5EIIG

Structural determination of an protein complex of a fab with increased solubility
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
152
structure length
144
Chain Sequence
SIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Structural determination of an protein complex of a Fab with increased solubility
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 144
sequence length 152
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5eiiG00
2IIJA 2IO5A 2YGVA 4EO5A 5BO0D 1ROCA 5BNXD 2I32A 5EIIG 2CU9A 2IDCA 2Z3FA 1WG3A 2DZEA 2HUEA 2Z34A 1TEYA 3AADB 5C3IA 4ZBJA 4RRPM
chains in the Genus database with same CATH superfamily
2KDYA 3BAJA 3UTPD 1JYVA 3F7QA 1BFSA 4C56D 4L0YA 4YSUA 4WEUD 4FRWA 2NXYD 3WEXA 3WXVH 3WIHH 1BV8A 2VISA 2AEOA 3OJDB 1OF2A 2IDTA 1U8QA 4DKEL 3DBSA 5DJ0A 4MJ4A 1JERA 1SYSA 1TLKA 4LIQL 1DVSA 5B39A 3PDOA 4W9CC 2WAHA 4LLDA 4NQUA 4EZJA 2AITA 1QYGH 3AB0B 1PBYA 2HZHA 1RZIA 2VT0A 3DPBB 4QIRA 1TNNA 4Z0XB 2PCPB 5FDWA 1ET8A 1MCWW 2C3WA 2VDLH 3BAEH 3DX7A 5E2WL 4Z5RB 4NAJA 3CSYB 4WU5A 1L3WA 4KJPD 1IGYA 3DTUB 5GJTL 4G6AD 1LVEA 4PUBL 3NIGE 5I1KH 3OXSB 3MU3A 1ED3A 4KTDL 5BZZA 1A66A 2BIIA 4HJEA 4H25A 1IIKA 5BZDA 4PWGA 5LVEA 3OAZH 1DZBA 3U6RB 1QRNA 3TF4A 3BUDA 2Y6SD 3LPGA 2UZYA 4MVBD 1W72L 2NX5B 4HPHA 2J6EA 4OQTL 5I15H 3T04D 5ADOL 4MJID 4X6BB 4CBZA 1HZHL 4NZFA 5E8NA 4TQEL 1UHVA 1KBWA 3ZT7A 4XVUC 4MZIA 4WY7L 3PPEA 4N2MA 4CN1A 1MCIA 4ZSOB 4WSKA 2X4SB 1HHIB 1G7JA 4U3CA 2IAMD 1WBXA 2WTOA 4FQIL 3QG7L 2V3EA 4G8EA 5GSVA 5DJ6A 1MRFH 1SLUA 2HRGA 4KTDH 1HVXA 4KRMB 4KU1A 3US1A 2OJZL 4N8UA 1QNZL 1W9XA 3UG3A 3C6SB 1E8ZA 3VXRD 2Y7QB 2EIJB 2DD8H 4L5FH 1A4AA 4PCSA 3GZOA 3ATDA 4L4VD 3MMEA 5TH2B 2NY4B 1AAJA 4ODWA 2OSWA 1MJ7L 2R0KH 1Q9LB 5HDWA 1V55B 4YUEH 3AU1A 5C0DA 2DICA 3SDXF 4O02A 2Y07H 1PGRB 1GMIA 1NUFA 3NZUA 1K4DB 4G2AA 3BQUB 1BFOB 3V0VA 2AFNA 1OV8A 4XTRD 2B7DT 1EFXD 3A24A 1EZVX 2PO6D 2CBTA 4OB5H 4AE1A 3QJHA 1BQ5A 3O6FD 3KHQA 5E6IC 1QNIA 3ZHLA 2P8MA 3W9DB 3QUMB 5LNGA 3F85A 3L3KA 2DIBA 1U8KA 2H6PB 3NN8A 2JJVA 3AREB 1JK9A 1WAAF 1R3IH 2FSEA 3C6EA 4IDJH 2ZJSL 1CYXA 2MPAL 1MAML 2G60H 1RUPH 3ZL2A 2PWHA 4F5CA 1KY6A 3IMTA 4NKIH 3S96B 3TYGL 2ZUSA 5IQMA 3JBG7 2YUZA 3OJ2C 5IROC 4LP5A 2CLRA 3JYBA 4RMWA 2GHZA 4PRNA 1B3IA 3WHE1 3CN4A 1JXJA 3C5ZC 2AEPL 4P9HL 5D9SA 1A8JH 3CC1A 1B6UA 3RG1C 2ROYA 3WSQL 4QPEA 3TEUA 1Y1UA 4AJVA 4GPVA 3TBCA 5FYLH 3IJEA 5DK0B 1A7RH 4TKWA 4X5PA 1WCBB 4LNRB 2EDMA 3RJOA 3TBTA 3EXJA 4BZ2L 4YPGA 4E9YA 3QZWG 5T5FH 4HIQA 3MCKB 5DD0L 4A7TA 1HH6A 3EFDL 1AXIB 4NO0B 4OLYL 4UI2A 4Z7VF 4J3OC 4BQ6A 3LN4A 4CN6A 4AYGA 2MNUA 4LK4A 1KTRL 2YMXL 3BPLC 4X5WB 4X98A 1MCNA 3OMNB 3TO2A 4Y16B 5IJVA 1ZLSL 2EIZB 3VH8B 2Q2LA 4X5LA 4G7YL 4ES9A 1QBAA 3H55A 1BSIA 4FFZH 2CUMA 3L4YA 5HYQA 1ADQH 1J8HA 1GGCH 4M9PA 5BV7B 5C7XL 3HZYA 2YPKA 4A6YH 3IKCA 2DQIL 3NDZE 2I5YH 3QS2A 4JFDE 3JTTB 4OT1H 4MD4A 1JJUA 3T65A 4D0DB 4Z3GA 3CUPB 3MLPA 4U1LA 1KV3A 4LU5H 4ODUB 4YDJA 5KYYA 4LSVH 5GSRA 3D30A 3NIDE 4LZKA 5FM5O 2Z7YA 2GSMB 4EI0A 1FPTH 3F12B 3I75A 4NQCD 3ATFA 4KK6D 2XN9B 5JIMA 5BXFB 3P40A 3FXIC 1CD1A 1TZGL 3B4NA 3P3SA 1NICA 5CUSH 1QFOA 1KJVA 1QFPA 3G5ZA 3MLUH 4IU3A 2YSSA 4GQ9L 2IGTA 1A47A 3NJFA 4NZUH 4DP5X 4PRDA 3NEEA 3JV6A 5FGCB 5HD8D 3IF1B 2HFEA 2RR3A 5BZWB 1L9TA 3ZL1A 3CVIH 5CEZH 5GGSA 4QD2E 1H3VA 2WIIA 4NXSA 1DJXA 2CSPA 1FYTD 3MKGA 5ACZB 1U8IB 1RJZB 3UTSB 3II2A 3EG9B 3F83A 4UDTA 3HUJA 3I9GL 4RAHA 3DX4A 1FO0A 1OLLA 4B50A 2VC2B 3PWLB 5T3ZH 5KUMA 4HKBB 4LASH 4M29A 4OI9A 4Z95L 1DEEA 1NZRA 3LV3B 2SODB 3MV11 2HUEA 4I9WE 5EC1B 3T4YA 4XN8A 4Q4EA 5AAMA 3RI5F 3EH4B 3V4UL 2XXGA 2MPVA 3FUEA 3TO4A 1A2YB 1UATA 4APQD 2E74C 5D7JB 2A7BA 5K93A 2YN3A 2GT9B 2C3GA 3RWFA 3EJTA 4I4WB 5SWZD 3WG7B 2D3JA 3AROA 3BHBB 1QPPA 4Y2OA 2B14A 4L37B 1G7LB 1LEKA 3BUQA 3DURB 1XCQA 4JCMA 5D1QA 5EUKB 1LK3H 5IGXL 3WU1A 2JELH 1RJYA 4HLEA 1CS6A 3W3BA 3RGVD 4WWKA 3E3QE 1E9OB 4MJJA 4UV7L 2AEIT 4FI8A 2XX1A 2QQLH 5DJ8B 3KEDA 4ZS7L 5IR1B 1EXUA 4LVEA 4PB0L 1S7TB 4PG9A 5AW3B 1JGEA 3EHBD 1CE6B 3LEVL 4NZRH 2NCMA 3MOBH 4MLIA 1ZSHA 5BW7A 3ARDB 5C0BB 1ILSA 3GXDA 4JQIL 1PSKH 1U92B 1WWWX 4GG8B 4WW1A 1DR9A 1TTCA 3OAZK 1AIZA 3LNHA 3CD4A 4O5LL 2R1WB 1E4XH 1MCLA 3OXRB 5IHUH 4DK6A 3QQ3B 1ZV2A 3KDMB 3S3JA 3W5MA 5IHHA 1I75A 3C5SB 5H37A 3ZDXF 2PYED 3FCBA 1QX1A 1NIFA 4MCYA 4IU2A 4L8DA 5C07D 4OJFL 4Y4KD 3CXHK 4GUOA 1UFUA 4HFUH 1NTDA 2X2YA 5I1CL 4OI7A 1L5GA 1TVBB 