3MRFA 3TC9A 4J12A 4D0CB 3MRBB 2B2XL 5MEQA 1EO7A 5C0AD 4I4WB 1E27A 5KSAD 3AS0A 2PO6D 3WS6A 3P0YH 3RZCB 35C8L 4GKNA 2J88H 4YFEA 4OJFL 5CEZL 2PR4L 4S0SD 4Z7UE 3H7BA 2WV3A 3IU4L 4UQ2B 5FUCE 4EKXA 4PP1C 1N0LA 5JPNB 3V4PH 3QUXB 1KCUL 2VJXA 5HPMA 5JQ6H 3FFCA 5F7DB 3LKRA 1MCNA 1T7XA 2NX5A 4F7PB 3FAWA 3NFSH 4DVRH 1EJOL 1U3JA 2HWZL 3F6LA 1VEPA 2IGFL 3FMGL 4QYOB 1N8ZB 2VDRH 2R1WA 1G9MC 2R0KH 5D7LA 1FORL 1CXFA 3DVGA 3D2UA 5BJTA 15C8H 4KHXH 2VLKB 5BW7A 2NY4C 3OZ9L 5E24E 3MOBL 2XN9D 2VXSL 4TRPH 2AAVA 1MCFA 3NN8B 4PG9B 1UZ6F 1MJ8L 4X6DF 1J18A 4NBXB 2CIIB 3OJDA 4GQ9L 3UDWA 4NRYA 1S7TB 3CLFH 3EUUA 1C12A 3BD4A 4QRRD 1DBAH 4KDTA 4OCSH 1ND0B 1CYGA 1BQHA 4JZOA 2RJMA 2PCPB 2HN7A 1YJDL 5L88H 4KJQC 3EO1B 5LXGL 5H94A 1ZGLM 4KUCF 5F9OL 3M07A 3I85A 2X09A 4QOKA 3QNYB 2H9GB 4LSSH 1NJ9A 1NGYB 4HUUA 5F3HB 1F8TH 2B0SH 4P5TD 1KC5L 1ZA6A 4RGND 2DM2A 3UZQA 3MLUL 1U8OA 4HLJA 1VENA 1F13A 1HEZB 3F7YB 3QDHA 1FYTD 2YXMA 3MLRH 1MFEH 1JV5A 5IB4A 3ET9F 4KJPC 5K9OB 1JN6A 1Y18A 5FUOH 1KLGA 5AG9A 2FO4B 4EOWL 4PJIF 43CAA 4JJ5A 4OZGF 4KQ3L 5C0FB 2NTFA 1MCPH 3TO2A 4R6UA 2D31A 4OFVA 3VFMB 1BFTA 4NUGL 4S2SA 1KYOK 4KUZH 4K8RC 5CBEB 3E2HB 5B21A 3HFMH 1EHLL 1LO2L 1U8KA 2CDFB 1JPFA 4U6XB 5EBGA 1DDHB 5HDBE 5I71C 3VD4A 2FEEL 2DIAA 5CFHA 5ID0A 1GAFL 5DVMA 3IB4A 2V7HB 3D1MC 4HJJH 4YDIH 4OTXL 2YC1A 4NKOB 3EHBC 1GGYA 1QVOB 5I30L 5K9JL 1UB6A 5J9PA 3MRHA 3S34H 4TSBL 3LEYH 2ZUSA 4P46D 1XCQB 1ZLSH 5BV7L 2EC9U 1WZ1H 5A2KH 4K71B 2AJUH 3SCMD 1MLBB 4MJ2A 2FLBT 4N0UE 1QYGH 3PJSB 5I19L 3NOIA 4BM7A 3KYKL 5BW7C 3S36X 2CSPA 3UROR 3QXUA 1HH6A 4Y1AA 3NAAL 1HI6B 4JFXA 2HJLA 1MWAH 4QLRA 2AQ3A 3UDWC 1ZWIB 2N7BA 1ZS8A 5EIVA 3IDJA 5CBAA 4ZPVB 4R26H 4H8WH 4OD2B 4H1LH 4GRWB 2NNAB 3ZDZF 4JAMB 1I8MB 2XA8H 3WLBA 4LLQA 4M1CD 25C8H 4OV5A 4KKBD 1GRWA 5CWSA 4B7LA 1FPTH 2GSIB 2B1HL 3BO8B 1UJ3B 4GAGH 5JLZB 3HZMA 4WJ5B 4PJ8D 4IRZL 5D6CB 4O9HH 2C4FT 3ZTJH 3X13B 2R2BB 4P57A 1KCRH 5L7XH 4RGOL 2ZCLL 2Q3AA 3NABL 4RSVA 3RA7L 4AG4H 4JANA 3LV3B 2JK5B 3HZKA 4LEOA 1I9IH 3STBA 3F58L 4ZFOB 4TULH 5KVDL 4UDUB 3RTQA 4UDTB 3REVA 3O2DL 4OJFH 5HDQL 3A6CL 4JR9L 4PD4J 5EULV 2RGSA 3QA3A 4MJIB 3UZVB 2GJ6B 4OSUH 3BSZH 2DQUH 4V1DA 4N0FB 2Z8VC 1KEMH 5DWUH 4UV7L 2XIDA 1LP9B 1JF6A 2CMRH 1AE6L 2A74B 1XGPB 1QRND 2BDNH 3HLAA 2HWZH 4AENA 5DC9B 3FMGH 1IAKA 3DNKA 4JY4B 3S96B 1LQSR 3FQTA 4IJ3B 4TUKL 4PJBA 1P7KB 4L3ED 1XF2B 3IETB 3MOAH 3DOSA 4NNXB 3W2DH 1CFQA 2JCCF 3I6LE 2AK4E 1V5JA 32C2B 3BN3B 3RWGB 4ODSL 1HZHH 2HTKC 5DI8B 4Y2DD 3KR3L 1I7UB 2BVPA 4P4RA 5D1ZD 1HILA 4U1GB 1BECA 4ETQA 1MQKL 4FQ1L 3RVVD 5T3ZE 4UOW0 4X6CE 5J1SC 1MCCA 2CLZB 5ERWB 4KZDL 1U42A 2E7BA 4HFWA 3G08B 2NY2B 5ESVA 2QKIB 1RZGA 1NAKL 4MA1B 2FBJL 1W0VA 3V5HA 5I1HL 3IF1A 1FGVH 3UYRL 1NLBL 1J0JA 4RFEA 3DBXA 1JI1A 1JIBA 4NQDE 3ARGD 2I60H 1ORQB 1XF5B 5EFIA 5BMFL 1A4KB 1A7PL 3BPLB 3G9VA 3JUZA 4N0CD 4F7TA 3S5LB 5GS0C 4MSWA 3CDFA 5FHAL 4LKXB 5ANME 4HIJB 4Y4KD 3UTZB 4P3CL 3O45B 4OCXL 5H35A 3MCG1 2VZUA 2ICWB 4NYLB 2BXYA 3ISWA 3DGCR 2A0LD 3L7EB 2BNRE 3JXAA 1I75A 1OSZB 5EU7E 4LPUA 1AGDB 1ZHKB 1HHHB 1JPTL 4JRXD 4PV8B 1Q9OA 4ZO7A 5GGVL 2Y7QA 4WI3A 3O3DB 1MIEL 2VC2H 1CDJA 3GMMA 3IFPA 1OAUH 1EH9A 1BQSA 4QGTA 5E4EB 4QHMB 3UAJC 1PSKH 4FA8A 3F8UB 2W65B 4NQCB 2X4RA 5D2NA 2I5YH 4M48L 3QQ4B 4OCYL 1ITCA 3ZE2F 3TN0D 4MNGB 3VRJA 3HPJB 2V2WB 4LRNH 5CEZE 2DLFL 3VDAA 4LMQI 3ME0A 5HHXL 3QDMD 4KZEH 2VB5A 1LILA 3FONB 5EU4A 1FSKB 4GKOA 1T1ZA 2N4IA 4HWBH 1R6VA 3RTQC 3VXUB 2DIBA 1D5MA 2XZAH 4FTVB 2MPAH 4FQPA 3V5KA 3P9MA 3S37L 2FWOB 1Q72H 3TJEH 1N4XL 4XBPA 1JHKL 2BCKB 4R8WH 3UTOA 4JKKA 2NYYC 1UACH 4HC1L 4L4JA 