5EIIA

Structural determination of an protein complex of a fab with increased solubility
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
220
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFNISYSSIHWVRQAPGKGLEWVASISSYYGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRGQASWDYWWAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Structural determination of an protein complex of a Fab with increased solubility
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 220
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiiA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiiA01
1L7IL 1ORQA 5IESH 5KSAC 4FQXD 5ENWA 3WUWA 4Y8AA 2R2EB 3PABA 4Y4FB 5L2KD 1MRCH 2IQAA 3MV9E 5F3BA 3VFTA 3QEQA 2XKSA 4HZAA 4J3SA 1CXKA 1E6JH 1TVDA 4N0RA 3V0VA 4LCUB 4MXVE 4AENA 4EI5C 3V4PH 1KBGL 3AB0B 3CH1B 4LP4A 4F7CB 1MFCL 4PBVC 5GGTL 4JQIH 2ITDA 5EO0A 5DHVB 3EYOB 1FN4A 4OZHA 4PJGB 2K3TA 4PJBA 4KJWC 1G7MA 1DE4B 4O2CB 4RIRA 4KTDH 5IBTL 2A0LD 4NM8H 3MRKA 5ETUA 4CVWA 1I8MA 1UEYA 3QXDA 1HH9A 5C0DB 1FNFA 3FCTB 4J3TA 5F72S 1A3LL 4L5FL 1SMAA 5IMOB 1Q1JL 3QI9D 3J7HA 3UBXB 1AQKL 2JELL 4POUB 4QRRA 5E8DL 1N64L 1PG7X 1IC7L 2OTUA 3CLEH 3HMWH 1EUUA 5D7KD 5C92A 3WYRA 2X1XR 3G6JB 2NXYB 5E8PA 4XPFH 5HDQH 1G7PA 2C9AA 2NY6C 3RVXC 1ZSDB 5EUOF 4G8GD 3MV7D 4OFYD 5L8KB 4WENB 3RUGB 1JWUA 4G9FA 4ZDHA 1YEDA 1HYRC 1RFDH 1UXSB 2Z31D 3M1BB 3VFMA 2M1KA 1UADC 4FZ8L 5C08A 1AGEB 4PB0L 2KQMA 3W5MA 5IGXL 1MQ8A 5IMKA 1JZ6A 2A6JA 3QCVL 2LU4A 4WY7L 5D6DA 3V0AC 3NCFB 2ESVE 1A4JA 1DANT 1DQMH 4OLUH 3TFKD 4KQ3H 5I8KL 3SOBL 1GAFL 2J7LA 3F12B 5E4IA 1F11A 3CXHJ 3CX2A 3IVKB 4DJMA 3BW9B 3QIUC 4PJIF 3KHOA 4XCCH 2J4WL 4WJ5A 3UTTB 4WUKL 2CDFB 5DJZA 2AGJL 1S5HA 5DSCA 3HNTL 3MRGB 1MFAL 4PJ9B 5F1NB 1JZ3A 1M05B 2ZOKB 3BMVA 3VFUA 5TH2B 2ENYA 4TULL 5DJXA 1NCDL 4KI5D 3BKML 1FFRA 3AMLA 3OF6D 4YZFE 4ODVH 5D93C 2E7BA 3ALXA 3DECA 3NIDF 4X7CC 4OCMC 4XPHL 5IVNA 1U93A 3QA3B 1NCWL 4ZPVA 1YN6B 4NQCE 2GITA 4P2RA 2PXYC 5CINL 5EDXA 4UT6L 3MV8A 5DC4B 1U3HB 1UJ3C 2BDNL 1CFTA 1BQHG 4QHMA 4KROC 1LEIB 4TPRL 2W92A 4RBPK 5TDOB 2AXHA 4HJ0D 4D94A 3U0PA 2NYYD 4PRAB 1NFIB 1SYVA 5CZVL 3RWJB 1PYWA 4HC1H 4JFDA 3SCMA 3GKWL 5GGSY 3DUUA 1GGYA 5FGCB 5HHPA 3FT4B 4Y5XB 1QUNA 1YEIL 1HNGA 3BQUC 4NHCH 4C59B 2EDEA 2HA1A 4L3EE 5HGHB 3IDNA 3D3VA 3BPOC 4U6HB 4HT1L 1C12A 4PJXF 3V79C 3D0LA 2GFBB 2I5YH 4UDTB 5I1EL 1NBZA 1T0NB 5DTFB 5KVEL 2ICEB 4MJ4A 1QFUL 3IJSA 4HKZA 3D2UB 2EXYD 4GRLD 1ZLWK 2D0GA 4Q6IA 2Z4QB 1FE8L 1JYNA 1TFHA 1YMHA 1HDMA 4JDZB 1FZMA 4QO1A 1MLBA 3RWDA 5ESQA 4U33A 1LGVA 4JFHE 4LQFL 1OGAD 3VGFA 4RISL 3MRBB 4UBDD 3A6BH 2NY1C 2VZOA 3MOBL 3TV3L 4OV6F 4C56B 4PRDB 4EQ3A 2OI9B 1LO3H 2YSSA 3AC0A 3ZE2E 4GW5B 2IEPA 4FXGB 3AY4C 1S7WB 3SDAB 2IAMB 2ZOLA 2NY0D 2BP3A 4P2OC 3V95A 1U8QB 5C07E 1YDPB 3S4SA 1PD6A 2NR6D 5HGAA 5IVXE 5AAMA 5SWSB 2HRPL 1HN1A 2B4CL 4NRYB 1YY8B 1R6VA 2FJFA 1YMMA 3IDYC 1W8OA 4ZTOH 1CD0A 1C08A 3CMGA 2PN5A 1A1NB 1O7VA 4L4JA 1Q9LA 3AROA 2ED9A 4N9OB 5ITBH 2GCYB 1GGBH 3PDOA 1DUZA 3IDIB 3F7VA 4XCYA 5DRXA 5KOMC 4U1NA 4W4NA 4X6DB 2DQTL 1BGXL 4X6CF 5EWIH 3Q2CA 1KPVA 5MEOA 3RZCA 2VMFA 4L4TE 5D1XC 3RWEA 4PP1D 4TUKH 2Q1EA 5D7JB 5CBAB 3LKPA 1I8KA 4J23A 5HHVL 3KXFD 1A5FL 3VFSB 2QSQA 3I6GA 3TWCL 5IIEA 2P5WD 4U1LB 5F70A 1C5DA 2PNDA 5ESAB 4U3CA 3IKCA 4IOIA 2E7LC 2X4PA 3RVVC 4JFOB 3WMSA 5MEPA 4DAGH 4HIHB 3ULVE 4AT6A 1A7OH 1HYSD 1GOHA 1W72L 3MCLH 3FB8B 3L7EA 5ICXA 3G5VA 5C70A 5IVZA 1UJTA 5DQDL 2VDMH 5DQ9A 2YD2A 3BXNB 5DUMH 3BP5B 4X80L 4ODTL 1OQOA 5ANMB 2VUYA 3VXPA 1CBVH 2A6DB 4XMPH 2AV1B 3VXMD 5KS9B 3OJDA 3EFFA 3E6FB 4MNHB 3QHZL 4MB5A 4UV4L 5HPMA 3DSFL 2GAZA 1ED3B 4IJ3B 1MF2H 2NX5A 2R2BA 1BBDL 1OAKH 4RGNC 3FFCB 3QUXD 2VDQH 3RL1B 3WFHA 5BV7H 4UV7L 2CIKB 5T33H 3OKOA 5E6YA 4OT1L 2DD8H 4LHUD 3JV4A 1KENH 1KTRL 1OAZL 2P48B 3FTGB 3KNBB 2QHLA 1YEKH 2ZCHL 4HULB 5ESVA 3VDCA 4PTTB 1JK8A 1S7SB 3PDGA 3TEUA 1KELH 4G43A 1DBKL 4Y16D 4AL8L 2CDEA 2PF6A 5I71C 3RL2B 3TZVB 1U8IB 1A14L 3L3GB 5L7XH 3VXUA 2P24A 5GRJH 4XMLH 4KMTL 2CMRH 4HMCA 5EOTB 4M5ZH 4YHMH 2WUBH 2LQRA 1I9JH 4GG6E 1QRND 1DQQA 3VXRB 4X98B 2A83B 1V7MH 4FOMA 3BH9A 3RTQA 1OP3K 4NQVB 5C0IB 2V2XA 5KN5B 1MRDL 3R4DA 5EORH 2KQNA 4P57B 4WU5A 3OB0H 1BF2A 2V5TA 4KRMB 2DM2A 4IOFC 3C5ZD 3QRGL 5HTSA 5F7EH 2BY0A 4HJGB 4MS8D 2A73A 2A38A 5E2JA 4P59H 2XKNB 2ZUYA 5IBLD 1A1MB 3LD8B 1EFXD 1ACYH 2RR3A 5FA4A 2R0KH 1K6QL 5MHSD 1NMCB 2YR3A 3HG1E 5B22A 3KVQA 3GO1H 3GSRB 1ODAA 2DWDB 3MRHA 4GXUM 4PFEA 3UZEA 3DUHA 4BQ9A 4JFYA 4MDJB 5IHBA 2QSTA 3MJ8A 4FZEL 3RI5K 3KPSD 1AGDA 4GS7C 2DLFL 4XCEB 2XICA 1D6EA 3UJIL 3H42L 3C6LC 4GSDL 4I3RH 3ARFC 5TDPB 4GRWE 4DKEL 1IAIH 1R5VB 1R5WA 3OWEA 4XPGH 4H5SB 1MH5A 4OKDA 4WO4D 2JCCF 5JW5B 1MRFL 1Y18A 4XP6L 5EC1A 1JTPA 3MRLA 5DJDB 1FNEA 4D9QD 5J6GB 1QYGL 1A0QL 1OTSD 1KB9J 3EFDL 4Q9RH 2G9HB 5BVJA 1S8DA 3RWIA 4EOWL 1IGYA 1NL0H 3D39E 3MACL 5HHOA 2J2ZA 5IHUH 5H35A 4P4KA 5J11B 4D0DB 1EEZA 1DUYB 4NO2B 2IWGA 1GPOH 4GXUN 4MX7B 1T0MB 3PXHA 3D9AL 1J05A 3O8XA 2AK4B 1IZKA 3FT2A 3UMTA 4IIQA 1JHTA 4M1DH 3QQ4B 5GGUB 4PV9B 1YJDH 3NCJL 4NZDA 3LB6C 3BUYB 3IDXL 3W9DB 3BO8A 1CGSH 4QRPB 5D7SH 4ORZC 4ZUWB 3AU1A 