1MLCA 3SDXA 3M6DA 2UY6B 3O3EA 3BWSA 2YD2A 3U2SB 5FK9B 3R06B 1BHGA 1JPFA 2MNJB 3ESPA 7PAZA 2OR7A 4IRSD 5DWPA 5E08L 1IZJA 4IIQB 3QISA 3TYFA 3EJQA 4AL8H 4EOWH 4Z3TA 4V1DA 4O4YH 1CDGA 3N43B 4HIIB 4UF7C 4NP4H 3SQOL 2Y1VA 3HAEG 4F1ZA 5CS7A 3VB9A 3VVWA 3ESNA 4AIEA 1FRGH 5GGVY 3V0JA 2CKBA 3F65A 4OZGB 4LCIH 3BKCH 4OCYL 4WKZA 3RDTD 3VG0L 3ALPA 1NBCA 2R0LH 5HDQH 4HEMA 3L8QA 3T6VA 4X9YA 4F7PA 2MSPA 1QUNA 3TURA 4LE8A 4LSTL 3S97C 2NUPB 3GSUA 5ACLA 4G1MA 3VRLE 3S9DB 4RMSA 1I85A 4PJDF 2IOIA 3MRCB 5CILH 1KXVC 4HMDA 2XNAB 4J27A 2KZKA 3OZ9H 4IIZA 3W57A 5I16A 3BZFA 4K07A 1AFVL 3R0NA 1L7IH 5JHDA 2LW3A 2IAAC 4PJ7E 4YBQC 2ESVD 4QRUB 3QI9D 3D7PA 3VFGL 1XGYH 4ZYKA 3MV9D 5I8KL 3V0WH 3SQOH 4AMWA 2E6JA 2IFGA 3SPJA 4OIAA 1Q94A 2WTPA 2MRYA 1TDQA 4OCYH 2SEBB 4HC1A 3FH5A 5HHOA 1MLBB 1PQZA 1QSEE 2ZG3A 2IF7A 3CSPA 4FG4A 4J6RL 4YDKH 2D3VA 3B5TA 2Y24A 3BIBX 1GVIA 5F6HI 2ERJC 2PR4L 2J5LB 2NR6A 4GMSH 1AD9A 4OZHF 5EUOB 1QR1B 1ID2A 2GPZA 3WIFB 1E43A 3GF8A 1GKEA 1K8IB 2GKIA 5AVTB 3FT2A 8CGTA 2X4RB 1T22A 2VZ3A 4JFFA 2YO3A 4JRXD 1EEYB 3GM8A 2IBZX 4GP4B 4PJXB 2ZONA 3LS5H 4HPOL 5D1ZD 2Z92A 3US9A 1AQKH 4JM2F 1OGTA 3EYFB 4L9LA 1PZCA 4LPUA 4YOKA 2HTKD 4FE9A 7PCYA 1I9IL 3CMOL 2C9PA 2DI9A 4WGWB 5GRVK 1KENL 2VLRA 1HOEA 4K3DL 2IH1A 5K9QI 4CU8A 4KKQA 4ZOBA 3TFKD 1MIEH 2Z31B 3FQNA 3QFGA 3QNFA 4F24A 4TOYH 4OTXL 3P2TA 4NQDD 4QCIA 2BFVH 4IEFA 3QYMA 4POUB 3DTXB 3IDYC 1MJUL 1AY1L 2D7OA 2EJ1A 2WQ8A 3CDCA 2DQJL 2P5WD 4TNWF 1IV8A 4LESA 1J0YA 2PPCA 4M5YH 3W0WA 4RFEA 4NFCA 3V9EA 2PTTA 3M1BB 3KLKA 4XVJH 3SBWA 4GLRH 2EINB 1OSPH 2ITDB 4NFBA 1WFUA 2V7HA 1GGIL 4FHJA 4HJIA 4UBDC 4XP9H 3GIVA 5T1DL 5J5EA 1R3LB 1P69B 2GI0A 2R29L 3E6HA 2WLKA 3AWEA 4FQCL 4XCYA 4ZK8A 1M7DB 4B0MB 3VD9A 1WFMA 1SY6H 2X87A 4OCRL 5B3SB 1KFAH 3ILQC 4Q0XL 3C6LA 3N1MC 1BM7A 2MNWA 3MV01 3R19A 4LLYB 4F33A 4JHAH 2ICWA 3O45A 5IV2B 2EKSB 2XBTA 3OLEA 4M7KL 4KJQC 4H1LG 4JDVB 1F58H 1E8XA 4PRPB 4QRRB 4D8PA 5JR1H 3S35X 3TCLA 4AVJA 2F7PA 5T1KA 1MVYA 1AGFA 3DETD 1R5WB 2NY3B 3S35H 4ZI8A 3GHBH 5MEOA 3CLFL 4G7RB 3S3CB 2W9DL 2RBLA 3MUGB 1YN6A 1JGLL 1GGIH 1IM9B 2HJKA 4IBWA 1IKNA 3B56A 4GUCA 2DEXX 5ANHA 3MTXA 2BNQE 2ICWI 1Z7JA 1BZ8A 1UM4H 2K3TA 1BXXA 4OCRH 5GGRA 2BZCA 1ETZA 1I8IB 4FCHA 5ALBH 4BV1A 1AZUA 2G2PA 2W65A 1RZKC 4IKJA 1RIUL 1IFHL 3QQXA 5D2LB 3SDYH 2K6WA 3GSNH 5HGAB 4B95C 4YVUA 3MRMA 4NCC1 2IV8A 2E46A 3BSZH 4LHUG 1FL6A 4ADGA 2A6KA 2DPKA 4LPWA 4YXHL 2DWEA 3FQWB 4FLQA 3QYCA 4KZ0A 4UUJB 4ZRGA 4KVNL 4LCVA 4ZDHA 4AYFA 2A6IA 4HETA 4WI0B 4G5ZH 3LQZB 2KPWA 5LJYH 1I9RL 1E67A 2W9DH 4Y4HB 5DJAB 5JW3H 4ALAC 1UYWL 2X89D 4M02A 3H4HA 4R2GB 2AZUA 3KPOB 4LLVA 2VMCA 1HINH 5JHMA 1ZS8A 3MRNA 1MREH 5EIIA 3GTNA 1KN4L 2Q76B 5FUZL 3L4XA 2Y4SA 3G5VB 4D9LL 1N5AB 1T04B 3NJVA 2CUHA 4J1UB 3VI4B 4X6CB 2C9VA 3JUYA 4K7PL 4HT1H 1EEUA 3U9UA 4LGRB 5JMOC 4XXDB 2CLZB 4JFOB 2XG4A 1U4FA 1AXTH 1U30A 5T1MA 5TE6H 1FFRA 3VXTA 2CIKB 4YXHH 3QUZC 4KZDH 1EHKB 1CQKA 1MJ8L 3M17A 3B3IB 2LQRA 2P8LA 4X7EC 1DVFA 2VXSL 5EF2A 2H2SC 5ITFA 2MCG1 2BSSA 1X7TA 2DRUA 3DV4A 4H5SA 3REWB 3BN9D 5E5MA 1PIGA 3LKRA 1G9NL 1NFAA 5LXGL 2UXFA 2YXFA 4X6FB 3P0VL 4PJ5A 1HFUA 5ICXB 3FT9A 1KJ2L 1R6VA 3GIZL 4X4YB 3QNXA 1IC4H 1OGSA 1I1FA 2QQKH 3A5VA 3NJMA 4K7PX 3TA3B 4N1EA 4PJDA 2ETWA 1Y1DA 1KCSH 2XETA 4NQTA 4G7SB 5E2VL 2XQYG 3HE6A 3MLTA 5DZOA 4PJHB 4HH9B 1R5IA 1AI1L 4AQAB 1A9EB 1RHFA 3D39E 3QYNA 2QGEA 5GRWA 1GGBH 3E2HB 5ETUA 1A5FL 2IG2H 4PJBA 4U1JA 1XIWB 3RNQA 3TJPA 5C09A 2ZPKL 4U1HB 1S7WA 3KLAA 2UZPA 4PU2A 4KTEL 4GRMB 2V2TB 4YHNA 1S7SB 2K6ZA 4HS6A 1NAMH 1C16B 1NOFA 4P5RA 3S4SG 4OD3L 1JZDC 4GUPA 5E24E 1AHMA 1I85C 4GSDL 1YEDB 4IJ3B 3WE6B 1EUTA 2MCAA 3QIBC 4XO8A 4OZHA 3W11C 4ONGH 4GW5B 4Z23A 1T80A 1BAWA 3FN0L 1F6AA 2O6FA 1E2VA 3WYRA 3L3GB 1CDIA 1RUAL 4N0UB 1M6OA 2VQTA 5GZNA 5HJBA 2ZX8A 1J5OL 3UTTA 1NCTA 3CZFA 3OL2A 4KRLB 4FNLL 4UQ3B 2WD0A 2ZWNA 3I3DA 4OCLC 4XP6L 3VU1A 1R0AL 4OGQC 1OO2A 3GS0A 5I18L 3BLPX 2BJMH 1TZ8A 4JZNB 1DJZA 4HWZA 5LBSA 4X42A 4I88A 5CIPH 2NUTB 2Z6FA 3WS6C 4CILA 3B7UX 3P4MA 4MD0A 4E0RA 4HUUA 2DWTA 3PP4H 4AYDC 3U9PH 2CHXA 3HS0B 3RIKA 5IK3B 3S7GA 1CLCA 3UOAB 5HDBB 2ZG2A 5KEZA 4K3HA 1IAKB 1FFPB 3FT1A 2BIHA 4ZXBB 3H9SD 2E27L 5GS1B 3T8XB 4A2DA 3S88L 3BWUC 2IFFL 4XE0A 1RSYA 5K33A 2G9HA 4HZ1A 2AABL 1UQSA 2FEEL 3TVMC 1IGCL 3QUHA 3PE9A 1DQQB 1IBFA 1K3IA 3GI9L 3ZQ9A 5EBLA 4IK7A 1ESOA 1TPXC 3BUYB 3NCXA 4Y88A 1OP3H 4BCYA 4BCXA 3WIAA 4F7CB 5D71H 