4ZD3L 4H20L 4HXAH 4PJ7F 3Q6FB 4Y16A 2VLRA 3IDGA 4G6FD 1IMHC 1TCRA 3TZVD 5I19H 4FFZL 3AXLB 5LAXA 4X4XA 5C6WH 1RURL 2HJFA 1ZOXA 3QCTL 3EDJA 1WWCA 4XMLH 4ZTOL 2VLJA 4POUB 4EVNA 2R2EA 4MXVF 4G3YH 4N8CH 2JJVA 3IJYB 4HUXA 4YBLC 4CN6A 5JQHC 1UG9A 4PY8J 5JIPA 1GGIL 3CDGA 4XNYH 1F4XH 1BOGA 1A2YA 3T0WA 1HQRB 2DQJH 3QFJA 3MRKB 4MWFB 2R29L 3PXHA 2WIIB 4XCFL 3Q1SH 2Y07L 3TNNA 4DVBA 2WK2A 2F5AL 2R0ZL 2CO6B 5F6HJ 4TUJB 1S7WA 4M5YH 4JQIL 3BPNC 5HHOB 5M94B 4BQ6A 4RGOH 3RX7A 1CBVL 3PIQA 3G6AA 2LAGB 1PG7L 4NO3A 4PJXF 4L8DA 1QSEE 4CVUA 4KFZC 5JIHA 3ULVD 3AMLA 2HLFC 4DZ8B 5CD5D 4WFFE 1WCQA 2OJZH 2IAND 1BVLB 3RL2A 4XC1H 1UWEH 3PQYE 5GRWA 3O3AB 2LTQC 4R2GC 3KPMA 4L9LB 3QEUB 1ZLVH 2XWTB 4RFNC 1M71A 4NJAH 1FFPA 3L7FB 4PGBA 1DQJA 3PV7A 2DI7A 2Z8SA 3GSNH 1YEFH 5CGTA 5AUMA 4UNVA 5HI3C 3O11B 4NHUB 4PGDA 3VXTB 4I77H 4K9EL 4DQOL 4X4YA 4S1RL 1PJ9A 2GTWB 5C08E 5SX5H 4Y4HA 5FYLH 5D7JB 5B38B 4HV8A 5ITFB 3VFOA 1QFUH 5DA4A 4PJDB 3O4LE 5C0IA 4O5LL 4GAFB 3H3BC 1KELH 5FM4A 1U8JB 3WKMH 5CCKL 2FECI 5JMOC 5MERA 1LD9B 1A14L 4KZDH 1FVDB 5HVGB 4NDMB 4Y19B 2CRMA 2X4TB 2VSCA 4QHKJ 3EOYG 5IBUG 4R7NA 2Q20A 5FYKD 3VWKB 1JZ3A 1AR1C 2AEPH 1RUMH 4K7PX 4Y16C 1LVEA 2VDQL 4B0MM 3ARXA 4J4PA 1OCWL 3BN9D 3KJ6L 4M7JL 1NEZB 3TP4A 1YNLL 4LSTH 3IDYC 1AY1H 4PJIA 4OZGA 4X7DC 3BZFB 4JPVL 4NQEA 2ADGA 3PL6D 5KW9L 5L6YL 4Z0XB 4G6JL 1XF3A 5KSAA 1D5ZA 2PO6A 4KTYA 3A0OA 3OXRB 3DUSA 3E3QE 1N7ML 4NZRH 5KS9B 3WN5A 4E41D 3A67L 2BSSB 3DRQA 4RAHA 2EH8H 5F8QC 3U0TA 1J9CT 3RY4A 2VABB 4RAUB 5T1LA 4HMDA 4MXWH 4U7MA 4PJAB 1FAIL 3CFEA 4LLDB 4YH6A 3ULUD 4OCYH 3EYSH 1BMGA 1UWGH 2D7OA 2F74B 3SPVA 3MZTA 5EBMB 3ULVF 4HSQA 2AVGA 5GZOC 5IT2L 5KSBB 3GKZA 1XGRA 3ALPA 4Z0BH 2VDPL 1CGSH 2BNUA 5D96C 4B50A 1ZEAH 4OV6F 2E7MA 4F3FA 3F6IA 2XN9A 4X9HA 4C58B 3OKMB 4ZOCA 3G04B 5C0GB 3DX7B 1NUFA 3MA9L 3IKCA 5L8JB 4CJ0A 1JHKH 5ABDE 3PDGA 1S7RA 4WW2B 2F58H 4QRRA 2VITA 3DVNA 4Z7QF 6FABH 1MI5E 3G5XA 4UINL 1ZVSB 4UT7L 1OTUC 4XPFH 4WDIA 1QFWI 4OF8A 1RZ8A 3TPUB 3IFNH 4ZNEA 5FYLE 4JHZA 2K7QA 3VWJD 3BE1H 3QCTH 4FQIH 1D5XA 5D2LA 2A6DA 4LLMB 4P5TA 3MV7D 4KKCD 4OF7A 4WUKL 5L2KE 4ZNCD 3BKML 4Q0XL 2DQGL 2XTLA 5BVJA 1YY9C 1SJHA 4C56E 4M7KH 3D69A 4KMLB 5TFSH 1DR9A 1QFWH 3RWHA 2ICEA 3O6FA 5ENWA 3DURA 1HDMA 1FYTA 1IC4H 4WO4B 3WNMA 4F9LA 4WUUE 1PKQB 4PR5B 3L3KA 4YHML 1T7VA 5IB5B 4I48A 3EO9L 2KKQA 2ZSVB 2V5RA 1T7ZA 4WI7A 3JWOL 1D5IL 2EE2A 2XNAB 3RVUD 3IDUA 4HIHA 3TFKC 5DYOB 4B41A 4KRNA 1UWXK 3RQ3A 3MLTA 1F00I 3RIAK 1YEEL 4WCYL 3I9GL 3GK8L 3KPNA 4JDTH 3KPSB 5E9DD 2JCCA 1IQDA 4LLWA 5EN2B 2PO6C 2QBWA 1WISA 1OAZH 3FT3B 1CE1H 3KPRE 4KV5F 5LGKA 3RVWD 5ACZA 3WN5C 2F53D 1U3HB 5TDOA 3LSOA 5I8CB 3T08A 4ZUSB 3ULUF 1VADA 1N59A 4PJEB 1UVQB 3MJ8B 2NY5L 5HGBB 1H9VA 4U1LB 3U36B 4S1RH 2WINB 3SCMA 3X3GH 2WWKT 4JRYB 1QPXA 5IMMA 3QZWG 3ULSB 1RUKL 4PD4K 4IMLA 4PJ9C 4ONHB 4IS6B 2BRRL 4HS8L 4ERSL 4O5LH 3O3BB 1CGXA 3D9AL 5GISL 5MP6L 3EYVA 3T3PE 2A6JB 1WEJL 1F4YL 2GAZB 4X4ZA 1ZHLA 1EVTC 2AABL 3OHXB 5HHVL 3O3EB 3QIBC 5KZCB 5IB1B 3RI5K 4GO6B 3PWPB 4ZDHA 3MCLL 2ZPKL 3HG1B 3CDCA 4XVJL 1U91B 3I84A 4G8EB 1MVUB 2GUOB 2DTMH 2VDQH 3OAZK 5CZXC 1BQUA 1HINL 1QNZH 1U58B 4ZFFB 1F90H 4FQQA 4JZNA 5DF0A 5FCSH 4LNVA 3H9SA 1MFBL 4P23D 4XWOD 4WHTA 4G9DB 4QRQA 2BVQB 5E6ID 3SKMA 4DGVL 4YIQA 4KRPD 4X4ME 5FKPA 1DQML 3QISA 1HSAB 4JO1H 1XIWC 1WC7B 2H2SD 3REWB 5T1DH 5DJ2A 4WFGD 4ODHL 4Y5XA 1BZ7A 1FNGA 3O6FC 3GSXA 4KI1A 1OP5K 3QO1B 1J12A 1RAMA 4QTHB 1OGAB 4XI5C 1D7FA 3RJQB 2EDBA 3U4EB 3MRJB 1HXYB 4G8GB 4WWKD 1SM3H 3SDAD 2BY3A 5I8KH 1OTSC 3CFKB 1QRNA 2AXHA 3D0VA 2RB8A 5F7YC 1I4FA 5C1MB 