2DLEA 3MJ6A 2VQ1A 5E8OA 9CGTA 5C09E 1M4KA 3WHE0 4X7FC 4Y1AA 3VW3L 4YQXL 4X7SH 3V4UH 4BUGA 2F5BH 5J7CC 3GMPA 5L6YL 4MYWB 1NCNA 4BQ6A 1SJEA 2XRAH 1GGUA 5ACLA 5H94B 1IT9L 2DIAA 3NIGE 1BHGA 4I48B 5SWZB 4XNZB 4CAGA 4P3DA 4F7TB 3TJHC 4Z0BL 3O3UN 1SJHB 5C0CD 1VEOA 4IDJL 1EJOL 3QWQB 3T8XA 1D5MA 2CRMA 3VG0L 3T1FB 3PWLA 1A6AB 4OM1L 1B4JL 3S5LG 1V7NL 3MREB 2IJ0C 2ICES 4JDVB 4LSPH 2Q76B 4R4NC 3LS5H 4Q6YA 1RMFL 4JFXB 3IS1X 4OZGB 5F9JA 5E2TH 5EZIL 3PWNB 3UZQA 4K9EH 1YUHB 3DRTB 1LO5A 2PW2B 2YZ1A 3ARUA 4R0LC 5CUSL 3MNZB 4M62L 2O5YH 3LKQA 4ODWA 3FQUB 2COQA 5DI8A 2XA8H 1KIQA 1EAPB 4PJ5B 1RZGB 3V5KB 5D1QA 2OL3B 4R3SB 4EI5D 3BX7C 3C60C 5IF0A 2J6EH 3GSNL 4I2XE 3QPXH 1EEYB 2LE9A 4X9GA 1CK0H 1F4XL 1MVFA 4LLYB 4KJWD 1KG0A 1OAUH 1FH5L 1D9KA 1UACL 1RZFL 1A7PH 4QHUA 3P0VL 4PP2B 4AEHL 2ICWB 1A7NL 4Y7MA 2QQKL 1ROWA 5KSBE 4L9LA 1IBGL 3K8KA 3C8KA 3GI9H 5D5MB 5KZCB 3OAZK 3WE6A 3GMRA 3GUTB 3DMMA 4OUOA 4DFHA 4PJFE 1EJ6A 2FX7L 1J8HA 4OZFB 1P7QD 1WISA 3GSOB 4NKQB 3GMQA 3T4YA 5CCKL 4JPKH 1A6ZB 1Q72H 1LO0L 1H5BC 1MY7A 4YDJA 2C1PB 4M48L 5EOCJ 5E6IC 3X13A 4OIAA 3UTPD 4ELKA 5IW3A 5DF0A 1GC1L 4R96B 3VXQB 2NW2B 2NY6D 4LSTL 2XV6B 3RVXD 4XVSH 5D72L 2OP4H 1AD0A 3P9LA 2P44B 3H3KA 4PJEE 5K9KA 3EOAA 1XCTA 4NNXA 1NFDB 1YPZA 4DTGH 4L8SA 4AIXA 4NSKA 3K81A 2H9GA 4ZXBC 2C3WA 3TO4C 3ZYJA 4ISVB 3W2DH 2ZUVA 3PQYA 1PY9A 4YXHL 2CH8A 1FRGL 3RPKA 3REWB 1KLFA 1JNNH 3TIEB 3BDBA 4Z78B 1MHHB 3JWOC 1KB5H 4MNQD 3V0WH 1RHFA 3EJJX 4Y4KC 1ITBB 1T1ZA 3QIUD 4PRHA 4ODUA 3NGBB 4Z0XB 3LVEA 3VJ6B 1DZBA 1G0DA 5J1AA 1WGOA 4TSBH 1CLCA 5DEFB 5CJ5A 2VDKL 3KPRB 4OJFH 4U7KA 4WWKB 5T3ZL 1FGVH 25C8L 2CR6A 4J3VA 4F57H 3GNML 4U1IB 4RWYH 3EO1B 3TJEL 2XOTA 5HDBF 3BDYL 1ONQB 3EYQC 4B7IA 5E9DD 5I16A 4U0RC 1MHCA 2G60L 5BS0A 3GRWH 4WIQA 3DVFA 2DQGL 1AGBA 3ILPB 4L29A 3P4LA 3ZL4H 2PXYD 5DK3A 4ZSOA 4M7JH 3L95A 4GG8B 1RIUH 5FYLH 4Z5RA 1QSFB 1G7JA 1SEBA 4KROD 4I0PA 5CWSB 5GZNC 3WJJC 1QOKA 3P2TA 1ZHLB 4KKBC 2F9BT 2F53D 4OCYL 3TCLA 2R1YB 4JN2B 1MIEH 3VI3E 3MUY1 1IC4L 5C0GA 4N8PA 3ALWA 3K4AA 2JIXD 2HT4C 5IFHH 1IKNA 2Q6WA 3BKCL 1G9NC 1E27A 4FQ2L 3NCBB 3KYMA 4LSVH 4ZUSB 4CVZA 2FZ3A 1PBYA 3O3BA 3BQUD 3KPLA 3BEVA 2VQTA 3UX9B 1J0IA 3OGCA 4Z76A 2X4OA 4Y5VC 1Y0LB 2HG5A 2J6EA 1D5XB 1MCDA 1DP0A 5FO7B 3GBNL 2JKXA 1Z9LA 4XPTH 1OVZA 3RUGE 1CVRA 1XGPB 2X4QB 3FO1A 2YPLD 5EB9A 5HGGS 5ID1B 4CDGC 4FNLH 2WBJA 3DYOA 3KDMA 3QWOA 3QDME 1X6NA 5E4EB 4M4PA 3K4DA 4KVCL 3VGHA 1YYLH 3DIFA 2Y07L 5GHWL 2FJGB 2NY1D 5T5FH 4V2CB 4HUVA 3T0AA 4NRXB 2OK0H 4CNIA 5I8CA 5DEGB 5JZ7D 3NACL 3QCUL 5H8DA 1QLRA 3AREA 5B21A 4HH9A 4UNUA 2OJZH 2YUWA 4CADB 3BZFB 1I1FB 5B39G 1VFAA 1NC4B 4S0SD 2WIIA 3B9KA 5CJOH 4LCWA 4ETYA 3ULVC 4RRPG 3TN0A 4R97B 4KZEL 3UTTE 3H8NA 1NCBL 3MJ9L 1A6VL 3G5XB 3MFFB 4P2QA 1UA6H 3FN0L 4GFTB 1JGEA 3WIHL 4JY4A 4JGUA 2Z91B 1SY6H 43C9B 3U1SH 3NFNA 1I1AB 1ZT4A 3QUMH 3QIWC 1V3LA 5C9JA 2XQBH 3D0VB 3ULSB 2D31A 2LABA 3ULVF 5H2BA 3ESVF 1XCQA 3BI9X 2F54A 3GIZH 4H25A 3RX8A 2BY2A 4ZS7L 4G7YL 3UO1H 2WWMC 5D1XD 1BFOB 3CMOL 4CVXB 4FQJL 1DBJL 1S7XA 3I02A 4HXBH 5IK3B 2GK0B 3DBXA 2IMNA 2AXGB 1UWEL 3UJTH 1KB5A 5JHDA 1FZOB 3NVQA 3F7RA 5HYEA 4G6JL 3RVVD 4EN3B 2EDXA 1U3YA 3JWNC 1MCPH 2R39A 3NZHL 4ZFFA 3LKOB 1LVEA 1XIWC 2IANE 3WFEH 5MI0C 4P4RA 5GSVA 5HDOA 2D7MA 5DD1L 5FGRA 3CCHB 4P9MH 3SDYH 4J1UA 1ADQH 4WTWA 4YPJA 4EDWL 4HIEA 1OPGL 1LO4H 4UQ3A 5C86A 5IB4B 1WC7B 3PJSA 1QO3B 3PNWB 3HZYB 5F71A 1G9NL 3DO7A 5KG9B 3QG7L 3RJDA 5JDSA 3B6SB 1OCWH 2VXSL 3SDCB 3L5HA 3GIVB 2P5ED 4ZFOA 5DRNA 1NSNH 4TOYL 4WI3A 5FGCE 3EYVB 3RNKB 3TYFB 2A74B 3GRWA 4KXZI 1QKZL 4WEMB 2X40A 4FQQB 1KUMA 3R06B 1RJLA 4FQ1H 4UILH 3LEXA 1GIGH 1WZMA 2FYYA 1MI5D 2UY7A 2PYEB 4H88H 2B39A 1F2QA 4U6TA 1RK1B 4RGND 1KXTB 1P1ZB 3HPJB 3WDIA 3TO2A 4RX4D 2EEBA 5INDA 4BSVA 1F58L 3WD5H 3WFBH 3QDGE 2JJTC 1W0VB 3ZYZA 1ZHBB 3I50H 4JFEB 2DYPA 1UT9A 4MJ6A 4GKZA 4KQ4L 1HOCB 1TJHL 2DMBA 2WUCH 2B5IB 2VZ1A 3BP7B 4F58H 1XF3A 3ZTJH 4NO0D 1BFVH 5F7HA 3WFCL 2VE6A 1HXYB 5ID0A 5GS0C 3QNXA 2VLJD 1N5AB 2W60A 5DUBB 3OR6A 4JHAL 3G5ZA 1RZKC 1FL3B 4U1MA 5KW9L 4CW1A 2EDLA 4XMKL 4JR9H 4JO4L 3QH3B 3SN6N 1UB5A 1EO8L 2BC4B 2EC9U 2X1OA 4HG4J 5E00A 3K4ZA 5SWSE 3O6FB 3ULVL 4FP8L 1NGWA 1MEXL 2PO6A 5ECJE 4LARH 3FO0L 1BQLL 1XF4A 2YRPA 3SKUD 2FD6L 2A9MH 4QTHA 4PR5A 3H9SD 2CD0A 5A40E 5IQ7H 4IOFD 1B0GA 3IFNL 3DV6A 5I1AA 5JPMB 1YEJH 1AKJD 1TZGH 2CKBB 3Q48A 3OX8A 3ARGC 2A6KA 1MWAL 3IJYB 1RJCA 4U1KB 1T2QL 4L4VA 1XH3B 1Z5LA 3OHXA 1AR1D 2FGWH 4F15C 5F9AC 3P77A 3LOWA 4PRNA 1QFWH 1C1EH 4NNYB 2APTA 1N4XH 3D48R 3LRSA 3RNQB 1DFBH 1FIGH 1U8OA 3DURB 2CUIA 1MREL 2EECA 2WQ8A 2UUDK 3O4LB 4XWGH 1BZQK 3TBWB 5HJ3B 4U6VH 1UWGL 2ARJB 4I5BB 2GSIA 3C6LD 3DGGB 3CFDA 4NKOA 4WRLA 1LMKA 3WEXB 3VDAA 3KPPB 3IXTA 5GRVK 4FQXA 4I4WA 1SY6A 2XYCA 5ANME 3VWKC 2A6IB 1L0YA 2P8LA 4X6BA 3TNNA 2FWOA 3QUMA 5FYKL 4EUPG 3FMGL 5I8EA 5E5MA 3WXVL 5KS9E 3V6ZB 3ARBC 1QQDA 4WTZA 4PG2C 4LLAA 3UZVB 1IGJA 1IQWH 3HB3D 1F4WL 5ERWA 1U6AL 2AQ2A 5FV2A 1CICC 3OSKA 3SGJC 1CFNB 3BPCA 5IB5A 5K9JH 4Y4HB 2ZCKH 1TETL 4DFIA 5IB3A 5GSRA 5DXWA 4OLZH 1WWCA 1FPTH 1JV5A 3L5WA 4HXAL 5FKAB 3ES6B 4PJCE 4J6RL 4NQDD 1PKQA 3D18B 5EOCH 4HD9A 