1CLYL 3B2UC 4XVUD 5GRUL 2FEJA 3COOA 3ZMNA 4XH2A 4NAMA 3QDGD 4A6YB 1Q38A 4FTVE 2X0UA 3HRPA 4B5ZA 1XSJA 4P5TB 3BFOA 4TL4A 1SJHA 4WHTB 1SHSA 4XCNB 2BY1A 2X4QB 5C70A 1SEBB 1M7IB 4ONFL 3IAQA 4H1LA 3QEUA 2P7TA 3ZRSA 4A68A 5HHMD 3LZLA 1ZLVH 5I73B 2J55A 1A7NL 3SBWC 3ATBA 2DLGA 2GG1A 3Q13A 5L4JA 2F74A 1L0YA 2LVEA 4NFDA 1S7QB 1CDUA 5BO0D 1AO7D 4RFNB 1FYHB 4QOKA 4YHPB 4ZZKA 3RWEB 3QRGL 1XF5A 1XF4A 3EYOB 3I02A 4YHOH 1JIBA 5ANME 3HB3C 3C6LC 4HIJB 3SE6A 4KRPB 2AI0L 2BVQA 2Z93A 3SE9L 1IGJB 3H53A 3ESOA 4ODSL 4WLCA 4X7TB 5CN2A 3W9EB 5AB1A 3CBJB 3MODL 1B4TA 1L7TH 2DKUA 2YAOA 3WFDL 4KITB 2ENQA 4NWUL 4ZO7A 2XKNA 4EIBA 4URTB 3DYOA 1BYPA 3E3QC 1T5XB 5DFVC 2ENYA 5J8OA 4TQ8A 3VXUB 1DANT 2VITA 1HDMB 2XOTA 1G94A 4FJ6A 4KO5A 3JT0A 1GGTA 3BT0A 4KDTA 1JZEA 3TWCH 3WOVA 4Y5XC 4L1DA 1PLAA 1YMME 2LE9A 3K4AA 3U2JA 1BIIA 4B9JA 4XHJD 1AD0A 2KQNA 2FO4A 1AGCA 4H26A 4HH8A 1A6ZB 2ZKXA 1BF8A 3WIIL 3N2JA 3GGWA 5E8DL 3TONA 4UT7L 4N0YL 4NKOB 2RAMA 4HAGA 5IROD 1J0IA 4MTMA 2BP5M 1UD4A 3FFCB 3O2DA 1YYMH 1PAMA 4Y4FB 1HXYA 1J9QA 2AV7A 3CVHL 3EXLA 5MEPB 3C5ZD 3ESUF 4JN2A 1U8LA 5C0CA 3QJFA 3B7SA 3RRQA 1KELH 1DQIA 5LCVL 3MLYL 3SYAA 4AEHL 2IANE 4M6OH 2ZNWA 2G5BB 3ULVE 2ADFL 2WBWB 3UJJH 4GKNA 3THML 2J44A 2OX5A 1J86A 3IVKA 1BFTA 1Q0YL 1BD2D 2AMUA 5C0JB 3FONA 1HH9A 1VIWA 2XTJE 3U1PA 4C54A 3U1QA 4PSRA 2D7NA 2WSDA 3LN9A 1JXFA 1PZDA 2NNRA 4J3OD 5I1GH 2WLLA 3QO1B 4PV9A 4XP1L 1ZJAA 1D6VH 2X3AA 1WH0A 4YSQA 4WI6A 2ZP8A 5I0YA 3OKLB 4R8WL 4YDVA 1JVOA 4B96A 3PHQB 1Q90A 4BZYA 4A2EA 1KBBA 3INOA 5DUJA 5JPNC 4GRLA 4MS6A 4KK5D 4WWOA 3LZQA 5LCVH 2XQYA 4P3DB 1E50A 1IQDB 1MAKA 3RKPA 5LKNA 5F89B 1F90L 4E41B 1CE1L 2V6HA 2BVOA 3RX9A 3VXME 4NKQB 1HHKB 4PV1C 1RU9L 4OLEA 2LAAA 5J56B 1S6NA 1LJMA 4UDUB 4DEPC 2KL6A 4HWEL 3BP4A 1FL5B 2VW6A 4LQ1A 5C92A 2A6JB 1H9DA 1KPVA 1D9KB 2C4FT 1SEQL 4K5PA 1UCBL 4E9LA 1TENA 4U0RB 2Z0UA 2GITB 3QIUB 4HV8A 3OC5A 3U46A 3VXPA 1NCOA 5LGHH 4MNQB 2DMHA 3OG6B 5L2KE 5J6GA 2ZXQA 4QHNA 3X14A 4A7SA 1Y6NR 2GCYB 2EUZA 4YE4L 3FRPB 3ZUNC 3GKZA 4JAMA 1E5CA 4P4RA 2H3KA 2MKWA 5BVPH 1DQDL 3P11L 2JQMA 3I9IA 4G8IA 2QHLA 4JO2H 3W38A 4RDBA 1S7XB 1ZVNA 5EO0A 4XNUH 3L2LA 1YYLL 4TNVF 1DL7H 1SXSA 3F7RA 2AQTA 4KQ3L 4N26A 1FAKT 3JWOC 1OM3L 1KPUA 2HTLD 1DQLH 3QAZB 2Q7YA 1CLZH 5KW9H 4URKA 4HGWA 1UWXH 2ALWA 3CHSA 2X9ZA 4NIKB 3C87A 3FTXA 3VM5A 4ZUTB 3AMKA 3RVVC 4PRHA 1WBZA 2MQ0A 5CP7A 3GS7A 5CO1A 4G9FB 4EXKA 3Q6FA 2VXUH 2WY3B 1LO5A 2VR9A 3QDMB 1TYRA 3OHXA 4Q9QH 5FGSA 1MCDA 3TIEB 1TJGH 4IOIA 1I8MB 3OX8B 3QQDA 2Z4QB 1QAWA 5IESH 2CWRA 2G0LA 2G2RB 1Z9OA 4KKBC 3P54A 4QXGH 4F7MB 2W60B 1JZIA 2A6DB 4QHLA 3JTSA 5FR3A 4L4TA 4P46B 2IADA 2QSCH 4XMKL 5HHXL 5F7DA 5I24A 4M00A 2APWA 5C6WH 3A6BH 4KXBA 2DQCL 1OPOA 4UWQB 3MGOA 5IQ9A 4RA3A 2X28A 4JG0L 2PR9A 1FFNA 1KGXA 3TL5A 1L9SA 2BNRD 1IM3B 2HT3C 2EDRA 1AC6A 1A0QH 4DGYH 4DH2A 3QHTC 4LAQL 1XCTB 3QP3A 3R7QA 1IFGA 3B1UA 2WLNA 2UZXA 4DUWA 1CO1A 1CT8B 3QXDB 1J1OL 4MJ5B 5F7WC 4X8JA 2WXHA 5I1HL 2OQJA 4G43A 3X1GA 4H2CA 3NP3A 1SVBA 3QCVH 1YG9A 3BI9X 4DQAA 1ZKAA 1MDAA 4H13C 4P23B 5CJOH 3HS9A 2ADJA 2P24B 2WIMA 1CDYA 2J6EL 4N24A 1NPJA 5ESQA 2XXCB 3NABH 3CFQA 2KZBA 3RP1A 2FUQA 3O9WB 4MZRA 3KYMB 2AJYL 3IFLH 3WTVA 4HK3N 4MXVF 1ZLVK 2GIXA 5K59F 1M6UA 2FNWA 2WANA 3ARVA 5B1KA 4Z7OE 5CFHA 1KXHA 5HGHB 4UZSA 4FXLA 4OCSH 1KPRB 4APXB 3EBHA 1FNLA 4ANXA 1NCJA 3QUKB 3T0WA 1KYUA 3GJEA 1EZLA 4YSEA 4KC3B 5C86A 1IEBA 2LABA 3NA9L 1J5HA 5T1LA 2A9CA 3SY0A 1JPGB 3QPXL 5CFAA 4O2CB 3HZMA 2NYZA 2L7JA 3K7UA 1DSWA 2VKXA 4DFIA 1F00I 5DZAA 4GO6B 5E7FA 4WQOA 4P2RD 4ZFZA 1JGVH 5AWNL 3FU5A 1E65A 1OW0A 3TZVA 3EOAA 1RCYA 4JFEE 4G6FB 5J89A 4MB3A 2V9TA 3C8DA 2HKHH 3HVNA 1VAHA 4OVUA 2DJ4A 4P07A 5I74B 3NUKA 4TUJB 5SWSB 1WISA 2MCPL 4U6XB 3E8VA 4ZAKB 2NTFA 6CGTA 1LWJA 5EIQA 1OGPA 4KKNA 2F54A 2BP3A 4ZUUA 1X5IA 2EXWC 1CJYA 1ZLWH 4XP4L 5D8JL 2PUQT 3HCVA 3BPNB 3PAZA 4ANWA 2Y69B 1B4RA 1A9VA 3REVA 1NCHA 2XRAL 4AG4H 4PLKC 4HUWB 3TBWB 2ZP9A 5C7ZA 4PJEA 5EU5A 1JD9A 3GSOB 1FE8L 4QT5A 2A2QT 3GXMA 3VD1A 3ARRA 5K1VA 2FX7H 4PHZA 3PAYA 4LRIC 5HJ3A 1AP2B 4O02H 5I5IA 3FRUB 5C0EA 2CJ3A 1F4YL 2YPLB 1OSEA 3QQNA 4NQSB 1J8SA 4OCXH 4WNQA 2QSVA 4KVCL 3T08A 4BDVB 2XZZA 3NJNA 3GBDA 2F08A 4PGBB 2XV2A 1OSZB 2DQGL 1FI8C 1MI5A 4ODVL 2X6CA 2K8MA 5FW7A 1NA8A 1NLDL 2ADGA 4BSVB 1DBAH 3B2DC 3T0XA 3R0MA 1BJ1J 5BUAA 3GINA 2ODIA 4F8NA 1IEHA 2VAAA 3QZOA 2VOTA 1QSFD 3N1FC 5F9WB 1PKQA 1NMCC 2FIKA 