3AS2A 4JY6B 2AV7B 4GW5B 4PJ7A 1TIUA 3BP6A 2DLTA 3PP4L 1MAMH 2NY4B 2VZVA 1QSVA 4XPHL 4KRMB 1E6OH 3IS1X 1A21A 1IQWH 3WSQL 1OM3L 1LK3H 2RFXB 4YHKL 1E4KA 5D5MA 3P77B 4I0PC 3WS3A 2OL3H 2OK0L 4F7CB 5DUMH 3UPCA 5TF0A 2ARJA 4HIEA 4Y2DA 4FQLL 3HN3A 3AS3A 4UT7H 4S10A 3MMEB 3EYQD 4AJ0A 1NC2D 3KPLB 3QEQB 4LCYA 3H8NA 1N5YL 5F8RC 3TBVB 4HLZH 2O61B 1DBBL 3QG7L 3SCMC 2XTJD 1NFIB 5HGDA 5IVZA 3BP4B 3ARGA 5C7XL 1IEBA 4KJYB 1P2CA 3E6FB 4HF5L 5KG9A 2F9BT 5J6HA 4FXLA 2QHRH 1JYVA 2C26A 1U2HA 2BSED 1IGJB 4H0IA 4K2UL 2UZXB 3AY4C 5EZLA 3NPSB 4Y4KA 4JPIB 4RRPA 3ARQA 1YEDB 3CU7A 5KTEH 1RZIB 2OR9L 5D7IE 4PJXA 1RQ5A 1M05A 1I8KA 4PRHE 1HIMH 1UT9A 3GBNL 4IDJL 4JRXA 4N68A 3BWAA 2DQDL 3ROOB 3WFHB 3RIFK 4HS3B 1R3IL 1N5AA 1MCLA 3HPLA 4ZSOE 1FCGA 5CHNB 4EN3B 2WBJD 4FQ2H 2UZIH 4AM0A 3K3QA 4JFPB 1TZIA 3MREA 2YD8A 5I15H 2ZUXA 5IJVA 1DBML 3TVMD 3NCYP 2V2XA 5FM5M 2IPKA 2X89D 3NACH 2Q86B 1NMAH 4M61A 5I16B 3MRFB 4MZ2A 2RCSH 5ITBL 1X3DA 5C71A 3GK8H 5IW3A 5D72L 4KMTL 5GGRA 5F1KC 1N6QL 3BWUC 3TH3T 3STLA 1QRKA 3BT2H 2L0DA 5J3HD 1N2RA 1S9WA 1D9KC 1YY8B 2IPTH 3H7BB 1AC6A 1EZVY 4Y5XC 4Z77A 3N50A 2EXWD 3V7MA 1AJ7L 4JGJA 1A7QL 5EIIB 3W0WE 3ARBA 3KHQA 2P1YA 3F65A 5AYUL 4M6NL 5ADOH 1B2WL 2A38A 3QXTA 3R0MA 4IIQA 5E1HB 2R1WB 3GMNB 4QHNB 1Z6JT 5D7LB 3NA9H 3TZVA 3D2UB 3GM0A 3O8XD 4J8RA 5BJTB 1SYSB 2OXGA 4NGHH 1QBLH 1P84J 1T3FB 1X5GA 3MODL 1X4XA 2NXZC 1OAQL 5TE4L 5D9SB 3D18A 2IG2H 1E4KC 2AABH 1A4JA 2R56L 4AMKL 3N85L 4FOMA 2IAMD 3SKOB 4NRZA 1ETZB 2QSTA 4Y2DC 2ZPKH 3MV8A 4ETYA 4O2CA 2HN7B 3QHZH 3L6FA 3JV0A 2VLLA 2HVJB 3BDYH 2NY0C 1CT8B 4PBVC 3RVVC 2FGWL 3B3IA 2AJZA 3DUHA 3FZUD 2IPUG 4WEBL 2J1KA 3BQUC 5GS2H 1DLFH 2ZCKH 2Z31B 1Z0NA 5D7KD 1ED3B 4NP4L 3WJLA 1LE5A 4YUEH 3HUJF 4M3KB 1EUUA 1KG0A 2XZQH 4L8SA 3DSFH 4N0CC 4YLQT 2ZOKB 1EEZA 4RQQA 4R97B 4LPYA 1IM9A 4LSVL 2QSCL 4MB4A 4Y5VA 5DO2D 3BH9A 1XGQA 1L7IH 3QIUC 3H42L 4K23L 2BJML 1II4E 4WTZG 2A0LC 5IB4B 4M3JA 2G5BB 4DKDC 1GIGL 3SQOL 4KTEL 4P99A 1UKQA 1SMAA 4G7VL 3SDYH 3BJ91 1UH3A 4RA0C 3T2QA 5H2BB 1W8OA 2NY7L 5KN5A 3BVNA 1MRFL 2VAJA 3TBTA 1MPAH 1ORSA 1YYML 2D0GA 1ZAGA 5BQ7A 2V6HA 3S6CA 4BQ9A 2CJUH 1U8KB 2VDKH 4OT1L 4G9FD 4PGCB 5HGAA 3QUMH 3MROA 2O93L 3SE9L 1WITA 4FABL 2HTLD 1T89A 3FB8A 5IUSA 2X4QA 4S1QH 1Z0MA 1CVSC 1IL1A 4JM2D 2JB5H 3ROLB 1UB6B 4I9WE 5HI4D 2AJVL 2GT9B 5IEHA 4AEHL 1VFAA 1GOGA 4LAQL 2NY3D 3ARBC 1NGQL 2EIBA 4DK6A 4HS6B 3U9PH 1MSPA 2FL5A 4OIIH 3UZEA 4IIQC 3O6KL 5C7XH 2QLVB 4U1HA 2BOBA 3TZVC 5EUOE 3WXWH 4OF3A 4N0UB 3EOBB 1NL0L 4NO0B 4BFEA 4P2RE 5TF1H 1RK0A 3UJTH 5I1JL 1YPZA 4YZFF 2KUTA 3EW3B 3MRLA 4IRJC 5KVGH 3PL6A 3X11B 4XBGA 2WQ8A 2A6IA 1IGTA 4NO5A 5LBSH 5CBAB 3CSGA 3R1GL 4OM0H 4MNHA 3U2SB 1U8NA 5EWIL 1LO4H 4WFHE 5IIEA 4PB9H 4YHOH 1CFBA 4LLQB 1KB5A 4K3EL 3WO3B 1OQOA 4PFEA 5DVLA 2QR0B 3V0WL 4JY5L 1P1ZA 4MD0B 3ZT5A 2DQCH 3IXAA 2A1WL 1J8HE 3CC5A 1X4ZA 4NZTL 5E7FA 3HZMB 2HLAB 5EU3A 3F5WB 4M93C 3S3JA 3HRPA 3WJLC 3FFCE 5JHLL 4JRWA 1H0DA 4AT6B 4L8SC 5IHUL 4JANB 3INUL 4LEOB 4YHNA 5I1GL 4S1DD 3IGAA 3BPOB 3RTQB 3REVB 4X98A 4XCCL 2DB8A 2F5BL 4MLSA 4NCDA 3SGJC 4RMQA 1HNFA 1KJ2H 1RIHL 5ESAB 5JO5A 3FOMA 4M5ZL 5E00A 1EAPB 1BGXH 4RDQG 1IKNA 3QXDA 4V1DB 4QTIH 3WL9B 3LRGA 4FQXD 1E6JL 4L4VD 5E2VH 2Q7YB 3RJDA 1FJ1B 5IFJA 1CXLA 2EZ0C 4PJFF 3EDFA 3ES6B 4O4YH 3EJYD 1QLRA 3FQTB 5ALCL 4DW2H 3S4SB 1CICA 3BRGC 1G6RH 1NMCB 4OLXH 2E6JA 3VWJA 3LHPL 3HR5A 1WK0A 4FQHB 2JLLA 1JTOA 3GNMH 3JZ7A 4RWYH 4P49A 5I9QC 2E7LA 5JPMB 3MV7A 4KVNH 4QOKE 4BZ2H 5I66B 2Z9TA 4TNVK 1YQVH 3SDCB 3MFFA 4YBLB 4JM2F 2PTTB 3LN5A 2AK1L 3QUMA 4YHIB 4WWID 3DX8A 4MCZB 4P4RB 2AK4B 