4DN3H 3MODH 1YN7A 5CGYC 4P46A 4QNPE 4O9HH 2HLAB 4HF5L 4RQQA 5BRZB 1ZK9A 4JRXB 3LB6D 4XNUH 1OT2A 2I9LA 3B4NA 1SBSL 1HHHB 3F58L 5EZLB 4CMMA 3T0DA 2EZ0C 5IQ9A 4E5XB 1JMXA 1HKLH 5GS0L 3S88L 1VEPA 2HYMA 3KJ4C 5I75B 3T4AB 1HH6A 4PJ8B 4W6WB 1WBXA 1XEDA 5DMIL 1KSRA 2VLKA 3MBXH 5D1ZA 5L2KB 1I9IH 3QUYC 2FHCA 5GGRA 2A1WL 3RDTC 3JVGC 2AJYH 1MCKA 4G42A 1S9WB 4QRQB 3MGOB 1MCEA 1WBYA 1XGUB 3VXRE 1AXSA 3TJHD 3CLFL 3WJLC 1MCIA 1T21A 1F4YH 3G6AA 2Z8SA 4Z95H 5TFSL 3HTLX 2W9EH 3QQNA 3BD4A 3DROB 3CX5J 3LPFA 1OGTB 4HIIB 4R4ND 3TA3B 4O4YL 4JPWH 3N9GH 1KIPB 2VXQL 1KCKA 5E5RB 5JW4N 4NJ9H 3U48A 1RUQL 4XBPA 2NZ9D 3QDJB 3VDBA 3STZA 4RNRB 1MUJA 2FX8L 3UTSE 4L8DA 1GGIL 5M95B 3L3OA 5HHXL 4D0BA 5DR5L 1JGLL 1XF5B 1U8NB 3VE0B 3VH8G 3QI9B 3MROA 1T7ZA 3C60D 4D8PB 1FFNA 4OD3H 1LQSR 5D7LB 5EBMB 1I8IA 2UWEB 3VI4E 2PKDA 4ZUVA 4YFEA 5KVFH 3WL9A 5D2NA 2GQHA 4KHXL 2HMIC 4XPAH 4GT7A 1UWXH 1GHFL 2CK2A 3MRNB 4UT7L 4G8GB 4K3EH 2IMMA 2VSCA 3SE3C 1YNTB 4FQCH 4ENEC 4XHJC 1U8MA 4PYGA 1NDGA 4YBHA 2EC9T 4GQ9L 4LLDA 4PJAB 3SBWC 4POZC 5DGQA 2HT3C 2Z31B 1Q38A 1XMWA 2R2HA 1NAML 4NQSB 3THMH 5L88H 2BFVL 5I9QC 1Q9KA 5E6ID 1QR1B 2ESVD 4YNYB 5H37G 1D5ZA 3IFPB 5E99H 5I1GH 5JLZA 5CD3B 2DMKA 2HVKA 1B2WH 2V2TA 3QWRA 5IWLA 2DQDH 3O2VL 3TYGH 3PABB 5MERA 5BXFB 3EO0B 5C0AE 4F2MA 1T20B 1CFQA 1LP9E 3X12A 1C5BL 2AK4E 4LCCB 4KMQA 1UZ6E 4GMTH 4NM4L 4HGWB 2EDDA 4K3GA 2FEDC 2UVEA 3VWJC 1R0AL 1CL7H 2ITDB 4HW6A 1IAOB 2XN9A 4QRPE 4ZXBD 3F65A 3HR5A 3TO4D 5ADOL 1OAQH 4AY0A 4Y4FC 3TPUA 4LL9A 5F88B 4LLVA 4JRYB 3Q6GH 2V17H 4LBEB 3CJJA 4NQCD 1AP2B 3AMKA 1Q0YL 1R3HB 4YR6B 3AB0C 4ZTPH 4QXTA 3QNYA 2Y06H 2VDPL 4Y4KD 1QLFB 4CU7A 4GO6B 3N06B 4BKLB 4R7DB 5J06A 5BVPL 5CD5C 1Y6KR 2XWTA 2ILLA 1K5NB 1OLZA 4S1SL 4APQC 5EOQH 1DQLH 2IH1A 4JKPL 4HZLA 1OD7A 4GRLA 4JLRA 5T1KB 4HUXA 1VADB 3WXWL 1JUFA 2XWBB 5EC2B 2F5AH 3MLUL 4EXPX 1L7IH 2JJSA 4OZGE 3U82B 2BNUB 1XGRA 4P5KB 4LGRB 3EYQD 5HGBA 4PJGF 2Q8BL 4JCMA 5INCA 4F9PC 1JWUB 2VXVL 4TYUA 4F33B 5ALCL 1WBZB 2MWCA 3AAZB 5GS1B 2FR4B 1CN4A 2BOCB 4L3ED 1JMZA 1JWMB 3SKNA 1MNUL 3VXSA 1MFCH 5GGTH 2GY7B 1HCVA 1GRWA 5F7LB 4J3XA 3CSYA 5GZND 5F7UA 1DQTA 4Z7UA 4KKBD 4JFZL 2L4OA 3LSOA 5IBTH 3WS6A 1QSEB 5E7FA 4BFEA 2Z93B 3BHBB 3I6KA 2HT4D 3SKMB 3C5SB 2GJ6B 3N85L 3G6JF 4M8VA 2E9WA 3UPCA 2X1PA 1XF1A 4L5FH 4JFHD 3Q6FB 2ARWA 5DJ2A 1AGFA 4YJZL 2XNAA 1A4KB 1Q1JH 3C6SB 3GEWB 2YPVL 2I60L 3O6MH 4NC2B 4DOHE 1AQKH 2JELH 5D7IA 5F97E 1U3ZA 5E8DH 5A1AA 3JUYA 5DMKA 1IC7H 1U91B 4Q7DA 3L3JA 1RJZB 1OGAB 2FECI 4PJBF 4ODXA 1WAAE 3KXFA 1N0LA 2NXZB 4PGJA 1KCRL 2WBKA 3SDDB 1TVHB 5C07D 4NFDA 4L1DA 3RY5A 4FQLL 3ZDZF 1MCQA 5DD6B 3RWHB 2IQ9L 4OLWL 1MY5A 2Q3AA 5IEKA 1Q94A 3MBEB 1FNGB 3KLAA 1A9BA 1NFDE 4NQXB 2Y5TB 1JPGB 4PB0H 3O6LL 4LLQB 1OT1A 3SEPA 1YEHH 3L6FB 5IGXH 3CFKA 4JHBA 1N3NB 3ABZA 3QCVH 4GLRI 4DCQA 4XNQA 5EIQA 4WY7H 1LHZA 4LIQL 4EXKA 5I8KH 1GAFH 4HV8A 4I9WE 1U3HC 1XR9B 5HYSA 5LCVH 2XXCB 4R26L 2X4RB 4KUCF 5LAXB 1MCOL 4M3KB 3MRJA 3ULVD 1CDUA 4WFEE 4X8JB 3QAZC 3H9HB 2J4WH 3A67L 4YDLB 2XFXA 2P5WB 3RZWA 2AGJH 4KPHL 4R7NA 3HNTH 4ZO9A 5BJTA 1MFAH 4I18B 2B1AH 4TULH 3QIWD 2YA0A 1NCDH 3BKMH 3QPQC 2W65B 3IJSB 4GOSA 5EU6B 4FXKB 4KTEH 4Y16A 4ELME 1YEEL 3HE7D 1S7RB 3DX8A 4ODHL 4XPHH 2AS5M 2WWMD 3OXSB 4J7RA 4NO3A 1NCWH 2YA2A 2ZUUA 4Y5XC 1G84A 1QHPA 3GJFH 2DTML 4G8EB 3VXMB 3BYTA 2BDNH 1CD1B 1R3KA 3S3SA 1F42A 2DKSA 2P8PA 3FO2B 4GXVL 4JCLA 5DURD 5F7YC 2WANA 1I4FA 1N2RB 1OAYL 2MHAA 4YHIA 1T83A 2BSED 4TPRH 1XIWD 3D85D 4FN0A 1X4YA 3F6IA 2R0WL 5DRWA 3QUXB 2ZOLB 1AGCB 3I85A 1JTTA 4PGCB 4DW2L 3C5ZA 1QBML 1KEGL 1MCNA 4N9GA 2ITCA 4PGZA 1HHIB 4ZOBA 5F9WB 2Q7YB 4LHUB 3GKWH 3MA7B 2FJFB 3F5WA 1X5YA 2YEZB 4HQQL 4OF3A 1EFXA 1CT8A 2OI9C 5IG7B 4JANA 2XZCL 4OZIE 4HT1H 2E7CA 3HUJB 2JK5A 4M7ZB 5EO9B 5I66A 3QULA 5GGTA 1FO0L 2ZCLL 4DZ8B 3OKLB 3IGAB 1OLLA 4ZOAA 1N59A 2EDJA 2AXFA 5EU3A 3MTRA 1BLNA 4XNXL 3H7BA 3T0EE 3KLHC 1FG2B 4WEUD 4B50A 4XVUC 5C8JB 3RP1A 1QRNB 2C7UA 2DM4A 1HE7A 3SPVB 4F9LC 1KPUA 3VXNA 4LQFH 5I1JL 5HY9B 5CHNA 4OLXL 4WO4A 3TGXA 4RISH 4PPTA 4ZNEE 2R1XB 3PL6C 3JV6B 3MOBH 3TV3H 3VD5A 1VGEH 2NLJA 3QEHB 5IVZB 3RWFA 1JHLL 1IZJA 4HUNB 4TQEH 1A47A 5D7JC 1WCBA 3HG1D 2VIRA 1CGUA 4XZUB 3UDWC 4RFOL 4PJHB 1RZ7L 3BZ4B 3EFFB 4MCZA 2MCPL 2E9JA 5JORA 2B4CH 4X6DF 4WI4A 2FH8A 3E6HA 4V1DD 1RIVL 3N0PB 4KU1A 1NGXA 2DQCL 1FLTX 4OZ4A 5C0NC 4DQOL 1B9ZA 3KPSB 4MMXC 3ARGD 3CGTA 4R6UA 3CXDL 1HHGA 3STLB 1DLHB 2DQTH 1BGXH 2P49B 1UM5L 1UQSB 3E8UL 3RGHA 1U95A 2Z35A 3T65A 3QXAB 5C0FA 5HHVH 1TZIB 5J3HC 1UB6B 1NGYB 1NGQL 3D39D 3MUJA 4IJ3C 3TWCH 2JB5L 4JQVA 5LBSL 1TITA 1LE9B 4QT5A 4FQHB 3SY0A 4MZ3A 5KS9F 4LLWB 2EDQA 1T4KB 4BFIB 3ZDXF 1W72H 3INUL 3BYYA 5DQDH 2VXTL 2QV2A 3PHSA 1FNLA 2PW1A 4X80H 4NT6B 4ODTH 3KPNB 5BW7C 4L8CB 5KSAA 1T3FB 4GQPH 2HVJA 1BZ7B 5EN2A 3MMEB 1J1XH 3VWKD 2OTPA 3PGFL 4RAVA 3MLSH 3CH8A 3BZEA 3ARBD 4ZYKB 5C09D 4M43L 3GMNA 3OJ2C 3QHZH 3TZVC 4UV4H 4OTXH 4QNPF 3DSFH 3RA7L 5JQ6L 1FQ9C 4E42A 4LCYB 1CICD 2AK1L 3ZE0E 3GJFA 4EI5A 3X3GL 1FYTA 3DUSA 2LTQC 3JZ7A 3V6OA 5JR1H 4NHUA 5TQ0L 1TXKA 4B41A 4LVNB 1AXTH 1JN6B 2UY6A 5J8OA 1P5VA 4UV7H 1U8JB 3OAYK 4U3HA 5CGYD 4OT1H 4ACPA 