1NGYB 2V8MA 4TLTA 3L3IA 2DS4A 2HG5A 5D7IB 3FFCE 5IW6A 5CZRA 1VKXA 2WUBL 3WTYA 4UINH 1X44A 2DIJA 2GJ6E 1QOKA 3IJYB 4PRIE 1HWWA 3HHMA 5INDB 2EDNA 3UC0L 2LR4A 2D9CA 3Q8EA 4XRCA 1IE4A 2EE2A 1X4ZA 4JB9H 1F4YH 2ADIB 4GAAA 4UBDD 2FYYA 4HAKA 3SCMA 1M9SA 2O6PA 2P49B 4CC4A 1LE9A 3FQ2A 3FUFA 2UWEA 3G9AB 4XMXA 2BSEA 1R3HB 4H8WC 5F1IB 1GYWA 3PQYD 3ILQD 3MROA 4RAUA 1URLA 1H15B 1JDCA 4I0PB 3T71A 1DLHA 4ZD3H 4XNDA 1N64L 5J3HC 1F3DH 3VI3E 4N9OB 4GT7A 2WN3A 3L1FA 1E3FA 3N40F 4KJQD 4QJ5B 4GH7B 4W4OA 5DEFA 4FZEH 1PY4A 5KVDL 1YC8A 3QUYA 3DYPA 4W1TA 2YEVB 4JPSA 5FYJH 1WGVA 2WSPA 4PVMA 2EDHA 1NAMB 2FX8H 4P59L 5F7KC 4YHYC 4HUXB 4XCFH 1FZMB 1G87A 5CLYA 2YUXA 3K2IA 2TSBA 2NTSP 5LDUA 2ZSWA 5CZXC 2QGBA 4K73A 4N5EC 3JV4A 5E51A 3G5YA 2AK4A 4NNYA 3S3SA 1Y0LB 4U7SA 2B0SH 5D7LA 1UWXK 1JUFB 1BQUA 5CM1A 5B4MC 2HFGH 3KPLA 1I8AA 4P4KA 4PTTA 5I71B 3QXAB 3UG5A 3CVDA 1IKFL 3FS9A 3X3FH 1SJXA 4U33A 4F7EB 2CUAA 5C8JA 4PJGB 4XB8A 2J6WA 5CIPB 1H8LA 4WK4B 5LGJB 4Y2DC 3K2KA 1J1PL 2AQNA 1C7TA 5EWIL 1FO0L 4K9JA 1RZKL 1OEZW 4D8OA 1HC1A 1XGPA 2CJUL 3OHXC 2WHVA 4WV1B 5DXWA 1MHHA 3LS4L 3HPJA 2NY2B 4EI5A 3EYSH 5IVZA 4TVPH 1NLBL 2VIRB 2VSMB 4Y9GA 5ISZE 1RXLA 4EN3C 2EYTA 2R4SH 4ZUVB 2Z4TA 5BNXD 1U8NA 2J2ZA 2XG5A 2XIDA 4WUKL 4W9FC 2CDGA 4FZ8H 4EDWL 2ZYHA 2OP4L 4ALAL 2WLIA 1IKFH 2IGLA 2FGWL 1E4HA 4HSQA 4Z7WE 1RPQA 5DLLA 1H8OA 3B37A 4XNYL 3WY2A 5CD3B 3QUZD 1S7VA 4MX7A 2G75A 3EO1A 4P5MB 3MGTB 5D1XE 3ZTJG 1NMBH 1FCCA 1U58A 4P57B 3MRJB 3QEQB 3CFBB 5FYKH 3T8MA 3RA7L 1G7PB 4Y9FA 1KACB 4IKNA 4DVRH 5I6XC 4YEEA 1FFOB 4XX5A 1N18A 4WTZA 5C0FA 3MNVA 3NCYS 3VE0A 5D7KD 3WTSA 1RZ7L 5DVPA 1WT5A 1P1VA 4CVZB 4PS7A 5BCAA 1EQWA 1ZVSB 2OSLA 3CZGA 3JQOB 3VGAC 5AW0B 1KN2L 2GBTA 2ZICA 3ZKSD 4DGVH 2VDPH 3HC0B 4P5SA 1YUHB 1HCYA 1NDTA 2BWQA 4MAYB 3HN5A 5TK4A 1U91B 4W9JC 2HP4A 2OL3H 3RX8A 4XT1C 3EZ8A 4MMXA 4HMEA 5IMKA 2C4XA 3C5JB 3L3OA 4H2AA 1SXAA 3CXDH 4NZTL 3K6OA 3RA7H 5J06A 3H3KA 3VXSA 2Z35A 1KSRA 4KZEH 1IQWL 3AABA 1THAA 3SKNA 3ZTNH 1G7QA 2AQ1A 1MEXH 3R18A 5F7FA 3ULVC 4R7DA 4UQ2A 4N87A 2JCCA 2NZ9C 5CP3A 3P02A 2JQAA 1RMFL 1J0KA 5IB1B 2CKBL 2AXGB 4R26H 5EU6B 4NKDA 5D2NE 4RVBA 1RZGB 3QIBD 4NO2A 3C8KB 4JMNA 3DIFB 3W11D 1U2YA 4HOZA 2OCFD 1Q1JH 3ORJA 4JN1L 4HP5A 3FTUA 3FFOA 3BVUA 3NK4A 4I18A 1H5BA 5I8CA 3ISRA 2EILB 3SDAB 1PLGH 3TZVC 4O2FA 2C9QA 2KZWA 4IGBA 3ZGIA 3V4VA 3ARBB 5D7EA 4K3EH 2AJSL 4GAJL 3NIGF 5E1GA 5HHOD 3TN0A 3WMPA 5EEVA 4MA8L 2FL5A 3O6KL 4P48A 1KB9K 2GUOA 1MFBH 3V7MA 1WS8A 4K7FB 1Z2KA 4JZOB 4W9GC 4YNYA 4XPGH 3B6SA 3BQVA 2RTTA 3VDCA 5HYJE 2AKRB 2K6YA 1BZOA 4JFDD 1DUZB 3N44F 1P6FA 1OVZA 3PFQA 1I3GL 3ZRCC 1XH0A 2D7TL 5F3HA 1FIGL 3PWPA 2YOCA 3UJTL 4RZCA 1NCUA 3EKCA 5F6IC 2VE6A 3SDDB 5JIHA 1FJ1B 1NC4A 1C1EH 3NZ8B 3TVMD 1X5AA 2Y5TA 4F7KA 3SGEH 1DLFL 1GPOH 3S34L 3H3BC 4N0FA 3MRPA 4FI6A 5DSCA 4P04A 1TFPA 4WDIB 4KVPA 1TJXA 3B2UD 5CCKH 4FP8L 4YIQB 1XGQA 1T0OA 1U8CA 3L7EA 3BD4A 3VFMA 1X7QA 4A2FA 3RX5A 1BZ9B 2APTA 2F9BT 5C08E 3ECVA 3ARFC 3SJVA 4HOMA 3UYRL 2H8PB 4YSAA 3P4NA 4HC1H 1AQMA 1BQHG 1EAOA 3NACL 4UV4H 2EKJA 4RAVA 4I7ZC 4YWGH 2YUWA 1JF1A 1W0VA 3BIKA 3Q48A 5E5UB 4G83A 3MV7E 5I1EH 3U0TB 2KHAA 2NRDA 3W0WD 1QI5A 1T1WB 1ORQA 2VXQA 4NM4L 5I9QC 2K7PA 5E00B 2N0MA 3ESVF 4I9WD 2VZTA 3IRPX 1G9MH 1TT6A 2ZYRA 4WUUB 4CC4C 4LCYA 5KG9B 1SBBA 3RJDA 5F2FA 3ASWA 3C60B 3WJMB 4X5XB 5DRZA 5F1NB 3VRJB 1BPVA 3HB3D 2D7MA 3H6JA 3KW8A 4FC3E 3RB5A 3ZYOA 1LO2H 2G9KA 3BW9B 4F37F 5AOJA 5DEJA 1XD0A 1MHEA 1T1XB 3ES6A 4IMLB 1FSKC 2DKSA 3SPVB 3KM1A 3MREB 5E2UL 2Y0SA 3OB0H 1U8MB 2J57A 4GKZA 4FQXB 1MCEA 4NYLA 4QTFA 4P2QD 5DFVD 1USZA 5EG6C 1V7NH 5DUBA 2AXWA 1RERA 1YEKH 4JPIB 1IAIH 4P3CL 4PJCB 3CZJA 2E5EA 1KBGL 1FC1A 4AK2A 2VN4A 5SX4I 5GJSH 4AQ1C 2YAMA 1VPOH 4PIBA 3MLRL 5EHFA 5CNHA 1XSKA 1KXQA 3RWIA 4QHMA 1XR9A 1F6FB 4GO9A 5MERB 1ZHLA 4HLZG 1NCWL 1U8OB 1HHGB 5F3FA 2CALA 1X5JA 5AW2B 1MQKH 3K72B 5E6RB 5BS0E 4EE2A 1FNGB 3KYNB 5IMOA 3SO3B 3STZB 3B5GA 1HE7A 4WO4A 1BF5A 3I50H 1KIUA 4HBCH 1RZFH 2J8UE 1E28B 5KVGE 5LWYH 4D9RE 1IARB 1C5CL 4P3CH 1XXFC 1FG9C 5J6HB 1JHLL 1TKWB 1PZAA 1XH2A 3H2QA 4HCRA 4EI5C 5DUPL 3KE0A 2YBRA 1I8KB 2HVJA 2WKOF 4IRZL 5E8PA 1M1XB 1IFRA 4PB9H 3B9KA 1LO3L 3U4AA 3X1BA 3T3MB 4HJGB 3RY4A 1MWAB 4F80A 3NESA 4CMMA 3NDYE 3IJ7A 5GISL 4E9XA 1OAYH 5I6MA 4KNUA 1W0YT 5HHQA 4P2OB 1Z5LB 2P46B 3QIWB 2R8SL 2A9NL 4M8VA 4TVSa 4R96A 1OF2B 5B38G 3K71B 3M45A 5ABZA 1X7SA 5DD5H 2ID5A 3NIDF 