3UTTA 1T89C 4NKIL 2OMNA 1ZVHA 3AU1A 4LLUA 5GJTH 3DGGB 1KN4L 5GRVL 4OD3L 2J6EL 2JJTC 3BD3A 4KTDH 3DVIA 4JHAH 4HFWB 4NRXA 3KWWB 4NM4H 4A6YH 1L7TL 5ESVB 4FXGA 4U33A 1LO5A 2B1AL 5E95B 1RIVH 3V0VA 1IAIH 5C70A 3V5HB 4X6CB 3BD5A 1JNNH 1J1OH 2PXYB 3PGDA 2YEZB 3U6RA 3BPNB 3BKCH 3SE8L 2PKDA 4FMKA 3NIDE 2ITCB 2R0LL 3ZSTA 3BN9C 5H37G 1GZPB 4PY7A 1IEAB 4LSUH 2I27N 4DN4H 1IAIM 4X6FB 5EO0A 3QUYD 5EU6A 2BJMH 5ANMB 1WFNA 4PRIB 2VTFA 4R2GB 4XNQB 1FVEB 1MWAB 5I1CL 4L8BA 3IYLW 3MNWA 5E9DA 5IGXL 3MV9D 1I8IB 1Q9OB 4RFNB 2Y7QB 4H1LB 1QBAA 5DZLA 2JJUA 3MUGA 3QP3A 2F53A 4LPVA 3GI9L 3LH2H 3V4UL 1S78C 4XPTL 3FRPG 3B9VA 2ITDB 4MQ7B 3S35H 4YWGL 1IKFL 1U6AH 2X4RB 4CAGA 1YYMH 3FQWB 5KJRL 5C09D 4O2EA 1YEIL 4GMSL 2HAZA 4YC2C 4ZQKA 3TA3D 3UTSD 4F37F 3MRGA 3MFGB 4JCLA 3LEXB 4LASH 4BK5A 4ZODA 4NZUL 3SE9H 3IVKA 5EU4B 3MC0A 1KENH 3IU3A 4XXDA 5MENE 5JDSA 1ONQA 4MD5B 2IH1B 5A43C 5IEKA 2J7LA 2ADFH 3GSRA 4OLYH 4OZHE 4X7SH 3I3BA 1KJ2A 1ACZA 1S9XA 5DRXA 3HNTL 4PJCA 3QUKA 4XBPB 4Y1AE 3ZDYF 4P9MH 2NW3A 4P2QE 4YBHA 1IKNC 4XCYA 1BD2B 2YPLD 5IMKA 4Y16B 4QHUA 1DUZA 4ZFGL 3K4AA 4JE4B 1A6WL 2Y25A 3U30C 3QZWA 2DWDA 4WHDA 3CMGA 1A3QA 1TCRB 4GG6F 3TESA 4DGYL 4FFWD 4YK4C 4X4XB 1CICC 5I2IA 1G6RA 1KTKE 3CLEL 3VWJC 1MLCA 2IC2A 4P23A 4XP1L 1IC5L 4JM4L 5E6IA 2VLJB 1NFDA 5I74B 2P43B 1DQLH 1ZT4B 1A6TB 2E7LC 1QSFA 1CIUA 5I8OH 5SWQB 1RMFL 2AV1A 4MD4A 4AQOA 4HUXB 2LVCA 3OG4B 3R1GH 2Y06L 4G80B 5EWIH 1KPVB 3T2OA 5HDOA 4UAOC 1BOGB 3KPPA 1KXVC 2W92A 1YNTB 3PP3H 3QFJB 1J05B 5TDNA 2AKRB 2VE6B 1MY5A 4U1JA 4NNYB 4XH2B 1NMBH 4U1SA 4A6YA 3QHFH 4L1HA 5C0ND 4WWKA 4D94A 4MCYB 3IFOA 5A2LH 1RJYA 1FDLH 1TXKA 3I6GA 3PIQB 3G6AB 3V2AR 4KROD 3RVUC 1WT5A 2X4UA 2D7TH 1DBJL 2YRPA 1Z9MA 5GQBA 5IHZA 2O5YH 2Y36L 4PJBE 4NQVB 1KNOA 2HYMA 4CU6A 1QSEB 1HOCB 4YDVA 3W39A 4CBPA 4LSDA 4EI5A 1OP3H 3KPMB 4LKCB 2CDEA 4UTAH 5BO1L 1CD1B 2P5EA 3PQYB 1VEMA 1F4WH 2H8PA 4ZOAA 3BGMA 1DQJB 3RZCD 1F6AA 2JF1A 3EBAA 3L3GB 4XNUH 3CFDA 2V2TB 3D39A 1NC2A 4YDJB 5IB3A 1T22B 1EERB 4LAJH 2HFEB 3SJVE 5HGHA 2EIDA 1BF2A 3KYNB 3UTPD 1TJGL 3KS0J 3AUVA 2HH0H 5AAMA 4X4YB 3QUXD 5ETUB 5JW4R 4M7LH 5F7HA 5LVEA 1NUGA 4OCRH 3LKSB 5C08B 3PWUB 2NY6C 2X05A 4F8QA 5CEXA 2AEIT 2E8YA 4F2MB 2BC4A 3WHE1 5EC1A 1W8NA 2VLKD 3O4LB 5KOVC 1MREH 4QNPE 5LGJB 5I0ZA 1W72A 2V9QA 1TQCC 1V3KA 3NCJL 4POZD 3DV4A 2FEDD 3R06B 3LEVL 2KDGA 4XAWH 1IGCH 5DZOA 1K85A 2R69L 1U8PB 2DBLH 4MNQE 1BZ9A 1P84K 3C09C 1J7VR 1EHNA 3IDMB 1HHIA 5FV2A 2VZTA 3EZ8A 3MBXH 4XNZC 5FOJA 5B39B 1A7BA 2OYPA 4OFIA 1C5DA 2X89A 2BVUA 1KPUA 1FNHA 1QR1A 3S36L 4M1GH 2FCBA 2BX5A 5D2NE 5DK0A 2B4CH 3H9YA 1U0QA 1J1PL 1K3IA 1AI1L 1X4YA 3DUSB 3DTXA 4DOHB 4XHJD 3WN5B 2FR4B 1ES0A 5EH1A 3U0TB 2J12B 1JZ7A 2YA1A 4PJGF 2E9IA 5T1LB 4YWGH 1VSCA 4PJHE 1JWSA 4WI6A 3CFEB 3ZL4H 3FN0H 5E2TL 2QL1A 4WWKC 1Q1JL 4U6HA 1P4BL 1EX0A 4UZGA 4MA7L 3HCVB 1A02N 4PJ9B 4QRPA 4CUCA 1CXEA 2VLRE 1T2JA 3GMPB 4HEPG 1WT5C 2BNUB 3KHOA 3D25A 3KPOA 3PABA 4ODTL 1V7MH 3UBXB 2UUDK 1F58H 3QJHA 4Q97A 3QIBB 1AFVH 2HRPH 1IZJA 3PE9A 4W81A 1UCBH 1FZKA 1C7TA 1MOEA 3H0TB 4EI5C 1CFVH 2IAMA 4RZCA 4KQ4H 2APTA 3DVNB 1DQDL 1CTOA 1SEQL 1CL7I 3MQIA 4GW1B 3AGVA 1K2DA 5T5NG 1E4XL 1KACB 3MLXL 3ILPB 3T1FB 3UYOD 3ARYA 4ODWA 5I1DA 3GSNB 1PDKA 5FF6B 5D2LB 2VZSA 4NOBA 3C5JA 4XP1H 2A6DB 1O0VA 2IJ0C 3HI1A 5I73B 4NNPL 1A6AB 4J1UA 1XIWB 1RMFH 4PRAA 3EO0B 8CGTA 3GUTA 2BFVH 3L5JA 4ZS7L 4MX7B 1SJHB 3VI4F 2E9JA 2XKNB 3D69B 3P4NB 3RWHB 1AIFA 1RZ7L 1QTYT 3O6FB 2FJHA 1D6VL 5FYJD 5L2KB 1IBGH 4G7YL 2F54E 1HDMB 5JHDB 3MX0A 1H3GA 1JK8A 4NBZB 4U3XA 1NGXA 4C56B 2ILLA 4BSVB 4IHOA 4I48B 4QRSA 