4JQIL 1OAZH 5I2IA 4M7LH 5E1AB 4NDMB 4Y2DC 2V9TA 5E8EB 4AZ8A 1W0WB 3QHTC 5C0CB 2MPAL 1Q9WB 1B0RB 2EZ0D 3MJ8B 1P7QA 4F7EA 4AL8H 1IGML 1AGDB 4MHHG 3V6BR 3IFOA 3SE8L 5IJVB 3U83A 2RQ8A 4KMTH 4LLUB 1F90L 3RBGA 3QUYD 4L8BB 3RDTD 1VPOH 2AJUL 4MGXA 3MRLB 4XCNA 1FJ1A 3HMWL 4K3JL 4RZCB 3EAKA 4G6KH 2HJKA 1EVUA 4ONFH 3VFVB 4OIIH 4PRPA 2HFTA 2ERJB 1MRDH 4E41A 5IROC 3FQXA 1OW0A 4NIKB 1A1OA 4JG0L 4NFCA 1T1WB 3G08B 1BPVA 1ZE3C 4JN1L 3HMXL 3MRFA 4RMTA 3QRGH 4ZO7A 3D1MC 4LEXL 5CKAA 1UVQA 3KJ6H 1P7KB 2F74B 4KY1H 2HFFB 4PJIA 4O5LL 3DTXB 1K6QH 5CKGA 5CJXA 1C16B 4CVUA 1ZOXA 2VQ1B 1DVFC 2J8UB 1SJVA 5I0ZA 5DMGC 4KHTH 2FNBA 3O4LE 3RJQB 2LAGB 2EKSA 4KQ3L 2D7OA 4X4YB 2DLFH 1EVTC 3RWGB 3NTCL 2BCKA 2ICWI 3CFJB 3FQRA 5F6HJ 2NY6B 3UJIH 3H42H 4GSDH 4DKEH 2EXWC 4UI2A 1K2DA 3V5DB 3ME0A 4HWEH 3HI1A 3JXAA 1CI5A 3O9WC 4ENED 4JQXA 4XHJD 2HFEA 2XQYK 3D6GA 4LSRL 3X14B 1MRFH 1RPQA 4PRIA 4POZD 2HT3D 1IKFL 1QYGH 1A0QH 1U0QA 3EFDH 5I1DA 3BWAA 1K9TA 3CK0L 1AHWC 1VA9A 4EOWH 4LF3A 3FOLB 3QXUA 4K71C 2OMBA 2X42A 2PR4L 2PXYA 4NZTH 3MACH 4GBXB 2BNQA 4ODVL 4OFIA 1UJ3A 1V3KA 5JXAH 2XT1B 2B1HL 2YD5A 3LN4A 5C0BB 4XNZC 1QFHA 4DVBA 5C0JB 3HE6A 4HWUA 4MNQB 1NGZB 1IEAB 1W72A 3VWJD 5BRZE 1U9KA 3FQTA 2JIXA 3QIUB 4OKVA 4QRTA 1GJIA 4JRXE 4NPYB 3NCJH 3IDXH 5DUPL 3GGWB 4PJXA 1WIPA 4PJDE 1D9KB 1YA5A 4U2ZA 3K2UL 5I1KH 1JZ8A 2YPKA 2BMKA 1U8KA 2AEQH 4Y4FD 3QIBC 3WNNA 3RX7A 2DQIH 2VC2L 3KGRA 1VERA 3LQAC 4L9LB 1SJXA 1ZA3A 1DR9A 1JNHA 3BQUA 1DQJA 1S9KC 5E9DB 3OKMB 5CSZA 1FGNL 4HC1L 3FB7B 4LSSH 3HFMH 4OZGF 2W0FA 1CE6A 4QOKB 4S1QH 3FT3B 3BDXA 4WV1B 4OAWA 1JPTH 1B90A 5CD5D 3BP6B 4APQD 4Z0BH 2RBLA 3L3DB 3O4OB 4IDJH 2LU3A 4KROB 3EOBA 2MSPA 3UCRA 1V7NH 2I5YL 2R4RL 3G04B 2HKHL 2F53B 1YY9C 4KDTC 1H3WM 5EZIH 3VFGL 4RBPH 4YGAB 2BK8A 4YC2B 1P53A 2Q86A 3QDJE 2GT9B 5CUSH 4M62H 4M7LT 3OPZL 2E9BA 2X4TB 5D5MF 3IDGB 3AGVA 4TUOA 4Z7OE 2ATPB 1I3RB 1EFQA 1IAII 2VDLH 2WNGA 4Q9CA 3C5JB 4ZFZA 3TP4A 3DYMA 5D7LE 1HHKA 4P2OA 2QR0A 4QCIA 2EYSB 2PYFB 1FH5H 3DHMA 2GYSA 1TIUA 1LO3L 3BPOB 1RZFH 3TBYA 3P0VH 1FDLH 1A7NH 4X6CA 5IFAL 2QQKH 4U1JA 5T1LD 5BZWA 4OD1H 1WAAF 2VL4A 4UQ2A 5ACZB 4MD0A 4ZTOL 3QDMD 4QRSB 1ZLWH 1GGCL 4PJAE 5CCKH 2YPLB 2UZYB 3PHOA 5KJRH 3BIAX 4I77L 1MHEA 4M48H 4X7TA 1GGBL 1UKSA 3LPWA 3PWVB 1NFDF 2NY1B 4PV8B 3B3IA 3VFNB 2CGRL 5BMFL 3VXOA 1RZ8A 5DDHB 2E7LA 5D72H 2D9CA 3OKNA 3ECBB 3NGBC 2O5ZH 4NBYB 4MD5B 3UTTD 3KLDA 3VRIB 4EIGB 2G75B 2R1WA 1IE5A 5IOPB 3ARRA 4OZHE 4LPUA 4S2SA 5EZOL 5C6TH 3ARWA 2DM7A 1R3IH 2ATKA 3W0WA 1HQRB 2HJFA 5DJYA 3BRDA 3DX7A 1KOAA 1PZ5B 2E9IA 4JRYE 3G9AB 3OR7A 1AIFA 1FRGH 4PTUB 5E8NB 1Z9MA 5FKPA 1CBVL 4XMPL 3I6LE 1U3HD 4NWUH 5DHYA 1YQ2A 2CRZA 5K33A 1MLCB 1PY4A 1I3VA 5D1XB 1FHGA 1CGWA 2I07A 4QRRE 3WO4C 4MNGB 2XY1A 5D9SA 2YD7A 5EFIA 1XF2A 2IAND 1MF2L 2WK2A 2I9TA 4Z76B 1P4BH 2AKRB 2VDKH 3IAPA 2ADGB 25C8H 2CLZB 2DICA 3GNMH 2VDQL 4BSWB 2CR3A 3QJFB 3FO9A 4N8VA 4NO0A 4XAKE 3BDYH 3R0NA 5GGSA 5C2BL 5IB1A 3QPQD 2DD8L 4HKBB 2G60H 1IEBB 1JCKA 1KENL 4N1CA 4IRJA 3FRUB 1WFNA 2VLJA 5DD0L 5DHXB 5SV3A 3U46A 5KVMC 2DJUA 4K23H 5JMOC 2ADFL 3AFLA 3S7GA 3LN5B 1I8LC 2CDGB 5CIPH 5CBEB 5I0DA 3E2HB 1FSKC 4Y2OA 1KELL 2P5EB 5C08E 3S5LA 4OZFG 4RMQA 1HILA 4ZOCA 3CFCL 3DVNA 4WGWB 5FM5O 3EDJA 4OCYH 1QSEE 3QDGD 1IC4H 3I84A 3JTTB 4RGNB 1H0DA 1A7BA 4YHML 4XP1L 3T0EC 1QHOA 4N0CC 2WUBL 4X99B 3L3KA 2GJ6E 2BRRH 4QTIL 1WEJH 5IMLB 1VFAB 4MA7H 1N6QL 3BKCH 1V7ML 4Z7WA 1AKJA 1IGFL 4FQ2H 3BPLC 4YO0A 3GMOA 1QFOA 1OD9A 2EIZB 1FFPB 2NNAB 4PB9L 1HZHL 3CVIL 3L9RA 1UH4A 3UPRA 1DDHB 2YUVA 2W0LA 1T1YA 3NFNB 1PW3A 4WU7A 2O61A 2FJHB 3CDYA 4IRSA 1LEKA 5FF6A 1R5IA 2Z92B 4HGKC 1LE5A 4XGZB 3HZKB 1MCHA 2XZZA 3VFRB 5SWSD 2JCCA 3VFWB 4WI5A 4HX1B 4UIMB 4HEPG 3KLHD 2XTJE 4MWFA 4XVUD 3HZVA 4D0CB 1DL7H 3DBXB 1F3RB 3ARFA 3U9UB 2WSKA 3P3YA 1OP3H 3H9SB 5LGHH 4KVCH 4HUUA 4LVOC 1M6OB 1QPPA 4HCRL 4MD4B 3PL6D 5GHWH 5E24E 4HUWA 3W9EA 2NMSA 3BIBX 4XPGL 5D7JD 3TVMB 4N0YL 3NN8A 1G7LA 3LH2L 3QZWB 2XY2A 4JFDE 4U3XA 4P0DA 1CD9B 3FQWA 3NZ8A 5J13C 2EE6A 1LK2A 1PQZB 4EN3C 2NY5C 2DKMA 4NQDA 4BH8B 4KZEH 3FOMA 5CMAB 1NCBH 2GJZB 1A6VH 3MJ9H 3PWPA 3D3VE 2P5WE 1KYOK 3FN0H 4HIJA 3HAEB 2MFNA 1E6OH 3WIHH 3MJGX 1CU4H 1H9VA 1RD6A 5EUKA 4JKMA 3TO2B 5C0ND 5CGTA 5INDB 3V52H 1UXWA 5FO9B 1G9ML 5EU6E 1F45A 1NUNB 4K7FB 4WNQB 4M1GL 4QHLB 3G5YB 5JPNA 3MV9A 2AJZB 4G7YH 3BEWB 1DEEA 1O5DT 2DF3A 3CMOH 1CGSL 5BOZG 1VKXA 3STBA 5J3HD 1DBJH 3CUPB 3FFDB 4WFHD 3VXME 1P6FA 2X4NB 43CAA 3IRPX 4ZQKB 1FVDA 1D5BA 3MO1A 1UWEH 5MEND 1E28B 3WDJA 4G6JH 1JZ7A 3VFPA 3QB7C 3OR6B 2GTWA 1P84K 2XRAL 4KVNH 2ZUWA 4U4BA 1VESA 3A6CL 3IDUA 3BP4B 3K74B 5F1IA 4EDWH 3OKKB 1VGKB 2B5IC 4DGIH 1G9NH 5E00B 1TDQA 3QG7H 2OJEB 1BZ9B 2VXSH 4DZBA 1YMME 5DJAA 4TOYH 1KLUB 4PLKC 2H26B 3LS5L 5F96H 1HHJB 4YHPA 5E2TL 4MJ5B 3GMMA 4EJ1C 2DS4A 4K9EL 4KK5C 5IR1A 4OF7A 3HUJE 5CIPA 3C60A 2BSTA 4NKDA 1LO2L 2E3VA 1I7ZA 3O6FC 3QUZC 4F37F 3VXRD 3FQNA 1BVLB 2CO7B 5HGDB 2P47B 4G7VL 3V7MA 1JI1A 4IHOA 3WIFA 4F7PB 2CLVB 1QRNE 4YDVB 4Y2DD 4JRWA 4X9HA 4QKXB 4MAYB 3HC3L 1A3RL 3WFCH 3JV0A 1K8DA 4D9LL 3PV6A 4OQTL 4JFFA 3UTSD 4BQBA 1P9MC 4JHAH 1R24B 1TVBA 3O3DB 4EDXA 5E6IA 