5CGTA 3BWUF 1IC1A 3DIDA 3MCLL 7CGTA 4M1DH 1AXSA 4QY8B 2YAHA 2ITCA 1JZ3A 1PLCA 1VFOA 3NJKA 1BAFL 5DJZB 5FHAL 1T4KB 3U2IA 2JJTA 1CD8A 3LAFA 3QDHA 5E9AA 5HDOA 3QRFM 4JKPH 4J2XA 3WFEH 3UJIL 5AB0A 2A9ML 1FHGA 4S0HA 2VDKH 4PJ5D 5CWSB 2WO2B 5LQBH 3TBVA 1INQA 1URZA 1G6VK 2FBRA 4O9HL 4ENZA 2ZX6A 3QEHA 4MLSA 2P8PA 3DJSA 4HJ0C 1F3JA 4M7LT 3RNKB 2Y2YA 3SDCB 3K46A 4OD1H 2Q8BH 3T1WA 2A9NH 4WWNA 1JNHB 1WDAA 3FQTB 1GIGL 4FEMA 4QXUL 3GUTA 2ZUXA 4OJAA 3VRIA 1GOGA 2K9FB 3WFBL 1QSED 2O1AA 3KYKL 4X80H 5F88B 1AE6H 1AKJB 3LXUX 5EA0L 1C5DA 1P6WA 5C3IA 1IC7H 1OANA 1G7HA 2YWZA 3ZIYA 1N6UA 3K1KC 1CFBA 1THCA 3DUHA 4JRWA 4YR6A 3OJMB 3L3OC 3KJ6L 5BQ7A 3WNPA 2NSMA 1MFDL 4TUUA 4OV5B 1AG6A 3B2XA 3DV6B 5FW8A 1I4FB 3MBEA 5IHLB 1C9SA 1KIPA 4ELDA 1KFGA 4DCQB 1KTDA 4G11A 2I25N 1NFDA 5D72L 4WFFD 3RVVD 1G7JB 4UM8B 1MPAH 3NJLA 4R0LB 1OOWA 3JWOL 3OKNA 5C0AB 3UIYA 4HEPG 5GSVB 1SJEB 1HL4A 3KPPA 4FNRA 1LEGA 1OAJA 3DJRA 4I18C 4RGNC 4DPAX 1AS8A 2W0PA 2Y36L 4PJ6A 1E9PA 3WD5H 3UTTD 3O4LB 4PJFE 3ZHFA 3L54A 2DLTA 4QDGA 5FGBC 2FQFA 5EBWA 5JHBA 4MNGE 4KXZH 4IW4C 2N56A 3UTQA 3TCXA 2A5UA 1RY7B 3P9MB 3HG4A 1CFSA 4M93B 3TM6A 3HG0A 2R1YA 2X7LA 4O02B 2FJGB 4ZUSB 4L29B 2BVTA 2VUOA 5CBEA 4JPKL 1QLFB 4BFKA 5ALCH 1F2XK 2G3MA 3MRKB 5AVRB 4UU9A 4PSPA 1CLVA 1JDAA 1T3FB 5DJYA 5LBSL 2J5WA 3GSQA 2X1WL 4Z7UA 3W82A 1FNSH 1HL9A 3KLQA 3PGFH 3QA3B 4EPSA 5DD3H 1LD9B 2JIXB 3OKYA 3WCYA 1NGWA 4BZ1H 2AJVH 3G5XA 2HT3D 4PH8A 1YQVL 4BH8A 4OLZL 4H8HA 4UQ9A 5CEXA 1ZK5A 4B60A 4D0CB 1JF5A 5IB3A 5IM7B 2XA8H 2MMXA 1MCKA 1FGVH 1ZT4A 2YIHA 1RUML 2CE6A 4WI4A 1E6OH 1XF1A 2AJXL 4IKLA 5I1JH 5F7YC 2J1KA 1BECA 3CCHA 3TT1L 3KXFA 4JDEA 4YX2H 2IBGA 1BVZA 5C9JB 2CLRB 4JPKH 4N2OA 4N6RB 2H9GA 2OMZA 2FWOA 2WXRA 4R97C 1ET5A 1KNOA 5LBSH 2BNQD 1GY2A 1HXMB 3AQYA 3O41A 4XAKE 3GMLA 1MF2L 3MJ8A 1F02I 2F1EA 3MFGB 3B8YA 1HSAB 1I7RA 2ARJA 2XX0A 3IS0X 3IU4L 3L3JA 5D70H 3VRLF 2PP9A 3BVNB 3IJEB 3VW3H 3AMLA 2E3VA 2JB6B 3NSDA 2P5EB 3DXAB 1IBDA 1M2VA 3GSXB 3HLAA 1UKQA 1E5BA 1GHFH 2Q5BA 4G6ML 3L6FB 4OLWH 2W8CA 4PJ7F 3H54A 4FNQA 1KIRB 4F2MB 4DVBA 3GB7B 4OGZA 4S11A 1MZYA 1UM5L 2VLKA 1LE5B 5TDOB 1DQVA 2DAVA 5MENE 3OB0K 4RMTA 3NPSB 1X5XA 2VDQH 4G7VH 4OKDA 2OI9B 4XWGL 5EC2B 5HVHC 1X9RA 3P9LB 4IBSA 5I19H 5M94B 3SGDH 3IAPA 3UCRA 5TF0A 1UH4A 4GBXA 4X7CC 3QE5A 4LHUD 4GQPH 4EBQL 3FUJA 4Q89A 1QA9A 2D2OA 3FO2B 4L0PB 1N0LA 1LWRA 2D03H 1MW3A 5KZCB 4XOCA 1R9FA 3HFMH 4MD4B 4W9DC 1EMTL 2I7OA 2Y5EA 1NEUA 5DURD 2XY1A 4JPVL 4YDJB 4B7LA 3VB8A 4UOZA 3HE7C 3WUWB 1YC7A 3ZDZB 1CG9A 2UYLB 4BFIA 4FX5A 3IJ8A 1WFJA 3NRFA 2Q86B 2EXWD 3VWKB 5C2BH 4I0CC 4TPRH 3CLEL 1N2RB 1BOGB 4NN5B 2VDRH 3D18B 4PGDA 4TVUA 1WC7B 1A7BA 3B9VA 3NP4A 5ICYB 1NM9A 3A6CL 1M4KA 4NBYB 3M8OL 3AT8A 3L17A 1AR1C 3FUNA 5DQ9B 4AXWA 3N9GL 3ZTDC 4FQ1L 3LTVA 1ETJA 2WLJA 1RSFA 1FNFA 3EAKA 3O2DL 4G71B 3WFCL 4YSSA 3H85A 4XOBA 4M62H 3TEZA 4XBPB 3VGGA 5A16A 4BA8A 1A3LL 2ATAA 1RHHA 3D39D 3U7WH 4EUPG 2P26A 1TJIL 2IDQA 5AEAA 3ILPB 1KJMB 4PVNA 3NZHL 1ZSDB 1SUJA 3OKOB 2QBWA 4XCEB 2VXVL 5DVOA 4NN7C 1QABA 4F15B 5IT2L 4OZFG 3Q8FA 1DVYA 5IMMA 4X8GA 2H32H 3RWFB 3OWEA 1ZA3B 4U1GC 1OKEA 2UX6A 4NI3A 3NH7L 3E1F1 3FU9A 4L3CA 3RTQA 4PGCB 3R1GH 3AT0A 4S1SL 5D2NC 4LOUC 3VH8G 4JHZA 1UB5B 4F2FA 3ZR6A 2VDPB 1RVFL 3GHEH 1DN0A 3EBAA 4UZUA 1CGSL 1YJDH 1UH2A 2HG0A 2EQDA 4KKLC 4XP5H 5CEYA 4M5ZL 3U4EA 4AQEA 3CQFA 2OL3B 3DX8A 4JRYE 2D0GA 2WWNA 5J3HD 3D33A 3ULSA 2Y06L 3RZCA 4UIMB 5E9DB 3NSJA 3MOAL 1EPFA 3BCDA 3VD7A 1MCPH 4H8WL 2OMVA 1QTYT 1XGUA 4PJ8B 2HFFB 5DD6A 5HPMA 5KSBA 2FHBA 1LEIA 1TG8A 1QUPA 1GH7A 4DESA 1ROWA 4FHBD 2DQDL 2R69A 5CZXD 4U6HB 2WBXA 4KUZH 3VSVA 4MQSB 4N5ED 5D5MB 4XX1G 1NOAA 4QNPE 1UUSA 2WZ5A 3AM8C 4NS0A 1X5FA 1SLXA 5LAPA 5DHMC 1ZRUA 3QFJB 2F53B 4JKKA 4M4RB 2FEDC 4QUOA 3N5AA 2FVNA 2VR8A 1H3PH 2ZOLB 3G5WA 2PCFB 2APXA 4CL7A 5IHBA 3ULUH 1KZQA 4IQHA 3KAAA 3KPSB 4FTDA 3DPBA 1TMQA 4Y2DD 1GGUA 3GD1C 2PCPA 3MLSH 2FNBA 3KPTA 1F1GA 5M7QA 4FTVD 3GQFA 4LSRL 4WKZB 3C5XA 4Z5RA 4XVSL 3ECWA 3CSYA 1Y18B 3NCYP 1VCAA 3R8QA 3O2WH 3NIFE 4I8DA 4E9TA 4MA3B 3UTOA 5E7BA 2NSXA 5KYWB 4PY8J 1UC6A 4EN3D 5DCCA 4AGOA 3OXSA 4LCCB 1JMZA 3RHWF 1BJMA 4LOEA 3CZKA 3CSFA 1FVEB 2XVBA 2FATL 3IPEA 2OYKA 3VMPA 4C56B 3U6RA 2X9YA 2NXYB 2F5AH 4LEXL 4JY4B 2NX5A 1V7MH 2F68X 5IQNA 4OVVA 2XXMB 4QO1B 4TSAH 4X6BA 4M1GL 2GFBB 3FQ4A 4EDXB 3FYEB 3GBLA 3V55A 1ICTA 3DTDA 4ZSOA 3TT3L 2FLMA 3U1SH 2VN5A 3VX0A 1VZIA 2HLFC 