2OR7A 4XMKL 2DQIL 2AS5M 1UZ6E 4X6DE 4OBRA 5ICZA 4YHYC 1CF8H 4MAYC 2V9RA 1DANT 4JB9H 4KKNA 4L5FL 5GGRY 3SKJH 5DEZA 4DUVA 5FFLA 4I0PB 1XR9B 1DL7L 4WTZA 5DZNA 5GS3A 3ZO0A 3KPNB 4YDLC 3EGSB 4OGXL 3RWIA 1IQDB 2XZCH 3T4AB 1FZMA 1R5IA 3ZDXF 4NC1C 1MHHB 1CGUA 5B8CA 1QEWA 1GC1H 2W0LA 1PBYA 1FRGH 5F9JA 2IQ9H 2EXWC 4PS4L 1UM6H 1N59B 5GHWL 5EB9A 5FB8A 4HGMA 4MJID 1LNUA 4HIIB 2DI8A 3FTGA 4HK0A 1KTDB 5C07E 2MQ3A 2GJ6D 3TCXA 3MV01 3TIDA 4XPGH 1G7MA 5IMMB 4YGVA 4IMLB 3F7VB 1QPPA 2R4SL 4D9QD 2I9TB 5FO9A 3IFLH 2X10A 4LMQE 1BFVL 1QG3A 3N9GL 2VXTH 1BM3L 3EYVB 4DEPC 3VD7A 1XF1A 5KVFL 4JN2B 1HHGA 1ZHLB 3V6BR 2Y4SA 2ZSWA 5FO8A 1IRAY 4PJIE 3V6FA 4N9GA 1MJ7L 1U36A 1WBZA 1PZ5A 3LMJL 5LG1A 3LEVH 1CLZH 3NIFF 2DJ4A 3ARRA 3QUZA 3G6DL 5C0AE 3S5LG 3CZJA 1XGTA 5JW5B 3EYFA 4CADB 1P4IH 3MRIB 2BMKA 1G1CA 2FHBA 4JHWL 4U3CA 3SDXE 4FQQB 1G7LB 1DEEB 3H9SB 3BHBB 4GRMB 3VG9C 4QRQB 3T04D 3NZHL 4ZUUA 1KJVB 4XVUC 4UV4L 1C5CL 2NY2D 5FKPB 5DUPL 1Z2KA 1JUFB 4HPYL 5DD6B 5CJXA 3BP5B 1MCKA 1J1PH 5I75C 4WHYG 5DJ2B 5IESL 1DJSA 1T7WA 1HKLH 3C5ZA 1ZSDA 5E8NA 1D9KB 2YN3A 1T20A 3WUWG 4Y5XB 2A9MH 5INCA 1YDPA 2WLYA 2MCPL 2FIKB 3RNQB 5ESQA 2MKWA 2OJEA 2EDEA 1XMWA 4K3DL 4GRWF 4FQXA 1SYVB 4N1CA 3BZEA 3CPLB 1XF4B 4HUWA 3D0VB 4QRRE 4ZO8A 5IM7A 4H0GA 5E8DL 3ARFA 5EZOL 4P4KA 3RPKA 2VMFA 4APQC 1V7NH 1B6UA 3UJJH 4GH7B 2NXZB 4GG6A 2GSGA 3LS4H 4M03A 5D5MB 1JGEB 1OL0A 2Q6WB 3LQAH 1B9ZA 4NQCD 1A0QL 5I1KH 2VL5B 1KIPB 3I2CH 1RIUL 2ARJB 5J1TC 4JJHA 4TTGA 3RU8H 4QXTB 4EXKA 3KG5A 1E4XH 4RGNE 3U7YH 4LPTA 3BI9X 2NY0B 3MLXH 1S7XA 43C9A 4IEFB 4GAYA 3VXUD 4JG1H 3CK0H 4PGEB 1Q94B 1CGWA 4FTVD 4WRLA 3BQUB 2A6KA 2EDWA 1Z3GH 4QCIB 2R2CA 1LP9F 2HFFA 2M26A 5IFHH 3ULVL 1WBXB 5FHBL 3GSQA 5L2JB 1P2CB 1MRCL 3ZHKA 4WI9A 4U1MB 5J6HB 4QHLA 1BEYL 3FQXA 1O7SA 3BEWA 5GRVK 1TPXB 1U8IB 5GRJL 1JZ6A 2Y1VA 3QIUB 3FO9B 2CRZA 1M05B 1I8KB 5EO1A 1M4KA 3QQNA 4LGSB 2H26B 2MQCA 3MV9A 3V0AC 1E0OB 2Z91A 5D7IB 3SKUD 3FL7A 3QWOA 5DT1H 3QUZC 4KXZH 5TE7L 2JCCE 1NSNL 1CXHA 1L6XA 3VGEA 4MAUH 1JHTB 3PWJA 2H41A 4V2CB 4J3UA 4K7PL 5HVHB 4L9DA 4DKFL 3GBML 4F15C 1H15A 2IPKB 1DFBL 3JWDC 3C08H 5IW1A 3BZDA 1IAOA 1CDUA 4PRPE 1RUAL 3TA3A 1XAUA 5CJXC 5GGRB 1C16A 5C0RL 1T04A 5HHOD 5L9DH 3C5ZC 2CQVA 5FYKL 3HMXH 1U93A 2FBOJ 4Z77B 4I5BB 2XQBL 4AEFA 1IZKA 2GQHA 4E5XB 5HYJE 3FRPA 1TDQA 3M8OH 2HKHH 3GI8H 3QDJB 1ZANL 2CK0H 1JNLH 2OX5A 3ARBB 4H26A 2EH7H 4D2NA 2WMPA 4FQXC 4J3VA 3MRCB 4IIQB 1HHKA 3GJFH 3MCKA 3W0WB 1AQKL 1J5OL 4XGZB 4D9RD 1HSBB 4GT7A 3ARFC 4P4KC 4HKBB 4RMUA 4KGJA 2GJZB 2XXCB 3MYJA 1QZ1A 4GSDH 3D18B 1KB5L 3Q6GL 4HAGA 4LVOC 5J57B 3C6LA 4IRJB 3FRUA 2DWEA 2OL3B 1CFSB 4TOYH 4JN1L 5D7JD 3K8LA 4NRZB 5KVEH 2X70A 3MV8B 4X5WA 1JGLH 1TETL 4JGUA 5EOQL 3ULUL 4Q9RL 3L3DA 3WIHA 4XNMA 1S7VA 2OP4L 5EC2B 1GC1C 1BZQK 3OKNB 5E7BA 5LCVH 1INQB 3L3IB 4PPTA 5F97E 5ACLA 4XZUB 1A7OL 3C8KA 3P30L 5JOPD 4M93B 3NZHH 3HHRB 5JW4M 4Y19D 4XP9L 3TH4T 3VWKD 3PGFL 4L8SB 1EEZB 4RQQB 5M95B 2EEDA 1QRNE 1IM9B 5GGQH 1LEIA 1K8IA 3VFUA 3WMSA 4PJ7E 1TITA 1XGQB 2OTWB 4IOIB 4N0RA 3DPBA 4L3EE 1N3NB 4MS8D 4TVPD 1FP5A 3EJZC 5FDYA 1C08A 4XX1G 1FLRL 1FG9C 4JO3L 4EEEA 4D0CA 3MRBA 5CSZA 5F7EL 5FEBA 2OTPA 4I4WA 3MA7B 2CRIA 1FAKT 5BZWB 2BVTA 1TQBC 4MXVE 5T3XD 5KN5B 3RZCA 1U2CA 2YPVL 1CLOH 3RY5A 1JYNA 3TBTB 1JFQL 2OMBA 4UTBH 4XRCA 4UQ2A 5GXBB 4RCAA 1MJUL 5JPNA 4NKDA 4OLUL 5BQ7B 1NBQA 2DLGA 4EDWH 5I9QB 3QI9B 1QOKA 3TA3C 3OAYK 5J56B 1VDGA 4F7PA 3AM8A 4JDZB 3EZJB 1Z9SA 2W91A 2C1OB 1N8ZA 3FB8B 2X4QB 3E8UL 3MXVL 4QYOA 3L5XH 4Q2ZB 2C5DC 3LCYA 2VLKA 4PB0L 1JHLL 4C54A 3VMPA 3V7AG 2ED8A 1GGCH 1LDPH 2BHUA 