3L3IA 3M17B 3OG6B 2ESVA 2N56A 3RVUC 5KW9H 3L5XL 1KLGA 3UJJL 3O41B 4XMKH 4NZRH 3DXAD 4JO4H 4PJHE 4R0LB 3V6FB 3RRQA 1KT2B 1Q72L 1EO8H 2PTVA 5KTEL 3ARPA 3ULVH 2NY5L 5GIRB 2BVOB 2B20A 3FO0H 1I7RA 3QQ9C 2NX5E 3MRQB 1U3JA 3IFNH 3S36X 2OP4L 2X6MA 4QXUL 3KPQB 5MEQA 3ROLA 3DX6A 4ZXBA 3BIKB 5JHLL 4OF8A 4YIQA 1PKQB 3TO4A 4LLMB 5B39A 3Q0HA 3OAZH 2E6QA 3BGMB 1T5XB 3LMJL 1T2QH 3FJTA 4LDOB 4DTGL 3B2UD 2BVEA 4RRPA 5I17B 2ZJSL 1B4RA 1ND0B 1A21A 3B5TA 5CP7A 4NQCA 5HXMA 5EBWB 1DJSA 1WK0A 1URLA 3GK8L 3VD4A 1H5BB 1DVFD 5AD0B 1FLRH 5DMGD 5C0AD 1Q8MA 1MIMH 1TTGA 1MREH 3MRMA 2AK4D 3VXUE 1JNNL 1FVCB 1OTTC 3OAUH 2OCFD 2VKXA 1UWGH 2BSRA 3MJ9A 3QJHB 3P73A 4WHCA 3HC0B 4OFDA 1IFHH 3WIHA 3HNSL 3SQOL 1TTFA 3HPLA 3OG4B 4S1DC 5I1LA 3O9WD 1NGPH 1AQDA 3MRDB 1ZHKA 4TSBL 1SMOA 3DETC 3WNLA 3FMGH 4ALAL 4ZAKA 1QVOB 2VL5A 4OJFL 1SVZA 4F57L 2ZG3A 4OGXL 4PJ8C 2AJSH 1I7TB 1U6AH 1XZ0B 3N1MC 4J8RA 4A6YH 4L3EA 4Q2ZB 32C2A 2X70A 3QXVA 1V3JA 1TETH 5FOBA 4KK8C 4XBPB 5FYJE 5FB8B 3WJJA 1X7QA 1K4CA 3L3OB 3QEUA 4J6RH 4JG1L 3LRGA 3ZL4L 3DVIA 2NTFB 4M7JL 1G9EA 1T5WB 3BFOA 4WDIB 4JM2C 1RIUL 5FYLL 4HF5H 1FV1B 4JZNA 4Y4KB 3WNKA 4WUUD 1ZVYA 3U7AA 3Q1SL 1N7ML 1I9RL 3TA3C 3F58H 2CKBL 5D2NB 4M5YL 3TBSB 2A0LC 4QWWD 5GS0H 4F7MA 3QIBD 3TESA 5A2JH 3P11L 1RZKH 4KV5F 5DMIH 5TF1L 1I1YB 3PGDB 3KYNB 2Y25A 2BSSA 1KNOB 2EYRA 1MCWW 4Y5VA 3QI9C 2A1WH 3B9AA 5GRUH 3FHQA 4IEFB 4P23A 4HS8L 2DI8A 4MQSB 4R4BB 5DJ8B 3UTZA 1WWBX 3PWUB 5FOJA 2JJWA 4JEGB 3TBTB 3WLBA 5IM7A 3HZMB 1CLOL 4BQ8A 2D0FA 2D03H 1ETZB 2WINA 5TFSH 1BFTA 1WJ3A 5HHOE 5GS3A 4PGDB 4GRWH 2H41A 1QFWI 4XRCA 3VGGA 2KZ1B 1T2XA 2IADB 2DBJA 1JF5A 4GAFB 1YY9D 5CZXD 4O4YH 1ZGLA 1ZHNB 2UWEF 4ORGB 5D71H 4N0FB 1U92B 2ZKHH 4WW2C 4XPTL 4C54A 2DQFA 1RUQH 1CQKA 1YC7A 3IU3B 3MNWB 3V7AE 3CIQA 2FX8H 4K94L 3RGVC 4DUWA 1GGIH 3W11C 4TVPE 5HHXH 5DR5H 3AXLA 1ORSB 2FATL 2JLLA 4NN6B 2CXGA 2SEBA 4L4TA 2EDHA 1S9YA 3S35X 4BZ1L 5T5FL 5I6XB 2J8UE 3ARDA 4Y1AE 3UTPE 3MRCA 1FL6B 3F7YA 3WSQH 1CDCA 3TFKC 4AMKH 2IFFH 1GHFH 2OJZL 4B7LA 1QA9B 5C2UB 5HSFA 3S37X 2OR9L 1HI6B 1M7DB 5IVXB 4UT7H 5H37H 5A2LH 1PEWA 5AZ2L 4YAQA 5JIHA 2H1PL 4JZOA 3QIWA 5I18H 3OXRB 2UYLA 4GQ9H 3P0YL 5ADPL 3ARYA 4UTAL 1G1CA 4JLRB 1IL1A 1MWAA 4JKWA 4C83A 5JNYA 4YHNA 1NAMH 3NFSL 2BFVH 1CVSC 4XC3L 2EIBA 1A6TA 1X5GA 2XQBL 1E4JA 2F8OA 1FZKA 2BXZA 1OSZA 2IALA 2Y4SA 4I9WD 3O2VH 3GJEA 1ES0B 3UO1L 5INCB 1S7QA 5C0BE 3T3MF 3X11B 1MCLA 1P2CA 2QBWA 4WHTA 4EUPA 4NM4H 2NY7H 3D25A 3WS3A 3UJTL 3SKNB 4KI5F 3ALPA 1UH3A 1CXFA 4RFEB 1TCMA 4OD2A 4FHBD 1NDMB 1NKOA 4AH2B 2DI7A 4UZGA 4HMDA 2E8YA 2EYTA 1K3ZA 5LVEA 3NIFF 4P9ML 3SDYL 2VZ3A 1ADQL 4NBXB 5DVMA 2X4SA 5JA8B 5DS8A 3P4OA 4YDKL 4H0HB 4WFGE 3QFJD 4HAGA 3KPTA 1A2YA 2H32H 4X7EC 3GSVA 1Q0YH 1HINH 3HE7B 4QOKE 4KJQC 4NO5B 1J18A 2VDPH 4KRLB 4KKCC 4OCLC 5BVPH 2BNRA 4FQ1L 4UILL 4JKPH 4H88L 3WXWH 5DURB 3K0WA 1P5UA 3KYOB 3MLUH 4HGMA 4UOW1 4AIZA 3WD5L 1XIWB 4XNMB 3IRZA 5MI0B 3D85B 5E2VH 4KAQH 5F7DB 3FAWA 1V3MA 4LKCA 5HYJA 1S7TA 2Q8BH 4GKNB 5ALCH 1IGTB 4NQTA 4PRBB 2QHRL 4BH7B 1OF2A 1U2HA 5CEYB 3C2AL 3HG1A 4ZMAT 1NBVH 3LV3A 3RWCB 2NXZC 3CFIC 2AEPL 4U6YB 3SDDC 3ZE1E 2P8MA 4JFZH 2PCPA 1CLYL 4A6YB 1MELA 1FL5A 1KTDA 3TNMB 4HDIA 3T0ED 5JW4Q 2XTJC 3MBEC 4G80A 4N0CD 4O58L 1GZPB 4LKXB 4HWBH 4FTVA 4O2FB 3C87A 1XFPA 4KWUA 3N85H 4GG6B 3EDEA 3TLRA 2AQ1A 4G8IA 1A6PA 4PRHE 1QTYT 2DWEA 3VH8A 4LDEB 3MLRL 5FUOL 3RPIB 3GZKA 2YPVH 2I60H 3ZT7A 2VISB 1HEZA 1OWWA 1T6WA 1Y6MR 4HFWA 5C0EA 1TZGL 1CL7I 3MLTB 3I2CL 3PIQB 3QDAA 3D39A 1KCRH 1MAML 4YHYB 4X0KA 5BS0E 3X17A 4FQLH 4U05A 1QEWA 1DLFL 4BYHA 2IQ9H 4LNRA 3TBVB 1GOFA 1OB1A 4YDLC 2ADJA 4PY7B 3PE9A 4MSWA 4I18C 5AYUH 1O7SA 2AJ3A 3O6LH 2IPKA 3IXAB 4V1DB 5JOFA 3ET9F 4O2EB 5ACMA 1RVFH 4PG2A 4Q6IC 1NAMA 4U1SA 4ETQA 3ARGB 4G8FB 2OS7A 4TN9A 2FLRT 2D2OA 1F13A 5DHVH 1M1SA 3WNOA 4R26H 4KRNA 1ZT1B 1FFOA 1MCOH 4OF6A 4EN3D 1I7UB 3KPMA 4UU9B 5IV2A 3M07A 2ADIA 5HVGB 1R3JB 4PD4J 3ZKMC 1U8HB 4RMUA 4OLZL 1ZKAA 3QO0B 4PREB 1RHHA 5E0QA 2HTLD 1FPTL 1CXLA 2BRQA 1K8IA 3MOQA 2VITA 5F93C 4OV5B 2UUDH 4MCYA 3T0XA 3WHXA 3WIIL 5DZLA 1U36A 5EU3B 1YEEH 4KJYB 3HLAA 4P5MB 3GSUA 1T22A 2DTMH 3VWKB 3QUYA 1TQBB 3ARBB 5C09B 2H32A 2VN7A 3U4EB 3ISWA 4M7ZC 5CEXB 4X5XB 5IEHA 4UDUB 1TJIH 3P30L 4YPGA 2FB4H 2GUOA 1CICB 3MBXL 1JRHL 3MGTA 4X4XB 3RZCC 1BAFL 2WMPA 2J8HA 4F3FB 4TUJA 4K55A 3P4NA 1ZWIA 5J4MA 1NC2A 1MVUB 2R0WH 5KSBA 1KPRB 2XG4A 3HUJF 5ICYB 1QBMH 2X44D 1KEGH 2JE8A 4LCWE 1ACZA 2P7TA 5GISL 2EDOA 4QGYA 4Z95L 4YGVB 1S9XA 3CPLB 4PLKD 4HQQH 2DN7A 1ZLVH 3N9GL 5KSUB 3PF2A 1B6DA 4KK5D 2AV7B 2XZCH 3DI2B 2R8SL 3WFZA 5ITFA 1XR8A 2ZCLH 3U36B 2XWJA 4LNVA 4Z7NE 3O6FD 5IMMB 3QUZD 4GW1A 1F5WA 5B3JE 4MQ7B 3NPSC 3BSZH 3RDTB 1U8PA 3KPOA 3PWJA 4OD3L 4I2XB 4OUUB 4NFBA 3BE1L 4LEOA 2OMNA 3SE3A 3OB0K 5JHDE 5I1JH 1OP5K 1JJUA 1HSAA 4XPAL 4XTRC 3H9SE 5T3XD 2R2CA 2HJLA 4ZUUB 3SBWA 4I8DA 3UTQB 4MA1C 2J1KA 1VFBA 4K3EL 3DX9A 1JHLH 4MDIB 4PJFB 1F02I 1N8ZB 1I3UA 3RVUD 2KKQA 3ARVA 4YLQT 1BVKB 2H6PB 5AWNL 1RZ7H 1GZQA 3MRRB 2CRIA 4PY8J 2F8VA 3EYFB 1BQHB 3ILQC 2MCPH 4U1GB 3B43A 1M71A 5DQJA 2LVCA 3GM0A 4MJ2A 3O4LD 5A3ID 5I1GL 1UZ8B 5EBLB 2DKUA 4CU6A 