1HJBC 3DDGA 5TFSL 4XN7A 2X4SA 3CHRA 3NTCL 1HHIA 4A1RA 4RGMC 4JQXC 4JG1H 4ZOEA 4KOCA 4Z7VB 5B3NA 1E40A 2CBQA 3LCYA 2C7UB 5JW5B 4ZTPL 1MFEH 5K5YA 1YMMD 4FKHA 3UIZA 3C6SA 3FT0A 2Y7QA 1CTNA 4RRPG 3VNYA 5TH2A 1IGIL 1ZLEA 1JWMB 1Q9LA 4X0KB 2E9WA 1CTMA 3OM3B 1KB5H 2A0LC 3GZQA 4WFEE 3OGCB 3BAKA 1AANA 1YEFL 4PJ9D 1NUGA 2VLRB 2E7BA 5DC4B 5F9JB 1IU1A 1K4DA 3V4PH 1BFOA 2ZOOA 3RWGB 2RCSL 1EA9C 3BYTA 3MBWB 3NTCH 4TNWK 4XBGB 2IAND 1TOXA 4L8CB 4OZIE 2KS0A 3ULVD 3B7TA 5T1LD 2NZ9D 3UABA 4DW2H 4R5VA 4JFUA 2DQ6A 4IEFB 2J8OA 4JS7A 4R90L 1NCCH 4BQBA 3BRDA 4UTBA 3BMVA 3QUMA 4JVUA 3NSXA 4U3HA 1A7QL 2HKFH 3CBKB 2DH2A 3D69B 3NFSL 5TQ0H 2H6PA 3US0A 3ARXA 2IAMB 2XTJD 3AREA 5KBLA 4J12A 1A65A 1DQML 1OTSC 3TZVD 2Q3XA 3DJZA 2OTUB 1A3RL 3S96A 4NQQA 3K1DA 3ARQA 3DX6A 3DXAE 1MFVA 1HI6B 1PNDA 3CFUA 3GMOB 3NRQA 4GSXA 4L4VB 4LKCB 3BKML 1HEZB 5JQHC 2K4WA 2RALA 4DSYA 2HT4D 4U1KB 3KCPB 3AXHA 3N0AA 1GXEA 4TUKL 3VG9B 4NZ8A 3VXMD 1ZGLB 2CIIB 2H26B 1E6JL 1FZKB 2YA0A 5DK0A 3AQZA 2XKUA 1MIMH 1XEDA 5TJWK 3FU7B 1EFXB 1WCBA 3N1QC 4HLJA 35C8L 1NSNH 2PO6B 3T0DA 3QUXD 3MCKA 3I6GB 2QLYA 4FYQA 1DQMH 3O6FB 3P2BA 4NO0A 4XBMA 4XO5A 2ICEB 3V6FB 4X9FA 1IBGH 2GY5A 2UXGA 1JNNH 1BX2B 4GIPD 3T4AB 5LGKA 2ZUTA 4BD4A 2PMZA 3P9WB 4Y5YC 3LQAH 2JKIS 4X5WA 4AT6B 1IAOB 1OWWA 2QV4A 5L2KD 4Y16A 3L1GA 4IBQA 2XCMC 3SOTA 1YHPA 3VH8A 5AD0B 2WZPA 3DOIA 1KT2B 4PJXF 3Q06A 3HR5B 2V7NB 5B1AB 1CC3A 5F3BB 1PFCA 3FC8A 5FEBA 1FF5A 2AAAA 3ARFD 3MRMB 1RAMA 3MGAA 2IQ9L 2WZAA 3D3VE 1TQCC 2ROXA 3BJLA 1H6UA 2VDKB 2DWEB 3GZKA 3HG3A 2NY7L 5JIIA 1E8WA 1XB6A 3JTTA 2VMFA 1NDMB 5EB9A 4D0DA 2APVA 2WXLA 5CCHE 3CUPA 5JIPA 4NJAL 4JREB 1E3XA 5TE7L 4ODUA 3RTQC 3CFNA 1RZQA 4HWBA 4ZOAA 1SMAA 4DP6X 3ZDYE 2ZD0A 5FLUA 3BUPA 5E4OA 5IB5B 3F12A 4HJ1A 4AUYA 4UANA 2XN9A 4FQJL 5BXFA 3DLQR 1JGUH 3VGBA 3ZDXB 3T77B 5DO8A 1B2WH 1A6WH 3CDYA 3UBXB 1CN4A 3CTTA 5HGDB 4LDLB 1JZ5A 3H56A 4P0DA 4U1MB 5J13C 3RZCC 3VFPB 4M7ZC 1HT6A 3D1MC 2BY0A 1TETH 2IQ9H 4AM0Q 3VXTB 1O5DT 2R2EB 4A7QA 3IF1A 3AC0A 5BZWA 1H0DB 1IO4C 3DMMC 1S3KH 4IBTA 5ACZA 2UV3A 1U8IA 1RJZA 2VJ0A 3UTSA 2RMNA 3EO0B 4NQEE 3EG9A 3L4WA 4UOW0 1AZNA 5FCUL 3TNMB 1CI5A 4HK0B 3PWLA 3OSVA 4HKBA 5J57B 5EC1A 3LV3A 1TMCB 4JPWH 2OMYB 1DHKA 1NCBL 3NVQA 2NXZB 1A2YA 4N28A 3ULVF 3DX9B 5D7JA 1PD1A 4NUGH 4NWTL 2GT9A 4NI6A 4I89A 3B3BA 4I4WA 4BGDA 4G8GE 1OAKH 3BHBA 1MCOH 5BRZE 3LX9A 4NQCB 2AJUH 5AVWB 4AC2A 3S5LG 1NBVH 4L37A 1G7LA 3DURA 5EUKA 4XVTL 1T0MB 2OXGB 1CUOA 3C09B 2EDXA 4QR7A 4L3EE 2L0DA 3DK0A 1E9OA 3P30H 4NENA 1Q9OA 4BRJA 2R4RH 2HYMA 4XC1L 4U6VH 5IMLB 1JV5B 5DJ8A 3MBXH 5EFIB 3G6JE 4GINA 5CJQH 4EI5D 5I2IB 3H2PA 5IR1A 1FNAA 3K80A 5CJXA 2CBOA 5GRYA 1S7TA 1WLHA 5KVMC 1CE6A 5IBUG 1FYTB 2FD6L 4GUPB 3PUCA 1EH9A 1HXKA 2Y7OA 2CDFB 3ARDA 5C0BA 5TQ2L 4CVXB 4GG8A 1QRKA 4TM9A 3F58L 4JMXA 1QMUA 2A74B 3QVAA 4X9GA 3BVWA 5DUML 2R1WA 1AQ8A 3LRKA 3OXRA 3QQ3A 3SPGA 1UZ6E 1F6AB 2M26A 2WGXA 4APQB 1H8NA 3KDMA 1QI3A 1I8UA 2H1PH 1PS3A 3C5SA 4O2EB 4XCCH 5SWZB 3O2VH 3DO7B 1E5YA 2X4OB 4LCWE 4IKKA 3BDYH 4JM2B 2IVFC 2JWYA 1AH1A 3VI4F 2DDQL 1ZHKB 4X6CF 3DSNB 5DA4A 3RL2B 1LP9E 4BEIA 1TVBA 1KDJA 3WNJA 2UY6A 3U2SA 3ZTCC 5FK9A 4DHLA 3RGVB 3R06A 1JPSH 4JGJA 3FCTB 1HU8A 5B3JE 1JYWA 5L4IA 1QW8A 4IIQA 4JFED 2RJMA 3MACH 4J4PC 3WKYA 2CCWA 4HJ0D 4TXVB 4HIIA 2VLJE 4ZTOL 4LIQE 1WAPA 2Q0ZX 3AJ7A 3RL1B 3UPRB 2N0KA 4WW2C 5I1LA 1RP8A 3EHBB 4OZGA 1TTGA 1NBQA 2VERN 3CQPA 4LPCA 1HSBB 2PABA 5DO2C 3SGJC 2E7MA 1A1NB 1A7PL 2YK1L 3KVDD 5L6YH 2R15A 1DZ0A 5FA3B 2NUPA 3VQMA 1XR8B 1XAUA 2D0HA 4JQVC 4XPTL 3MRCA 1E27B 2XFXB 1OTUC 2VDQB 5JYMA 4BXVA 1NBYB 2XNAA 4PJIE 1DBJL 4PP1C 2JJSA 3D52A 3BQUC 4PJHF 1TXKA 4LBEB 1W6WA 2PYEB 4Y4KB 4QRUA 1CFTB 1SJVA 2IJ0C 2NQDA 4R7NB 3H3PH 1A3ZA 5JDJA 3BISA 3E38A 3S3PA 3GRWH 2NYKA 1LK2B 2IGFL 2AQ2A 3INUH 4G82A 4IBUA 2SEBA 3AREC 5KSVB 4IRSB 2B59B 1J48A 4HS8H 1IB5A 4RGND 1A7PH 5L4FA 4L8BB 1MLBA 5CGMA 1HIML 1CXFA 2VDRB 3PNWB 3ML8A 4XPTH 1EV2E 5IZ7A 1FVCB 4X7SL 2I32A 3LKQB 5EOQL 3RDTB 4BKLB 4R6UA 3KPRE 5EUOA 1J05B 4Y5VC 3NSFA 3WIFA 3ROLB 1QR1A 1DBMH 1K8IA 4MJIE 4YBLC 2X4RA 5I0VA 4W6YB 1J0HA 1J1XH 4Q14A 4NPJA 1XMEB 1EEYA 4NIYE 4LO9A 4PJXA 2BSTB 3V4VL 4AWJC 4D94A 3V5DB 2YSTA 4YMPA 2CR0A 3EYFA 3QEGL 2DH3A 3Q43A 5JUEH 3AGVA 5HI4D 3MPCA 4RMBA 2ESVB 5ECGA 3SO5A 3QI9B 3T2NL 4AZUA 1T6BX 1FG2B 5CP3H 2DYRB 3KBFA 4LEEA 2O5XL 4KHXH 4Q9RH 2Z31A 1RIHH 1HIMH 3MDJA 4ATWA 4K23L 1NIBA 