2YMXL 3NN8A 4KKLC 4PG9A 2NLJA 4HHAB 2IQAB 1SVCP 2ZUQC 1OSPL 4G6KL 3DRTA 4HAFA 4PJXE 3GRWA 2CIIA 1L0YA 1Y0LB 2WWMD 3GJFA 1WWWX 1NCAH 3HB3C 3VFWB 3BIKB 2PCPA 1ZE3C 5HJ3B 2CXGA 5CGMA 1N6VA 3EO1A 4I3SH 4HXBL 4OF0A 4O02H 1HWHB 2EE9A 1L0XA 1NGWB 3C6LC 3ESUF 1C5BH 4X7TB 1ZLUH 4TN9A 3LQAC 2H9GA 1AO7E 5F3HA 4PTTB 1SBSH 1PG7X 1RZFH 3ARDC 3K8MA 3QQ3B 5D4QA 3UC0L 4PJDF 1OAXL 4F7MB 1JPSH 1YNKH 5IBUB 2PW1B 2DM7A 3THMH 1V3JA 1OAKL 3QDME 1T0PB 2G5RA 2XRAL 2YD2A 4R7DB 3WLWC 1Q9LB 1QHOA 1P1ZB 2ZCHH 3IXAB 1RI8A 4KI5C 3DJ9A 3SGDH 2E7CA 3P4MB 4ZPTB 4WO4D 4YC2B 5C0NC 4PBXA 1R5WA 2M1KA 5EOCH 1L9MA 4GMTH 5EU3B 5EU5B 4DN3H 3MLZH 1B0GB 5K9OA 1JI2A 2VR5A 1RUAH 2WUBH 1J8HB 2C3VB 1H0DB 2VDOH 1IGFH 3D3VB 4YXLH 2HKFL 1KLFA 2FO4A 3MRNA 1INEH 4X98B 5DJAB 5JR1H 4I18A 3WFBH 1NCCH 4ZAKB 1ZLWH 3TO4A 4QXGH 4CNIB 1YMMA 3VFMA 2P4AB 3UEZA 4Q6IB 5CBEA 5EO9B 1T03H 1DDHA 4K3JL 4XPAL 5KS9F 3KPSD 3HC4L 5IF0B 4OB5L 2V7HA 3RZCC 4YK4B 2E8ZA 2F15A 1WIPA 2CH8A 1CICB 1KJ3L 1UM4L 1U3HD 3QRGL 3V6ZB 4ZYKA 2FD6L 1SJVA 2VDMH 4JPWH 3CMOL 5F1SA 1QVOA 5DJYB 5GGUA 3WDHA 2GW5A 4PJAF 2BNQB 4Z95H 2ZUYA 2ICWI 1FIEA 3MLVH 4B5EA 4RX4D 3C9NB 5CJOL 1XCQA 2E9WA 1JGUL 4L4TA 5T33H 3AM8C 3QUMB 4JRYD 3GZKA 2JJWA 3PJSA 3TWCL 5DD5L 2X9WA 3TYGH 3UTTB 4CJ1A 1OD9A 2W9DH 5CZVL 1D5BB 1VFBB 5AEAA 2P42B 3W11C 4DTGL 5F7MC 3FAXA 5D1QB 3ULVE 3BKJL 3EOTH 2DRUA 4BFIB 4FXGB 4WW2F 3C8DA 2IANE 5D1XC 1LO5B 1KPRB 3V0VB 2FEDC 1EGJH 5KZCD 4YX2L 1ZWIA 5DD0H 2EIZB 3MR9A 4XP9H 5AWNH 4EBQL 1YEGH 3PWPD 4I1NB 4ZPVA 1N64L 4OD2A 4RMWA 3HG1D 2KPNA 3JVGA 2NNAA 4I3RL 4JAMA 1I8MA 4WHYH 4F57H 4GFTB 5B3JF 3H3PL 4XMPH 4Z7QE 2Z35A 3ZT6A 5DJDA 3VXMA 2QSQA 4LHUB 1WVZA 3T0DA 2GSIA 5EU6B 4NN5C 4QEGA 1UJ3A 3G6JF 4X7FC 1HYSC 5JIKA 4L8BB 4WJ5A 2H6PA 3O6ML 2O5XH 5D6CA 4YHZH 5CEYB 1QHPA 3MJ9A 2R2BA 3ZMRA 4NC0B 1FO0H 5IROA 3MUGB 2F19L 3LV3A 3K74B 4ZFOA 2GKIA 4UDUA 4UDTA 4UT6L 4DWHA 4GRLA 2NW2A 5DRZB 3OKOB 4MJIA 4PP1D 3QQ9D 1MJUH 4O2EB 4OLUH 4XT1C 5JXED 5GSRB 2GJ6A 4ZQKB 1OGAD 4FP8H 3WFEL 4HJGA 1IFHH 5E8EB 4RISL 4N0FA 3SBWA 1FGNL 4G8GD 4U31A 1W72L 5FYKE 1LP9A 1F6FB 2NY6B 2ADIB 1XH3A 1XGPA 4LCIL 1NFKA 3IU3B 4HMCA 4XXDB 3FN3A 4HK3J 1YEJL 3S96A 2D9CA 4I18C 1A9EB 1I9JL 2NY4D 1FIGH 1KJ2B 1T0NA 1I9RL 3TO4C 5DRXB 3IETA 3DVFA 4KK5C 3QUKB 4PJCB 4MJ5B 4NNXA 3SO3B 4LLYB 1ACYH 4OZHB 3PDOA 5EA0L 2R1XA 1VGEH 1N0XH 5IMKB 3BAEL 3RWGA 3ECBA 4LIQL 1XT5A 5DI8A 4ENEC 3C09B 1A3RL 4Q9QL 4P2QB 3NTCL 1I7UA 3RVTC 2BHYA 4KJQD 2A9NH 4E41E 3NFNB 1G6RB 4PJEF 5T5FH 2HFGH 1S7QA 2NZ9C 2CLZA 4KV5E 5ERWA 5C0CA 3KPTA 3QEQD 2PYFA 1NFDB 3LKNB 3G08A 3KYMB 5EOTB 4U7KA 4U49A 1DUYB 1G7PB 5ADPL 1QSFB 4WEMB 3DETC 3NCCB 3U82B 1GCFA 4K71C 3ULUE 2BOCB 1OAXH 4X7CC 5BOPA 1Z9LA 1ORQA 1XF5A 2I9LB 1R3KB 4LEXL 1A4KA 1I3GL 1DVFC 1V8HA 5DUBB 3S5LA 3ZHLA 1JP5A 1UXWB 3GHEL 3BYYA 3UTZA 5GRUL 4KHTL 4WENB 2YXFA 5EIQA 2ICWA 4NYLA 4A6YB 5B3NA 3L7EA 3WFDH 4W4OA 1CS6A 2UWEB 4KJPD 3IFOB 4WIQA 1OSZA 1AGDA 2IH3B 1ZHKA 1HHHA 3K4DA 3P4LA 5HHPB 4A2MA 4MXQC 3I6GB 4PV8A 4LSPH 1UYWL 5HYFA 3JVGC 4TTDD 2EDNA 4ONGH 3O3DA 5HYSG 4EN3D 2HKFH 4XTRC 2YUWA 3JV4B 1ZA3A 1EMTL 2C3HA 5IHZB 3SGKA 4OAWB 3WUWA 1IM3A 2V17H 3HI5H 3VE0B 4QHMA 3BFOA 3K80A 3X12A 4YDVB 2W65A 1DCLA 4K8RD 4EI5B 2R1YB 1MCOH 3QQ4A 5H8DA 12E8L 2CDEB 5SX4H 5KSVB 4MNGA 3BGAA 3VXSE 2YD3A 2VXQH 2P5EB 3HPJA 3MV7E 3UTQA 5MHSD 2HT3C 4UT9H 3QULB 1FO0A 1D6EA 3MNZB 1H3TA 4S1SL 4XWGH 1I8LA 1JF1B 3FONA 1ZXQA 1QFHA 1LHZA 3D39B 3VXUA 2X4OA 3VFRA 3EHBD 4FTVA 4GRLC 4HZLA 4HWEH 3CMOH 2AEWA 1P53A 3ARZA 4BH8A 2EDDA 5K9QG 2FWOA 3VXPB 2BCKA 3MUY1 1M7DB 4HMEA 4NWTL 