3P4MB 1B2WL 3QQ9D 3BPNC 3MQIA 3ROOB 1KJMB 2DQDL 4XB8A 1RIVH 1WT5C 3TYGL 3MRPB 2DQCH 3VWJA 1AH1A 3DUSB 4QRUA 1R3LA 3T1WA 1IM9B 4M61B 1SEQH 1X5IA 2YN3A 2H3NB 1AO7D 4PJEB 3CXDH 2R2EA 4Y4FA 3RTQC 1UM5H 1CL7L 3E8UH 1NCAL 5I76B 3H9ZA 3KYAA 1QLEL 1NGQH 3CSGA 4HS3B 4LCUA 5D8JL 4Q9QL 1OAQL 2JB5H 5LBSH 4LHUG 5FECB 3CH1A 8FABB 4F7CA 5F21B 2YUZA 4TRPL 1K4DB 3DGCR 3CDCA 5DHVA 1KJ2B 3EYOA 5EUOB 2IBBA 5IW6B 4QY8B 3Q6GL 4PJGA 4LVNC 2DRUA 5GGVH 1DE4A 5BQ7B 4O2CA 1OTTD 3ZLQC 4EI6B 4NRZB 3SKOB 3INUH 4KK9C 3MNVB 4YX2L 5BZDB 4QHKJ 5BRZD 1F3JB 4JRXD 4BELD 4S1DD 5C0DA 3TC9A 5IBUB 3BRFA 3FCTA 5EOQL 3DETD 3PGFH 5IMOA 3BH8B 3QQ3B 2OSLB 4F9PA 4M43H 1ZAGA 3UBXA 2F5AL 3F62A 4PJ8D 3RA7H 4PGBB 4UMGA 5JQ6H 3NA4A 2AK1H 1BREA 2Y7QB 1JHKL 1EHLL 3F8UB 3X3GH 3G6JA 4KK8D 1DBMH 8CGTA 5TQ0H 2GHWB 1ZSDA 3MRIB 4HKJB 3U4BL 1CXIA 3LIZL 4L4VE 1WITA 3MYJB 4JM2D 1T89A 3RUGA 4NUGH 2I27N 3TPKA 2ERJC 2D7NA 4N5EC 1UXSA 2VTFA 3TA3D 3M1BA 1BWMA 4APQB 1T7WA 2MPAH 1J7VR 3CXHK 5K59F 3OV6A 1AGEA 1UCBH 4G6AC 2E7MA 1IGMH 3QDJD 2BOBB 4MJIB 3V4VL 1EV2E 3SE8H 1PG7L 3FQRB 4RSVA 4HIXL 2D7TL 4XPBH 1F90H 1W2KT 3O6ML 2AJUH 5D7LD 1MOEA 1X6LA 5ICZB 3IVKA 1OSPH 2ENSA 3BW9A 4MXQC 1RUKL 1FO0A 2D7QA 4K3JH 2B0SL 1RJYB 3BMWA 2H45A 3UTTA 2CDFA 1EIBA 3L7FB 4JG0H 2FEEL 2W91A 3MRGA 4JN1H 4PJ9A 5F1NA 3HMXH 3EOYG 4P9HL 1M05A 2ZOKA 3DYPA 5TH2A 2J8UF 2UV3A 4LEXH 3MCKB 4M7KL 4X6FB 1EBAA 5T1LB 1PKQE 1S7VB 1RSFA 3RGVD 5F7MC 4O5LH 3W11D 3QA3A 3QDMB 1ZT7B 1YN6A 4TNWK 1YEHL 2Y1VA 3ZKQD 4GBXC 5T5NF 1U3HA 2V5SA 1JPFB 4MQXC 3JV5A 3FL7A 1LEIA 3BN9C 2BVUA 4GAGL 2RAMA 5TDOA 2VLKE 2DI9A 3NTCH 3P0GB 5LCVL 5J9PB 4LGSB 1Y6NR 4U6XB 1KACB 1NFIA 4PRAA 3MXVL 4JFPB 5FGBA 1JFQH 3RWJA 4BK5A 4LSRH 1D9KC 2EDKA 3R8QA 1IKFH 4DN4L 3EOBB 3MLZL 1JWSA 2B1AL 3FT4A 4L9LC 3CK0H 4Y5XA 5J6HB 4JRYD 3C08H 3IDJB 5HGHA 1EO7A 2PR4H 3OGOE 3DMMC 2XZAL 4KTEL 2G2RB 4NBZB 3I6LD 2B1HH 1E4XL 2VLME 1DSFL 4BZ2L 2GFBA 4C57C 4UDTA 4WV1C 1T0NA 5TPWL 3MUHL 4NCC2 2ICEA 4QRRD 5JOEA 2VAAB 3D2UA 3O4OC 1YECH 4U2YA 5T1KD 2Z4QA 3T2QA 4JDZA 1F6AB 1HHKB 5DUPH 3QAZB 4P5TA 2IANB 4XAKD 1WFUA 5D2NE 5HDLA 3K2UH 1RIHL 4YC2C 3NCYP 2VC2H 3MRBA 4XVTH 5TQ2H 1IMHC 3V5HB 4C56A 4PRDA 3CDGB 1FGNH 4GW5A 4FXGA 4L8SC 4Y19B 1S7WA 5C08D 2EDWA 3SDAA 5FXCH 2IAMA 4KJQD 4KKCD 1U8QA 1YDPA 3PHOB 4XP4H 5SWSA 3UYRL 4NRYA 5EU5B 1YY8A 1QSED 4G6FB 3S9DB 4AM0B 1YEGL 4KZDL 1G0YR 2R4RH 2HKHH 2GJ6D 3RIAK 1A1NA 1UEMA 3QDGB 4F9LA 1CF8L 3VFGH 5TE7L 1KCSL 4LMQE 3U9PL 4G6MH 2GCYA 2CLRB 3KWWB 3IDIA 3VXTB 1ZMYA 3OPZH 4X6DA 1KXVC 1JGVL 1JBJA 3GSXB 3EZ8A 5D7JA 5CBAA 2XN9E 3HKFA 5T5NG 4XHQA 3VFSA 2NXZD 4E0RB 4OIBA 5ABDE 1ZS8B 3LY6A 1VGEL 2ATKB 4U1LA 2GSGB 3P40A 3SDDD 5ESAA 5I73B 5DGRA 4TQEL 5I1HL 4QHNB 1FVEB 1CGVA 4JFOA 5JZ7C 2RFXB 4HIHA 4FQPA 3GSWB 5IFAH 1F4HA 1TCRB 2V2WB 4KI1A 2XTJD 3FB8A 3MBED 5SWQB 1T7VA 3BXNA 1U8LB 4Z8FL 4G3YL 4GW4B 4I0PC 4NN7C 3BP5A 2XZQL 1KC5H 3HMXA 5ANMA 4YFLI 3WKNA 1GGCH 5SV4A 4LRIC 1YC8A 2A6DA 5KS9A 2D7PA 3BUTA 1F00I 5B8CB 2QKIB 4PGEB 3E6FA 1VENA 4I77H 4MNHA 5C9KA 3O81A 2N7BA 1S7UB 1FIEA 3PL6B 2ZUQB 1YEFH 1ED3A 4S1RH 5I74B 3TIDB 2W0KA 2YWZA 4JFDD 3SCMD 2CGRH 2VN4A 1CDYA 5BMFH 4HK0B 2V6HA 1S5IL 3FFCA 3QFDA 3ZYOA 1U41A 3DRQB 3V2AR 4I0KA 2B8OT 5E70A 4IMLB 3RL1A 2ZSVB 1CIUA 4WGVB 2CIKA 1IAIM 3K8MA 3D3VD 1MJ7L 1TQCB 1P4LB 4FS0A 2KDGA 4LAQH 3FTGA 2DM3A 3KNBA 4PUBH 1PLGL 1FCGA 5EZOH 4PTTA 3GMLB 1S7SA 3LKRB 3LQAH 5DYOB 1T6VN 5EU6D 3ZHDA 1H0DB 3VRLE 1L7TH 1H8SA 2IH3B 2NY4C 5F7KC 3RL2A 3TZVA 3L3KB 1U8IA 3L3GA 1OAXH 2OL3H 1J1XL 4I3GA 2WBJC 5B4MC 3E2HC 5E94B 3U6RB 3MLSL 4JFQB 5EOTA 5FAAA 5I30L 3U2SB 1FZJB 4LSQH 4GRMB 2ZUSA 4JPIB 4OTXL 5D7IE 5L2JB 5CP3H 4RGOH 3FN3A 2FL5B 3ESUF 3VXRA 4X98A 2A83A 1T1XB 3OZ9L 3S96B 3QHFH 4NQVA 3ZKMD 5MENB 5C0IA 3C8DA 5KN5A 3AREC 4P57A 5JR1L 2ZUXA 4RMSA 2OQJB 1YQVH 1AXTL 4PJCB 4Y5YB 3GSNB 3HRZB 4OZFH 3B9KC 1ZVSB 5C2BH 4HJGA 3TN0C 1RZIB 1YMMD 4W81A 5IW1B 1UGNA 4M7LL 2XKNA 5DD0H 3F7PC 3NCCB 1A1MA 4MVBC 3CNKA 2ADFH 2GIYA 4M6OL 3L1OH 1XGQB 3IJHB 3IS0X 3S3PA 1ZXQA 4PLJC 2OXGA 4KRPC 2FBJL 4HC1A 4YFLF 3GSRA 4OGAC 1EK3A 1KIRB 2DWDA 2QQQA 4WI7A 3CFCH 2MQ0A 4MDJA 5GRZA 3RZCD 4TTDC 2LTQB 4XP1H 4XCEA 3ULUE 1VPOL 1NEZB 3U0WH 2NTSP 4QTIH 5TDPA 3OKDB 3FQWB 2G5BB 1N6QH 1R5VA 3E0GA 4G6KL 2RCSL 4ONFL 1IGFH 4OIIL 4H5SA 5JW5A 5E2WL 5KVGH 4XP9L 4PB9H 2RJMA 4Y2DB 1HZHH 2FX9H 5J6GA 5LGJB 2Y72A 2G9HA 3CVIH 2X10A 4RAUB 3TVMC 2J12B 3KJ6L 4URTB 4KY1L 5IVOA 3RX5A 1KEMH 1IC5L 3UTSB 1LWRA 1WTGT 4D0DA 1LNUB 1DUYA 4NO2A 2HRLA 4MX7A 1AR1C 1T0MA 2C3XA 1S9VB 2FO4B 4UOW0 3CZFB 3DXAB 1KYOJ 2R15A 3UYPA 4KGLA 4Z7WF 3VMPA 4IMKA 2NX5D 3GHBH 1A9EB 2H2PC 3QQ4A 5GGUA 1UM4H 4PV9A 2XA3A 4KHTL 5I8OL 3BUYA 2CQVA 2WIMA 3W9DA 3F7QA 4QRPA 3QP3A 4V1DE 4XTRD 3WDHA 4ZUWA 4HCRH 4AQ1B 5K9OB 4DEPC 4JO1L 1AI1H 2YBRB 4HWEL 1HXMB 4RGMC 4N0YH 1G7IB 3LH2H 4U7MA 2FH6A 4X4ME 4LQ1A 5TDNB 3ILQD 5H94A 1ZA6B 3HB3C 5KANG 4I48A 5SWZA 12E8H 5F7FA 4F7TA 1A6UL 4NZTL 1P84J 4OBSA 5JTWA 4NP4H 3VXUD 3VGEA 1M7IB 1SJHA 1EMTL 4B5EA 5JXAL 4PBXA 3QO1B 3UROR 2AEWA 1DVFB 3T1FA 1A6AA 3MREA 5C0AB 1NJ9B 2Q76A 1LP9B 4Z77B 1I7ZB 4OZGA 5DJCB 2KBGA 4WHYH 3PWNA 