2YGNA 4TQPA 2WQSA 2WLZA 4BWTA 1BIIB 3ZKXB 3DHUA 3VXRE 1BLNB 1QBLH 4H26B 2H32B 3WS3B 3DTXA 3QDJE 3MNWA 3IMWA 4PWKA 1JHKH 3FBKA 4Z7OF 1T03H 3QJSB 5EZJB 1CD9B 1S7RB 2A1WL 1HYSD 4KMTH 3OC8A 5GRXG 1UG9A 2UY7B 3IMRA 5FCSH 3G9VA 4WK2B 4YHLL 4NN6B 3M1BA 3RIFF 1XSIA 1U3HC 2JI1A 3JV5A 4F3FA 1NC2D 2ITDA 5EOCJ 4DEUA 4LVNB 4X0NA 2CR6A 5HYSG 2EDBA 4MJHA 1R3LA 4IDLA 4JRXB 2FSDA 4JDTL 1M7DA 5F7AA 2H1XA 3OAYK 5D1ZB 5DJXB 3RY5A 3C2AL 1ONQB 3CXFA 5FUCE 4LLYA 2JKXA 1GYUA 2GABA 2H4EA 3ULAB 4R84A 1A4CA 4MD5B 4PAZA 4Z8FH 5IV2A 2EKSA 1XFPA 5DRXB 1P4IH 3FHAA 3RJQB 1BVLB 3KWWB 4JDVA 1ZDSA 2ZCHL 4PRPA 4YL4A 4QRRA 4N2FA 2P4AB 2WMPB 5B1CA 5CCGE 2YD0A 3TFBA 3BKJH 1ZCRA 2VXQL 2A1WH 4GKSB 4NQDB 1R5WA 2P80D 4XI5C 4GXVL 3IFNL 3CU1A 1MCBA 4R7LA 2F19L 5E8OB 5FUOL 3MUGA 4DTGH 1A7OH 5CLXA 3WIHA 4KO7A 5IJDC 5ISZD 1IM9A 2NY5C 5I30H 1LL1A 3F04A 2P5WB 2QHRH 2DM4A 1TLMA 1I8IA 4YVNA 2FHFA 4OCWL 4XAWL 1P9MC 1T21B 1F4AA 1YDPB 2B9AA 3ELAT 4B9KC 5IB2B 3JWNH 5D2LA 3WUZA 4ENEC 4MDJB 5HGAA 5JW4M 1FAIL 3A4FA 3HE7D 3A23A 1MCFA 4JR9L 5I1AB 2EH7H 3FQWA 1T6WA 4RBPH 5D7JC 1AG0A 4R4NC 4ONOA 3D06A 4C4KT 1J8KA 3NG5A 4RH4A 4WI0A 3SKJL 3LQZA 3LIZH 4JK0D 4Y4HA 2OSXA 5DJAA 5IOKA 2EVFA 4QAWA 3MXWL 1NCGA 4U3SB 5CINH 4AK1A 1NJ9B 3BJ91 3KPOA 5E2TL 5EF1A 2B08A 2ILLA 1AR1D 5F97E 2K7QA 5DMIL 1XCXA 1SOQA 2X6BA 2B16A 2YQ3A 3G5VA 3IE9A 1N5AA 1T04A 4J1UA 3VI4A 3NFNA 4X6CA 5JQ6L 4LGSB 3O0RL 4YSCA 3VXNB 5ERWB 3FULA 4XXDA 2CLZA 4JFOA 1OCOB 3T1FB 5KYNA 2CIKA 4IK6A 1WWBX 4RQQB 1FH5L 3B3IA 4XBEL 1OP5K 2TAAA 5F0LB 2VUYA 5JLZB 5T5NG 4HCRL 4M1CC 4LSQL 1ZTMA 3Q9QA 3WEMA 3HG1E 3HC3L 2JK5B 1RLBA 1CK0L 2FX9L 2NQ3A 3L3HB 4XZ4A 5EO1B 4ODTL 1OGAE 3D08A 3REWA 2ED8A 3SHSA 4XB3A 2JLLA 2FJHB 2MTAA 3DGGB 4X6FA 4UAOB 5ICXA 4ZQTA 3OR6B 3JV0A 1YEIH 3G7TA 3LHPH 4X4YA 3HG2A 3P0YL 1OL0A 4AUUA 3FT3B 4FFVC 4KHTH 2DJSA 4LSUL 3VI3F 4A7VA 4N8VG 1MFCH 4KNTA 4QXVA 3TA3A 2OXHB 3B8SA 1CGWA 2VMJA 2W07B 5HHVH 3HI5H 3GLDA 1PZBA 1FCGA 3QSKB 4F91B 4X4XB 5ADPH 2GTQA 4PJHA 4HH9A 1O6VA 1P1ZB 4KKLD 2WSKA 2XVLA 4IIQC 4AQAA 1A9EA 3KGSA 1DFBL 1TCRB 3MXVL 3O6LL 4W9HC 4AGMA 4OW6A 1KB5B 1T20B 4KXDA 4YXLL 5DGRA 3RUGE 1D6EB 2CA4A 1XIWA 3V4PB 3E8UL 4P05A 4U1HA 2C9SA 2BIOA 1U6AL 3V6ZB 4U7MA 4GRMA 2V2TA 3VQ1C 1OSYA 1C16A 1YNKH 2D0FA 2HCZX 3ILDA 3VD5A 3OMAB 4EAEA 3NCMA 4JL1A 5HYJD 3G6DL 1YEDA 3WE6A 1AJ7L 1K6QL 1OALA 1EJOH 1NAKH 1DSFH 3QGVA 5DZNA 5CJ8A 4DAGL 4GW5A 4OJYA 5D4JA 2ZKMX 4LEOB 4U1NB 1RIVH 2J72A 4ZFOB 2FEDD 3L3GA 3O6MH 4N0UA 5AYUH 2I9LB 4AENB 2EACA 3ML9A 1HKFA 3E80A 4OGYL 3T0EE 3FH7A 5GHWH 4UQ3A 2XZCL 5F96L 2QFPA 3DECA 4HBQA 1ZE3C 4ADJA 3KLLA 4JZNA 4K71C 4NX0A 4FA8A 7TAAA 4W6WB 3MLVH 4GMTL 3OZLA 3V10A 5CJ5A 2NUTA 5C08D 4K8RC 1MW0A 4MRBA 4FYSA 3PHSA 2BVPB 3HS0A 5IK3A 4Z7WF 2RHEA 3GK8L 4ZQKB 1HHHA 1IAKA 4YHKH 1I1CA 5T5FA 3MV7D 3N85L 4AIZB 3CU7A 3IDGB 3QXTA 5EOCL 4AMXA 4ZXBA 3ULVH 5GS1A 5C07E 3T8XA 4CJ0A 1XZWA 1NEPA 1UJ3C 5HHNB 3Q2WA 3LZFH 4R4BA 1JS4A 1LXMA 2NT1A 4ILDA 4J3SA 4F92B 1DQQA 1UWGL 3HNVH 1EJ6A 3IMVA 1IKOP 1L6XA 4JGUA 3BUYA 1PAZA 3NAAH 5IVXE 1ZLUH 4PWFA 2O5ZH 4F7CA 5DK2B 1S9KC 2WXMA 4GMTH 4XNZC 1ADQA 1PZSA 1WJ3A 2BXYA 4JM4L 4Y1AB 4A6YA 1U8JB 2G3ZA 2BW5A 1W16A 3QHFL 4P5TA 1PD6A 2HLFD 3GK8H 2NW3B 3QJXA 4PWHA 3QH3B 2AGJL 2A83B 4WHTA 4XCNA 1A6AB 2X4QA 5LN4A 4Z3EA 2G3NA 4MA7L 1SEBA 1M7IA 1JNLL 4F8TA 2LFGA 5DQJB 1QLEL 3N1GC 1WQVT 3FQYA 5EEYA 3ARZA 1T0PB 1PZ5B 1UWGH 4K94C 1QZNA 5AUMB 1S7QA 3KPQB 3H9SB 5E4AA 2E6QA 4YHPA 1BG1A 3RWEA 3EYOA 5E9NA 3STLB 4C83B 3MV9E 2VL5B 5BO1L 4HIJA 2XZQL 3TNNB 2A0LD 1IGJA 5CU9A 2EDQA 4ODBD 2ENPA 1T2QL 2WNGA 2IH8A 4X7TA 5C6TH 3W9EA 5BS0D 1NCDH 4XMLL 4JLRB 1YEGL 4JX0A 4UAHA 2AGJH 3PAVA 1CLOH 4P5KB 3NQIA 1SOKA 2N7BA 4GFTB 2E7LC 2M8XA 4ES8A 1OT2A 2YA1A 1T5XA 4PBVC 3JZ7A 3OKEA 3VXUA 1HDMA 2EO1A 4YE0A 3TX4A 5J1AB 2X44D 2WLHA 1E9QB 1Z9PA 1MHCB 1XBDA 4I2XE 2M83A 4AC4A 2DV6A 3QWRA 3MCYA 5B7FA 3WXWH 3BRGC 1XDTT 2OTWA 3MJWA 5KVGL 3KL3A 1A6ZA 1OTSD 3OPZL 3W37A 5GGTA 5BO1H 5HHMB 3K2MC 5FB8B 4QTIL 1NGQL 2YMTA 4W9KC 1UURA 4N1CA 3SCMB 1MW2A 4NKOA 4DN3L 1AO7B 5DFTA 3FFCA 2GJZB 2XWTB 5JO5B 3B9EA 4RBPK 4Y4FA 5DJDB 4A39A 2DW5A 5MEPA 4RMVA 2WQUA 4PG2C 4GRWE 2YJLA 1TQUA 5IUSA 3FQRB 3D0AA 4HJUA 2G5BA 3ELQA 2F5BH 1CPUA 2GI7A 5C71A 2WC7A 1KDIA 1IL1B 3O3UN 4ZW8A 3FU8A 2X1XR 2Z1KA 3L5WB 2VDOL 4R2GC 3CFDB 3O8XC 1P84J 4BUGA 1OCWH 5C0JA 1IGML 4OLUL 4J8RB 2LLGA 3H4FA 4HULB 2L04A 5IOPB 