1KCSL 3SJVB 3SBWC 3CFIC 1CK0L 1OTTC 3Q6FA 3A6OA 2W9EH 1NDMA 1NH6A 1MJJB 5CEXB 2WUCL 3CX5J 5D7LD 3D2UD 5MI0C 3GMLA 4R96B 5EC1B 3GSVB 1WAAF 3CFJB 1CLYH 3CVHH 3WNPA 2X4PB 4I0KA 2GJJA 3U1SH 2W0FB 4IDLA 3N1FC 4EUPG 5AD0A 1CE6B 1KXTB 1NCUA 1LGVA 4RMTA 4R4BB 1INDL 1FN4B 4OGAC 3IJYA 4AEIL 5E9DE 1NLDL 4H25B 3U7WH 1JRHH 2R4RL 4N8VB 3RX5A 4YHYB 3RAJH 2VYRE 5CLTA 2F53E 4MAYB 3H3PH 1UGNA 4BFGA 2Q87A 3MRKA 4YJZL 3KPQB 1WFUA 2WIIA 4UNTA 4JVPA 4Z18A 4YDLB 2XKSA 2Z31D 5E2WL 4R90L 4TUJA 5GGTH 5F70A 4LOUD 4HIXL 5HHOA 4EQ3A 3BGFC 4N90E 2BXZA 2X1OA 4RNRB 4M1DL 3O2VL 4S0TD 1B6DA 1ERNA 3OPZL 3LKPB 1CU4H 3MGOA 4DZ8A 1BVLA 4TSCL 5JA9A 4W4OC 2BSTB 3O3AA 1SQ2N 1OARL 2QHLA 3TM6A 3V79C 3LDBC 5F7NC 3O2WH 5A2FA 4PJHB 2XWTA 4QRPB 5IFAL 2R15A 4NN6C 4OKVB 3ZKSD 3O3UN 3L7FA 4LCIH 5D70L 2LQRA 3KPOB 3D25B 1FH5L 4HEME 2QSVA 1RFDL 3N1GC 1RJCA 1I9JH 1TNMA 5E4EC 3UPAA 1MCRA 1TNNA 4NHUA 3RWEA 1T6WA 4ZS6C 1X5XA 1B4JH 2ZWLT 2CLVA 1UA6L 5D7JA 2L4OA 3D87B 3WFCL 5F1OB 3LOWA 4NC2B 2QQNL 2I25N 3JWDL 4ISVB 3NTCH 1JGVL 1S7UA 1SEBB 2CKBL 2NR6D 5LJYH 5A40E 2IALB 2QV2A 1FSKC 4WFGE 1CL7L 4OM1H 1LD9A 3C5JB 1LO3H 1FVDA 4NDMA 2FX7H 2M2DA 2UY7A 4Y19A 5KSUB 1TLKA 2X4TA 2IMMA 3NCFB 1CDIA 3VWKA 3CUPA 3IS0X 4U2YA 3CZFB 1OOAA 3HNSL 5GS0D 1IGYB 1NEZA 4FFYH 1GGBL 1RHFA 4OLZL 1OVZA 4NO0D 3CVHA 5ILTH 2Q1EA 4M9OA 3PGCB 5F9WC 4E0RB 3GHBL 2F54B 7FABL 5DD1H 5FGBC 4Z7VB 5K9KB 4OCWH 5FYKU 4Z0XA 5EZIL 1JNHB 4HBQA 2VQUA 2FX9H 2O5ZL 3OXRA 1KN2L 3K2UL 5ICZB 4APQB 1TVHB 4P59H 1BPVA 2DDQL 1FCCA 4HBCH 4KAQH 2DQEL 4X6DB 4D0BB 4ELMA 4RAUA 1YYLH 4LSQL 3RUGA 3RBSA 3HI6H 4PJAA 4YBQD 5KAQG 1OD7A 1FZMB 3MACL 1QR4A 2XTJE 2F74A 3WV0A 5DRNB 3LAFA 5EBMA 2PN5A 3HR6A 3UXFA 5KSBA 1RUQH 1JGDB 5DJZB 1TTUA 3S4SG 3RTQD 5C0JB 3HUJE 4EXPX 1WFOA 3L3OB 4UB0L 5FB8B 1MQ8A 3OKMA 3RNKB 3G04A 1FBIH 3E6HB 4TYUA 3MYZA 1M6OA 4Z7WE 1AXTH 4DAGH 3PG2A 3LZFL 4V1DD 1G7MB 1IILE 3TIDB 4WW2A 5F9AC 2ZKHH 2Z92B 5C07B 1KIQA 5HVFB 1ZVSA 1HK6A 2CDGA 1KEGH 4FG6D 1NCWL 3U9UB 1KT2B 1R0AH 3FQUA 3V5DB 3B9KA 2BERA 2P45B 4HJ0D 4MVBC 5CKAA 1LWRA 4HPOH 4N9GB 2VN7A 3BKYL 4RFOH 4LLMA 2MHAB 4NIKB 1EZVX 1G6VK 1U92B 1Q9KB 3X3FH 3QUZB 4UIKH 3SDCD 2B7DT 5D6DA 2CUIA 3B6SB 1NLDH 1XGTB 3I6LD 2AK4D 2BMKB 4KWUA 2WNGA 1PGRB 3F12B 4KDWA 2A83A 4ZUUB 2P5WE 3SDXB 1EHAA 2ATPA 1PKQA 3CXHJ 4PR5A 5D71L 5GJSL 5GSVB 2DJUA 2YD1A 4PRDA 4JQVC 3VWKC 5CINL 2PXYD 4XAKD 4C57C 5AZ2H 1CR9L 1J8KA 3C5ZB 2XFXB 1T20B 2XNAA 5SWZE 5INCB 1IC7L 4J7RA 3OPZH 5DYOA 3MLYH 5DQDH 2BY0A 2P8MA 3O6LL 3WFZA 2V5MA 3QNXB 3P11L 4YHPB 3DX9A 4PRID 3N1PC 4R2GD 4FQXB 5TE6L 3BZEB 3QAZC 1FG2A 1PLGL 4YGAB 5EN2A 4YZFE 1GHFL 3FT3A 3MRDB 4QT5B 3ARFB 4P4KB 1NCDH 2VDLL 3FQRA 1U3HA 1DP0A 5CUSH 2EDJA 3CU1A 4X6EB 5I8CA 2GSGB 5HI3D 4RX4A 3OQ3B 1Z5LB 4ZTPH 1U41A 1UVQA 3KYAA 3WIHL 1BVKA 4Q9BA 5HGBA 3KLSA 4U1LA 3U36A 5C92A 2CRYA 1HNGA 4HW6A 2FYYB 5D7KE 2QQLH 4X9BA 1JJUA 3MUHL 1ZT1B 3FO0H 5I1IL 1MF2H 5ISZA 1OT2A 4ONHA 4IS6A 4N1EA 4P9HH 4YPGB 2CKBH 4GAYB 3IDXL 2OI9B 2A6JA 4LCCC 1MFDH 1RZKH 3W9DB 3O3EA 5ALBL 2IBGA 5KAQF 3LKQB 5IB1A 3GSQB 5IVOA 2ESVA 5ACMA 1BD2D 5TQ0L 2WWMC 3HG1A 1U91A 4Y16D 1FV1A 2JELL 3BIBX 4QHLB 4YXKH 1MVUA 5MEPB 1YN7A 1FNAA 1FE8L 5AZEH 5FGRA 4XVSH 1U58A 4ZFFA 3I3EA 3B9KC 2DQTH 2DI9A 4GKZB 4PJFE 5LGHH 5C6PB 2VDNH 2BVQA 2VLJD 1H3PH 4M6MH 1A6UH 3QDGA 1G1YA 5DSCA 4G9FE 1HSAA 5EZIH 5DK2B 1WC7A 3REWA 3MLWH 5D6DC 4PRBB 3SN6N 1SY6H 3PWJB 3DWTA 1RU9L 3CCHB 2XWJB 1A47A 2DDQH 4J3OC 2C3GA 3QFJD 2YHGA 2H2PD 4X6CF 5JXEA 5K9QI 1OGAA 5EORH 3DI2B 4U1NB 4F8TA 4UUJA 2YRLA 1BJ1H 1T04B 3CFKA 2Y6SC 3O0RL 5GZOD 2EDKA 4PRPB 