1YUHA 1G9MH 1OARL 3DRTA 2PW2A 4D3CL 4M1GH 3RTQD 4ZOEA 4NYLB 2VYRE 3O3EB 3TCXA 3DVGB 2GY5A 1KCVL 3MNZA 2HN7B 2ZNWA 2DQJL 3FQUA 3O9WB 4HS6B 2WP3T 2MNUA 1EAPA 4PJ5A 1RZGA 5IFJB 2X9WA 5I1KL 3V5KA 4R3SA 2AEQL 5DK0B 2DQIL 1AHWB 1EEYA 5FYJD 4K71B 1SYSB 3FB5B 4LLYA 4KC3B 3IDMB 4N8VG 4LSSL 4PP2A 2ICWA 3HFML 4KK9D 3DJ9A 4ZPTB 4WCYH 3A6CH 4S1QL 2AAVA 5D5MA 3K3QA 4FABH 1JPTL 5FO8B 3GUTA 5CFHA 4KDTA 4MMZC 2O5XL 3NABH 3QNZB 1NBYB 2UZXB 4PJ7B 4OZFA 4MAYC 4LASH 3GSOA 3IT8D 4WUUB 3O45B 5FDWB 4MXVF 3BAEL 1A6ZA 1H3UA 3BD3A 1NEUA 3EOTL 1CLZH 2C1PA 1PVHA 2VDNH 2X05A 5MEQB 3QIBB 1WAAA 2NZ9C 5ISZB 2NY2D 1FCCA 2BVPB 1LO2H 5I1IL 4R96A 3VXQA 2NW2A 4W4OA 1X9QA 4G7VH 3X3FH 2VDLL 4YXLH 4J12A 3T0VA 3QZWG 4PG9B 5HHOD 4N5ED 4X7DC 1NFDA 2N4IA 1FDLL 3EHBC 3HC3H 1A3RH 4G6AD 3MRMB 4R90H 4D9LH 4OD1L 4OQTH 4X5WB 4P46C 2XACC 3HAEG 1NLDL 5C7XL 4ISVA 4TVPD 3HPLB 3K8LA 1H3XA 5I1LB 3L5XH 5T1MB 3REWA 3UJJH 2YOCA 2NW3B 3TIEA 4Z78A 4DOHB 1MHHA 5F3HB 5KJRL 4KGJA 4CBPA 4ZAKB 5EU7C 5KTEH 5AUMB 2NY5H 4MXQD 3AUVA 3AS3A 5HI5C 4Y1AD 5EULV 4Z0XA 3VJ6A 2R9HC 1BD2B 2X4UB 5DEFA 5D1ZC 2V9RA 1FYTE 1UWXK 3KPRA 4WWKA 2ZSWB 1LD9B 2KH2B 5E5UB 1CFSB 4XXDB 2R4SH 4QXUH 3V6OE 1CG9B 1X7QB 2O5ZL 3EO1A 5A16B 4JHWH 4ZFGL 5JHLH 1ONQA 1GVIA 3UP1A 3FONB 4XXCC 3GB7B 5EO1B 1KGCE 3LMJH 4HCRA 5J89A 2ZJSH 1EXUB 3WN5B 3GHEL 5SX4I 5C6TL 4YHKL 4LSDA 3O6KL 1R3IL 4K7PY 4GBXD 3RHWK 3GK8H 4GG8A 1WZ1L 4MQXD 1QSFA 1FBIL 5CWSA 2GEEA 3OJMB 5EUOE 4C58B 3DOSA 5DWUL 5C0BD 3BN9D 5IB2B 4JJHA 1ZHLA 5F6HI 1WWAX 2R1YA 4JN2A 1Z2KA 5EZJB 4WTXA 3DV4B 4NWUL 2YD9A 2X89A 4DKFH 5D96C 4YZFF 3HNSH 3SQOH 2E6PA 1IQDB 2W9LA 3EGSB 1BIIB 3V8CA 2FSEB 2CIIB 3B9VA 3ARZA 3QISA 1D9KD 5EPMB 5F1KC 1HSBB 3FB6B 5D2NC 1P4BL 4ALAH 1JYWA 2RHEA 4PRPE 5FM4A 4ZUSA 1I75A 4X83A 4E41E 4OSUL 3KR3L 4WFGD 4OGXH 1EGJL 3B2VL 4HLJA 4OF5A 2QSVA 1I8LA 4V2BA 3DMMD 3BGFC 4ONHB 5AEAA 4ZNCD 2KUTA 4ELMB 4XH2B 4QOKD 3QFJB 5AYQA 1Y0LA 2WBWB 7FABH 1D5XA 4K23L 3LS4H 5D2LB 2OM5A 4JG1H 5FO7A 4TTGA 4EVNB 1JGDB 1KTLA 1XGPA 2X4QA 3RI5F 1Q9OB 5ID1A 1BX2B 5IWLC 3Q1SH 3WO4B 1N7MH 1I9RH 2DBLH 2CKBH 4K07A 1WCQA 4M5YH 3MRCB 2C3VB 5GS2H 3KHQA 4MJIE 4ZNEA 5LG1A 3VFOB 2FJGA 3P11H 4IS6B 2BRRL 1WEJL 3IETB 4MA7L 2YC1B 5TF1H 3SE9L 4NRXA 4N0UB 4NN6C 1FFQA 1RK0B 5DEGA 4YAQB 1IARB 4CADA 3BZFA 1I1FA 5DK2B 1RUMH 4HS8H 2Z0BA 5I6XC 1NC4A 3SDXB 4L1HA 1FSKB 1CLOH 4OZIB 3PQYD 4MA3B 2VABB 5DJ0B 3G5XA 4NKMB 3MFFA 1ZTXL 2W59A 2BNQE 1QNZL 2VB5A 4QYOB 2WZPD 2Z91A 1QZ1A 3SGDH 43C9A 5AG9A 4PRHD 3VCLA 4GUPA 1I1AA 4K3HA 1WFOA 3T0EB 3D0VA 3S35H 3ULSA 4UIKL 3ZE2F 4EUPB 4K94H 1DL7L 1JF1B 1U58B 4OQTA 2AI0H 4RMWA 4JZJB 4GAJH 5K93A 2FATH 3FHAA 4JHZA 1BFOA 3PDDA 3BPLB 5IVXF 5LGHL 3CFEB 1XGTB 3B9EA 1CD8A 1BBJB 1KJVB 4HPOH 5IK3A 2W0PA 4O51B 2GK0A 5FA3B 1F2XK 3RQ3A 3S37H 1JE6A 4BZ1H 2AXGA 1H3VA 5LKNA 5BS0D 1FZOA 4H26B 1AFVL 2APVA 4EN3A 1CFVL 3JWOL 1HQ4B 3LKOA 2VRAA 3T77B 1KF9B 3GSVB 2WQRA 3EO9H 3CCHA 2OR9H 1INQB 2X7LB 3LPGA 3NH7L 4GH7B 4I0PD 5AZ2H 5IB4A 1WC7A 1QO3A 2H1PH 3HZYA 3PNWA 3REVB 5KG9A 3P0YH 4GAYB 5ADPH 5HHQB 1MJJB 3SDCA 1E6OL 1IAKB 3WS6C 4UTAH 3GIVA 1CU4L 1QFWM 3EYVA 3RNKA 3TYFA 2A74A 3NFSH 4FQQA 2XPGB 2IPTL 3DSNA 4XC3H 3R06A 5CILL 3V52L 4LVOB 4M9PA 3PGCB 4ZD3L 4JKLA 5TF0A 2PYEA 3HE7C 5HYJB 4ZODA 1RK1A 4UUJB 1SBBA 1P1ZA 5C6WH 4UB0H 3VRLF 1AY1L 1W0VA 1IM3B 4JFEA 4QF1B 5DRZB 5J13B 1HOCA 1D5IL 1WLHA 3WHE1 3BP7A 4YWGH 4NQEB 4RMRA 3EYSH 1I3GH 4H20L 4U1HB 4KVNL 5B38B 4X6CE 1HXYA 4YDKH 2NY4D 1N5AA 4WW1B 4DGIL 4RDQF 3CVHH 5DUBA 1EHAA 1MCJA 1FL3A 3E3QE 2WBJD 5B4MD 3QXWA 5HBBA 3GJFK 4Y19E 5A2KH 3C09B 5JIPA 4XWOC 3MUGB 3HS0B 3QH3A 1BIHA 2X1QA 2BC4A 3MZGB 5F96L 1S3KH 3IF1B 4JAMB 4LSUL 1CGXA 4ZO6A 3O6FA 3FRPG 1BOGB 5IHZB 1UKQA 3H7LA 4NNPL 3VRJB 4H8WC 3ARED 3ULUC 3P9MB 4H0IA 1TJGL 3N50A 2Q87A 3B9KD 4LP5A 4LCWD 5T1DL 5JPMA 2CKBA 3TN0D 4NC0B 3NAAH 5JO5B 3IJYA 2WWKO 2EH7H 2BVQB 3QXTA 4U1KA 3OJVC 3PP3K 4MVBD 2QHRH 1OM3L 5C0RL 1XH3A 5HVFB 3C2AH 3MJ7B 4PLJD 4GG6F 1H3GA 4KRPD 3ZTNH 4W6YB 4OGAD 2AEPH 4YHYC 5KSVB 4M03A 2F19L 3CC5B 3S34L 1OTUC 2F54D 1CLYH 4YUEL 3RNQA 4TTDD 3O4LA 3DURA 1FYHB 4NZRL 1Z3GL 5DT1L 5HJ3A 4O58H 1LEGB 2ARJA 4I5BA 4D9RE 1AD9B 3DGGA 3QUZB 2MQCA 2ARJQ 5TE4H 1I9EA 3WEXA 1X4ZA 4DVRL 2C26A 5JHDD 3KPPA 1MAKA 3MLRH 5FUOH 1T83C 2B2XL 1NPUA 2A6IA 5FUZH 3U0TB 2X2YA 1X3DA 3V6ZA 3O3AB 5D6CB 3MLYL 4HEME 2PTUA 1CXHA 4WEBH 4H1LB 4K7PL 4HBCL 2W9DL 1LK3L 5GRYA 3TVMD 3I2CH 3LQZB 4J4PC 1CFNA 1I85A 4M8QB 1T04B 1KTKE 1MAMH 2IF7A 3QR2A 4Y4HA 5LXGH 2XXMB 3HCVA 1DLFH 1QBBA 5FKAA 5F89B 3ES6A 4K7PX 2VDRL 4GRWF 3WCYA 3LKSA 3D18A 3H0TB 2GTZB 3Q3GB 3BVNB 1TZHB 2HLAA 2OZ4H 3JTSA 1N6UA 2H2PD 1FLRL 5BRZA 1CWVA 1YYML 1MIML 1HHHA 4F8TA 5DJ6B 5EZLA 3OAUL 5DO2C 4E5XA 4LPXA 2VZSA 1VFOA 3I3BA 4RDQG 3MR9B 2DYPD 1IFHL 1DANU 1NGPL 4OCRL 3CFBB 1CTOA 4AK1A 1AO7B 3PHQB 5L2KA 4ZUTB 2VLLB 1T2JA 1TQBC 4HPYL 3WFDH 4XAWH 3I75A 3WNMA 2AJSL 1S9WA 2QLVB 2R23B 4QRQA 3MGOA 4A6YL 4WFHE 1XGUA 3SGKA 4H8WL 4L3AA 3HC4H 5MENE 4IOSD 3DWTA 3DROA 1OGTA 4G9DB 4HIIA 1MCRA 1XR8B 3TA3A 3N1QC 3TH4T 2YXFA 1KIPA 3QUKB 4NCDA 3WIIH 3MLVL 5GPRA 4FMKA 5FCUL 4AEIH 3QDJA 4RNRA 5E08L 1ADQA 1J0HA 4M6AA 3C9NB 1G7QB 5TGBB 3NIGF 4PJDB 4S10A 1XF5A 1U8NA 1H3PH 3VE0A 3QG6B 3QI9A 1KCUH 2L7JA 4D8PA 2IG2H 3OKEB 5D7LA 5EBMA 1RZKL 2UWEA 1BQSA 3P30H 2HH0L 1MCCA 2N7AA 1JRHH 3AS1A 3LKNB 3ZT6A 1BAFH 3W39B 1QSZA 4L4VD 3W5NA 3J8F7 3K1DA 4OB5H 5GRUL 2VLRB 4LVHB 5I1CH 1MQKL 2ZWLT 5EIIB 3MRNA 2APWA 4X6EB 5FK9B 5KVDL 4JGMA 4G8GA 3MV7A 4OFYA 4JM2B 4L3CB 5GISH 1G6RB 4MAYD 2D03L 3T09A 5CEZE 2YN5A 3UEZA 3R0MA 2OTWB 4PJAA 3NCEB 2Z31A 4EBQL 3GSQB 1ITCA 1CGYA 4NQSA 2V5RA 5D71L 3NFPB 4Z7VB 2V7NB 2ZKHL 2FIKB 1QR1A 4YNYA 3VGBA 3IFPA 1VDGA 2IGFL 5CD3A 3D69B 2R8SH 2P43B 1VHPA 3EO0A 5BXFA 4U1GC 5KSBF 3CD4A 3CVHB 3LRHA 1T20A 1JF6A 4KKAC 3DXAE 5KBNC 4LCCA 4PJFF 2VWEE 3B9DA 1J5OL 4HGWA 4NGHH 5J56B 3BE1H 4ZO8A 2C4XA 3EHBD 1IAOA 2XKUA 3WSQL 3V6OC 4AMKL 2H8PB 2IFFL 1IEHA 3SJVB 4P46D 1DQDL 4GKSB 2E5EA 4XBGB 4BZYA 5F88A 1T7XA 4JRYA 3JSSA 1OQXA 4WW2B 1INDL 4LBEA 5T3ZE 5I18L 4QXGL 5DD5L 3VA6A 4BM7A 3OF6A 1AP2A 5AWNH 3RGVB 1R3HA 4YR6A 4JJ5B 5HHNB 1J0JA 1QLFA 4ONOA 4PJEF 3UBXI 3V8OA 4R7DA 4BKLA 5HI5D 4YBLC 1ORQB 3R1GH 2R9HD 1K5NA 5ENWB 3WUWB 2VLKD 5T1KA 5D1ZD 2MCG1 1VADA 5KAQF 4DGYH 2IQAB 2XWBA 5F3BB 3VFTB 5EC2A 2OZ4A 3QEQB 4OBRA 2Y6SC 4HFUH 2BNUA 2IFGA 4P5KA 3D5OF 3V0VB 2NY7L 4AENB 2YMXL 2Z8RA 2AERT 4BK4A 3UYOD 5EO0B 1H8OA 1NCAH 4F33A 3WO3B 1WBZA 1FN4B 1OW0C 3EDKA 1MCFA 4NJAH 4OZHB 1NUFA 3AAZA 4LAJH 4PJBB 5GS1A 2FR4A 1G7MB 2BOCA 1QLEH 4RIRB 4Q9QH 1JWMA 5D8JH 1G7HA 3MRKB 4TRPH 2VLMD 4JDTL 5ETUB 1I8MB 4M00A 4JFFE 3QXDB 1HH9B 1AJ7H 3ZSSA 1WFTA 2CJUH 5J12B 1QSEA 1HINL 5CJXC 3LZFL 4DKAA 4YX2H 2Z93A 1E4WL 1PSKH 3BHBA 3SKMA 4JB9H 5CSBA 3T2OA 3C5SA 2GJ6A 4QRRB 1EX0A 4UINH 2OTUB 3JBG7 4PJ7E 1FO0B 3Q6FA 1D3CA 5GGVY 1A4KA 4KFZC 4WUUE 1BJMA 2B4CC 2H2SD 3C6SA 5GRWA 4Q0XL 5JW3H 5E8PB 1J10A 1G7PB 3ZYIA 1U91A 5E2VL 2AVGA 1RJZA 1IGCL 4KAQL 3GBLA 1OGAA 1JHKH 1F3DJ 5HD8C 1EHLH 5ISZE 1G0XA 4JQXC 2YUXA 4G9FB 4C4KT 4ZDHB 1YEDB 3RY6C 3VI3F 3SDDA 1TVHA 3VFMB 1PG7W 2AABL 3U4BH 3LIZH 5DD6A 3RWHA 5C08B 1NBVL 3MBEA 1HWGB 5IMKB 1FNGA 5I15H 2A6JB 1H15A 3RVWC 3QWRD 2R29L 4NWTH 5HDBE 4W70A 1IC1A 4NQXA 2Y5TA 4KKLC 1JPGA 1A4JB 4LLQA 3L6FA 3HE6C 1LILA 1E4KC 2Q20A 3V4VH 1N3NA 4HWBL 1PG7H 1F11B 4HIXH 4AEEA 2D7TH 4B0MM 3IYLW 2XN9D 3M45A 4WJ5B 2ID5A 4HLZG 1XR9A 5DJZB 1KJ2L 3RUGF 1S5HB 2JJVA 1GOGA 5DSCB 2X4RA 1A7RL 5LAXA 1RUKH 3RKDC 1JWSB 1CDJA 4O02L 1TNNA 2B0SH 4MLIA 4X8JA 1BD2E 3VFUB 5DJXB 3N1FC 3H9HA 1MCBA 3A0OA 5KAQG 2P5WA 2IBZY 4I18A 1OHQA 3MOAH 1U93B 4P9HH 4ZPVB 4M7KH 2GITB 4P2RB 3RAJH 2XTJB 1P7HL 3MV8B 3O0RL 2W65A 3MLWL 3UAJC 4X5LA 4FXKA 5EU6A 1CFTB 1MFEL 4QHMB 5FYJU 1S7RA 2ZNXA 5AYUL 3OXSA 1NANH 5EA0L 4P3CL 1YNLH 4G8EA 5IBUG 4P5TB 1RURL 4XC1L 1FC1A 4N90D 3VXMA 1CD1A 5FYJH 3U0PB 1RVFL 4TSCL 3FO2A 3EZJB 2YRZA 1N2RA 1AE6L 1SYVB 1SM3H 4GAGH 4OCXL 2APBA 1PYWB 2M8XA 3ZMRA 4JFDB 3SCMB 1FNSL 3FZUC 2EEDA 4OGYH 3DUUB 4NZUH 2C1OA 3DHJA 3VXSD 1P4IL 5HHPB 3QUXA 3LDBB 3MXVH 5L9DH 5GJTH 1AGCA 4RFNC 5EG6C 3AM8A 4PGCA 1CCZA 4GMSH 3IDNB 2EIEA 3D3VB 1HHIA 2Q7YA 4XX1E 5GXBB 4LHUA 3MA7A 1C12B 2ZPKL 4MHHI 4DN4H 3MLZH 4MLSA 3D0LB 2YEZA 4LU5H 2MQ3A 1NBZB 3MC0A 2XZAH 5C3TA 3E3QC 5IG7A 4HKZB 4RWHA 1KULA 3HUJA 3UPAA 1E4XH 2EDFA 4Q6IB 1DSFH 3QFJE 1DBBH 4XP5L 5EO9A 1YMHB 1HDMB 1TENA 4BZ2H 1FZMB 5TPWH 1MLBB 3RWDB 4DZ8A 3OKLA 3IGAA 5D2LE 5ESQB 5GRVL 3QDHA 4LVEA 2R0ZL 3FN9A 1FG2A 3UBXG 1TJIL 4CKVX 5C8JA 2FB4L 1QRNA 4WI6A 2Y36L 3SPVA 5HY9A 2YSSB 2R69H 1RIHH 3IU4H 1TTUA 4OM0H 1F97A 3PP4H 3ARQA 2R1XA 3JV6A 3L3HA 4TVPH 3QEHA 3S4SB 1GH7A 1N6VA 2MKLC 5HGAB 4N0UE 2HT2C 1QACA 5CGMA 1YMMB 4XZUA 4LOUC 4XWOD 2K7PA 4PJHA 1C08B 1RQ5A 3G6DL 3BZ4A 3B83A 3O2WL 3SDXE 5I73C 3UYRH 1AR2A 1Q9LB 4P99A 3PDOB 1YEGH 1DUZB 3I9GL 4IDLA 4F8QA 3F7VB 4XCYB 5DRXB 4KZDH 3ULUD 1CE1H 1BP3B 3BKYL 4U1NB 1KIUA 1KPVB 5MEOB 1YNKL 3RZCB 3QFDB 1CF8H 3RWEB 5TE7H 1KCSH 3BSZL 3KPSA 3U9PH 3LKPB 1I8KB 3ZKSD 1CDGA 3I6GB 3STLA 3SKJH 5IIEB 1DLHA 1C5DB 1JGVH 5B8CC 1UQSA 3IKCB 4IOIB 4JVPA 3CU7A 2X4PB 5MEPB 1JYVA 3QXAA 4AT6B 1TZIA 1UB6A 1NGYA 1V05A 2ZUQC 5I74C 3SHSA 3L7EB 2HKFH 5ICXB 3G5VB 2Q3ZA 4JY6A 4UNTA 1LE9A 4FQHA 5DQ9B 1GCFA 5FYKE 1OTUD 4IRJC 5I1HH 4LLWA 1C5CH 2FCBA 1T4KA 4BFIA 2QQLL 3VXPB 1D6VL 1WT5A 1Z6JT 3OJDB 4YHZL 1TQCC 5HHME 4Z8FH 4G3YH 1NCCL 2XZQH 4NT6A 3NPSB 3KPNA 2VQUA 4L8CA 5HPMB 2BNRE 1T3FA 5DC0A 1BZ7A 3MMEA 2PTTA 3LHPL 2GAZB 4CU8A 2A9NL 2CSPA 2NX5B 2Y9RT 2R2BB 4ZYKA 4Y8DC 1ZLUH 4RMVA 4ODSL 3Q5OA 2AEIT 1OP5H 1SEQL 1WICA 3WFHB 2NY3B 4LCYA 4IRZH 4J4PD 3OKOB 4DGVH 3DO3A 4MA1B 1INEL 3U7WL 5HYJE 3JV4B 1S5IH 5DEZA 2UVFA 3SE4C 1JN6A 5ESVB 1U8JA 2W07A 1JK8B 1HKFA 4LFHG 1MJ7H 1NAKH 5IKCA 1J0KA 3T2NL 4G43B 2CDEB 4IRSC 5E1AA 4NDMA 1PLGH 4NQEE 4OLYL 5GGVL 4Y5YC 5E8EA 3VXUB 1W0WA 2P24B 1B0WA 5C0CA 3SGEH 3BPNB 1Q9WA 1B0RA 3TF7C 2V7HA 5DO2D 2JB6A 4AYFA 5ALBL 1CYGA 4NN5B 4YFDB 1NCTA 4OCNC 2RGSA 2YRLA 4FTVE 2L0DA 5IJVA 1DQQB 4LLUA 1JPSH 1VACA 3BH9B 4PJCF 3RTQB 5I30H 4L8BA 2ICCA 2X09A 2V2XB 3VMOA 4WU5B 1ZGLP 1XGYL 1ZVHA 3NCMA 5FHAH 4RZCA 3OZ9H 3VFVA 2A73B 4TSAL 1DBML 2V5YA 4OLEA 1IVLA 1T1WA 3G08A 5FA4B 1A7QL 1GC1C 5F9OL 5BOPA 4NUGL 2F58L 1P7KA 2F74A 2HFFA 2WAHA 4M6NL 2EICA 3MRHB