5FGCE 2VIRB 4KVCH 1NAMA 3DI3B 3GRWL 1FNFA 2AV7A 4JY6A 3QH3B 1U93B 2RR3A 3B4NA 2DLIA 3QRFM 4JFDA 4K3GA 1MNUL 5IOPB 5TQ2L 3SGEI 3NZ8B 2M8XA 3T8XB 1GGTA 1KTRL 2RFXA 2YA2A 2ZUQB 2R8SH 1W0WB 3P77A 1QSED 5HYJB 3UCRA 4QRTA 4X9FA 1MCJA 3RWFB 3BMWA 3OL2A 4F7CA 3MCKB 3P0VL 1T4KA 1XCTA 4LGPB 3RRQA 1OTUD 3PQYD 2DM3A 3MRPA 4LCWE 1U3HC 3VD3A 3WIIL 2CR3A 4JO4H 3KPLA 3QEQA 4GXVH 3C6LB 3TBVA 4M43H 4EUPH 2EYSB 3ARDB 1NUDA 3T2NL 3L1OL 4G6AD 3DXAE 5E0QA 1NFIA 4OLVH 3BP4A 4X5WB 1T83A 5BOZG 2OM5A 3P9WB 4KJYA 4X80L 3E6FA 3T0EE 1GYAA 4ZO6A 2CUHA 5C08D 4XNXH 1YY9D 4W6XB 1IGJA 1S7VB 1MCEA 3L9RA 4K94L 5B39G 4JPIA 5HGGS 1RZIA 5E99H 4XPBL 3O4LD 1RK1B 3CXDH 3C8KB 5FO7B 4MDIB 4KJWD 3MRMB 4OQ1A 3VH8B 3CX5K 4PYHA 5F96L 3ROOA 5TPWL 4HS3A 4EZMA 4L4VE 2Y5TA 4EN3A 1CR9H 3QPXH 2VZ3A 2WBWB 2ORBL 5D7SL 4JFPA 4LF3B 4F58L 2AJSH 4LSRH 3GIZH 4QRUA 2X9XA 5TJWK 4GG6E 4L29B 3IRZA 4G5ZL 5DJ8B 3BISA 4X8JB 5CSZB 3U4AA 1QBMH 3ZTNL 4HKZA 1MIML 3SE4A 1HKFA 1GZQB 4ZUVB 5DGRA 2VDLH 1YY8A 3UBXG 3A6BH 5EPMB 4XRCB 2OS7A 4NKDB 3QQ9C 1A6VL 5T1LD 5JXEC 2IFGA 5GGSY 3QSKB 2C4FU 5EIIA 4OQTA 4Z7UA 5FYJL 1K4CA 1BBJA 1KFAH 1RJZB 3VFGL 1I7ZB 2YS4A 3GMNA 4PJ9D 4QHNA 5CIPH 4ONOA 1SYSA 3LS5L 3D48R 4Z9KB 1ZHBB 2ZJSH 3IDXH 1T3FA 2E3VA 4F33A 5D1XB 5D9SA 2NLJB 2E27H 1QD0A 3DRTB 2AJXH 3QIBD 1K6QL 4ZOEA 3EYOB 3W5MA 3HS0B 3OMZA 4F9PC 1S9KC 1GVIA 4Y8DC 3GJFB 4MA8L 2D0FA 1G0YR 3MV9E 3SKOA 1T5WA 3K46A 5TQ0H 1ETZA 4XBEL 1EHXA 1P9MA 1Z9OA 3FB5B 2E9BA 5CZXD 5C2BH 3HC3L 4JFFB 2HVJA 1FE8H 1CT8A 1I1YB 3MJ9L 4M8QB 2D4FA 4CU7A 1HE7A 4NN5B 4HH9B 5FK9B 3O4OB 5IQ7L 3QCVH 3BH8B 4HWNA 3GKWH 4ZFOL 1CZ8L 3S8WA 2APFA 2Z31A 5C09E 2MMXA 4YE4H 4U6VH 3H6JA 2MFNA 2Y23A 3P4OA 5FYLD 5J13C 1ED3A 1H8NA 3EFDL 2IMNA 4YR6B 5F7LB 4NHCH 3UTSE 1T83C 3W9EB 1XIWD 3OKEA 3WE6A 2ZUVA 1AO7B 5F44A 2ZOKA 2EDQA 1DE4B 3PHOB 4P9HC 3NPSC 3O6FD 3CIQA 3LIZH 5L2KD 2R39A 4G6ML 5JHDD 1Q0XH 4C56D 4Z5RB 1R5WB 4XI5D 2G5BA 3HE6C 4KPHH 4AH2B 2Q8AH 2YPLE 1OF2A 1A5FL 1OTSD 1F02I 1F2QA 3DMMB 2AEQL 3P9LA 2ED7A 4TTDC 3B9EA 1P5UA 1OLZA 3MRNB 4EN3C 5GZNC 4XP5L 5H2BA 2D03H 3BOVA 1GOHA 4I18B 3PUCA 4ODXB 2BVOA 3TCLB 4MJ6B 3TO4B 2J4WH 5KBNC 1YMMB 4HG4J 3HE7C 4TPRL 4XB8A 3CFCL 4I0PD 3JTSB 4LQFL 1DSFH 4HCRH 3BP7B 4FMFA 4PGCA 2VH5L 1CN4A 1F3JB 1VPOL 3TV3H 1DBKL 4GLRI 1A7NH 3SE4C 1TTGA 3S3SA 3WD5L 1HN1A 4NOFA 4C4KO 5DGQA 4ZYKB 2ATKB 1A1NB 3ROLA 5T1KA 5GGUB 1AQDA 2GI7A 2OZ4H 5CILL 2GT9A 4X99B 1YEKL 3ORJA 1RZJH 2C7UB 4Y5YB 4R3SB 5T3ZH 4L4TB 3SOBH 4DCQB 4MHHG 5CP7B 4HS6A 5FUCC 1IJ9A 1NUNB 2H32H 2VXUH 4PJGE 1PEWA 3RL1B 4GLRH 1DVFB 2B5IB 1QO3B 4N0UA 3EOBA 5JORB 2XG4A 1BIHA 4F37K 4R4ND 4JFOA 1HYRC 4NO0A 1R24B 5C8JB 3B2VL 4XPBH 3QBTB 1ZGLA 1T2QL 2E5EA 4L8CB 3KDMA 3X11A 4PJ5B 4OD1H 3MR9B 1TZHA 1TJHH 3U2SA 5CJQH 5TPWH 4WFEE 4WW1A 1MRDH 1P9MC 1RY7B 2OCFD 3O9WA 4OLWL 4HT1H 3VGDA 5I1EL 2QR0A 1U8LB 5D2LF 1EV2E 2Z35B 1EFXB 2ORBH 5DJDB 3VXMB 1IE5A 1I3RB 3PWNA 2MKLC 2VXVL 4NM8L 4MD0A 2QADC 4JG0L 3H9SD 3GIVB 3UTPE 1KXQE 2H6PB 3TT1H 4URTB 2HLAA 2Z31C 3F5WA 1G7QB 2B2XH 4HGWB 2JJSA 1PG7W 4LOUC 2EECA 3WNKA 3VW3L 2Z4QA 3ZTNH 4AT6A 1FL3A 1U8MB 2C1PB 5F21B 2ARWA 3EYUL 4R97C 1AGEB 2FLRT 2R0WL 35C8H 1D9KD 5CEZH 2PR4H 4GRLB 5BS0B 2NW2B 3CXHK 3IU4H 2D7PA 5ESAA 2VLKE 2ADJB 1JNJA 2JIXD 1Y6MR 3WUZA 1EAPA 1GH7A 3OF6A 4ONFL 4PGJA 1KCUH 4HJGB 4O2FB 4XVTL 4CU8A 3WL9A 2LU7A 2Q7YA 1XH3B 1EJOH 5GGSB 1FJ1A 2IGFH 1FFOA 2ICWJ 1CD9B 3ES6A 5MI0B 1FORH 2APVA 1B4RA 3S4SA 4IOSD 1T0NB 1BAFL 2NXZD 2X4SB 3OZ9H 3Q5OA 3B8YA 2HVKB 3MOBH 2VXSH 4FQHA 2DKUA 3PDOB 1MJ8H 2R1XB 4LBEB 4QXUL 5JPMA 3OB8A 1UXSB 4GQ9H 5I66A