1QHPA 1L3NA 4CNIB 3IRZA 5EF3A 3QO1A 5GGQH 3GSWB 3T3PE 4FXGC 1QWHA 5IP4A 4UQIM 2BMKB 3CVHB 4NBXB 4AKQA 3OKLA 2PW1B 1G9HA 3PHQA 3RVWC 5CLZA 1G1YA 5IW1B 4F27A 4P3DA 1IQDA 4DQOH 1EFQA 3APFA 5F89A 5TPWH 2YFNA 2PWDA 3H6AA 4E41A 4UT6H 8FABB 5FFLA 4QRPE 3CFIC 3CVBA 4HF5H 5IWLA 3MLXL 4S1DD 3GKWH 1HHKA 4E42B 3C5ZB 3RQ3A 1KCUH 1E7VA 1MY5A 2ZE0A 4R9HA 4UDUA 1YEHL 4EXPX 4GAGL 1D7BA 1E4XI 3IWUA 3OPUA 1FL5A 1SJMA 4LQFL 2A6JA 4H8PA 3RVXC 1D9KA 4Q4IA 5AVUB 4I48B 1A6UL 3TA3C 5LXVA 3UDWA 2GITA 3QIUA 2LT9A 4S0SD 1EXHA 1KG0B 3KCWA 4JW3A 4MNQA 4AGPA 3D87B 4ZPTB 1Z9SB 1ZXKA 4JM0A 4JFHE 2GCYA 3FRPA 4LSDA 3FCSB 1XZ0B 3OR7B 1B0GB 5D6CB 3E2HC 1QFUL 1MFAL 2VB5A 3RZCD 3EJRA 4OLXH 1S7XA 3ZR5A 1KGIA 4NGHH 2ALAA 5L88L 2PWFA 1ASOA 1S7VB 2ED7A 4RWYH 2ORBH 2BNUB 2X1QA 3DMMD 3FO0L 4GKLA 1WRFA 2XWJA 1IC5H 2B5IC 1LWHA 3DROB 2CBMA 3VAEA 1T6VN 3IGFA 4ELMB 3NZSA 4ZUTA 2VR3A 2DEYX 4OF6A 3F8UB 4Z7WA 1J0JA 1A9BB 1DJYA 5FV1L 1FGNH 2J8UF 4UQBA 3MNVB 4CN4A 4FMKA 5ESAB 1BQRA 1KLGB 5D1XA 3FN9A 4JFZL 4N6QA 4G9FA 2JNZA 3BAYA 4FERA 2AP2A 4GQQA 1HWHB 1ZK9A 2R69L 1QBMH 3MI6A 3QDMA 2ZYIA 4KJWC 5DC2A 3TIEA 2CCLA 3T6ZA 1I8MA 4MCZB 3OX8A 2Z4QA 3TU6A 4DZ8B 2VM9A 2G2RA 4E5XB 4UYPA 1MRCH 4GG6E 4AYEC 1G6RH 4F7MA 2W60A 4HUMB 4IOSA 2A6DA 4IRJC 2ZXAA 1IAMA 4P46A 2DM2A 3CX5J 4N4YB 2YD9A 5IEHB 5F7EL 1RQ5A 4A38A 2PW2A 4PJGF 3FMGL 1VGEH 1DO6A 4FQQB 4XAKD 5F44A 1N7ML 2WW8A 1FNEB 4WU7B 3LZPA 4NAQA 4XPFL 4CGTA 2OK0H 2WVSA 1L4IA 4FABL 2ZCLL 5L9DH 1CBVH 3BYYA 2XWRA 1IM3A 1XMWA 3J8F7 4GKOA 1P7QD 4WTXA 2J25A 2J4WL 2QPDB 1MH5B 1XCTA 1Z3RA 3PWNB 3IN2A 1EGJA 4ANVA 1CT8A 4MJ5A 1VCBC 1GW0A 3Q3GB 4RSYA 3ZGHA 1F45A 5J6SA 4FHKA 1KZYA 5DLMH 1S5HB 5MEND 2BK8A 2IOMA 1N4XH 4M8RA 5AVQB 3UO8B 4AE0A 4P23A 2L8AA 4N3UA 2V5YA 4TTDC 4P5TC 2WXPA 2P24A 2F7IA 1BGXH 4WEBH 1ACZA 2DMKA 1GAFL 4Y7OC 1EUUA 3KPMB 4GO8A 1UA6L 1SY6A 3KYMA 5FKPB 15C8L 4E9RA 1BFVH 1OIOA 2IEPA 3D07A 1F42A 1TYEB 3FH8A 4J4PD 1WEJL 1XGTB 3FU0A 5HGHA 4DEWA 2Z0BA 1DCLA 1MVUB 4X2UA 5DGQA 1KPRA 4APXA 3K6SB 2YD4A 3Q5TA 3ALWA 2KLSA 2WN2A 3QUKA 4RFNC 4RIRB 4YHZH 5DO2D 1NCAH 2GY7B 4GLRI 1DDTA 2BNRB 1PCXA 1OE3A 3IGLA 2PLTA 2DMCA 1I3UA 2VZSA 3EO9L 1C8PA 1JPGA 3DVIA 1AIFB 4LP4A 4O2CA 4X6DB 1OTUD 3HR6A 5E6SB 1KY7A 3WAKA 2H3XC 1KCLA 3P3RA 4PP1D 3BQUD 2A9AA 1NKGA 1ZHNB 3SQRA 4NRZB 5L8KB 3X1NA 5IHZB 4LLMA 2UXVA 2G30A 4LARL 1JTOA 4PJFF 3TEXA 2ZUYA 1L0XA 1P4BH 2IH3B 1OCZB 2I69A 4OGXL 4NKMB 5IREA 1UOLA 3BSZA 3HAEH 3ARED 4JZJC 2P5PA 4TUJA 5SWSA 3ZE2E 4U6XA 4ZAKA 4F37K 1GJIA 1Q8MA 4XMVA 2QQNL 5DJCB 2XWCA 4UTBL 4YFLF 3QUML 2DBLL 4Z7AA 4OIIL 3IXTB 4AUJA 4G6KH 3WY4A 3ECBB 3R4DA 2VZ1A 4HUWA 1I8LC 3HG5A 3QZBA 3TBWA 1UB6B 4FG2A 4RX4A 4D3CL 7FABL 4EF3A 2VDNH 3GSOA 5SX5H 3KLHD 1BP3B 1YAZA 5DD1L 4HZLB 3QDGE 5I0XA 1AP2A 3FRUA 2YPLA 3OKKB 4NQSA 4PCKA 5FWRA 1I1AB 4BDVA 4OBRA 3UBFA 2GEEA 3HBQA 4FOMA 5EO9B 1LO4L 4PGBA 4P2RB 1OSZA 1D5XB 1AYOA 5KS9E 3L5XH 4KXAA 4BSVA 4GAFB 4HQQL 1J9SA 2VH5L 3MLZL 3PY9A 4J3BA 4DO5A 4UTBH 1E90A 3ZMEA 4LMQE 3QQ9C 3ME0B 1TSHA 1NGYA 4NUJB 3WGVB 5D7IA 3H1ZA 1EO8L 2H41A 7FABH 1B90A 3GRBA 1M42A 5G2NA 3IGAB 3IJYA 4XPHL 4PJAE 2ERJB 5INDA 1SHMA 4WHDA 3NBNA 5IWLC 1U3HD 3V6OE 4JANB 2ADIA 3MJ9A 4YGVB 5E1AB 2G4EA 1OP4A 1HAUA 2YD6A 4X4MA 1B6DA 3ZL4H 4EZMA 1LO4H 4XO3A 2EDDA 1I7TB 3LZRA 2FB4H 4Y19E 3OAWA 2X2UA 1R3HA 5F1IA 3UEZA 5AKTA 1PCSA 2ZOWA 1D9KC 2EP6A 2Q3AA 1H15A 2WLYA 4I0PA 4I1RA 4BE6A 1J5CA 3BE1L 3I6KB 1NFIA 3UDWC 1X6LA 3QIUC 4JDZB 2YBRB 3NQKA 1CICD 2EXSA 3F6IA 2CH8A 3SB3A 3ZE0E 4DGUA 2ZUWA 4Q9BA 4CKQA 1TQVA 1KWKA 2LU7A 4NPYB 2GYSA 2IBBA 4ZNEA 1N9PA 1NAMA 4YK4C 3HC4L 4HUXA 4HWBL 1UWFA 4UB0H 1FZMA 1QSFB 3VGHA 4XI5D 5JOFB 5JPMB 1WF5A 4XOAA 1F2QA 4KZCA 1Y0LA 1JUFA 2CBPA 4JFWA 4W93A 3HEIB 2Q6WA 2CG9X 4L1BA 4QKTA 4HXBH 1CR9H 5BV7H 3QXAA 4RISL 2XQ0A 1SHXA 3C08L 5EH1A 4ENED 1BD2E 4AI7A 2YGVA 2NY5L 4F7EA 4ZMQA 4AEIL 4V11A 3S3BB 4PJGA 1P5UC 2Z8RA 1D5IL 2VLME 5CIPA 1PY0A 4XNXL 1LM8V 1IZKA 4R4ND 4C4KO 5LGJA 1FLRH 1HOCB 1XHHA 3BT2H 1JNJA 3PU7A 4KK9D 2VC2L 4V2BA 2CGRL 3H8NA 4U6YB 4WV1A 4FMVA 1JN6B 1BBDH 3SGKA 1DO5A 2LLLA 4DUVA 2N4IA 2FJFB 2VIRA 3ABKB 4L1TA 1VLXA 4TRPL 2HH0L 2CPUA 5FYKU 3NCJL 3CHQA 3TBSB 1A4JB 4WFGE 4ZUVA 3BVVA 5DZJA 5A2IH 1XVSA 2BW4A 2FHCA 4PCTA 3HVDA 1KGCD 1H3XA 1MAJA 2UZIH 3IDIB 3NIGB 1N3NB 5ENWB 2I07B 1ZD6A 5CD3A 4N2KA 2VAJA 3QWNA 4CDGC 1FDLH 4A2MA 4XNXH 4KKAC 4L23A 4P5MA 3MGTA 1BBJB 4WFED 5GRJH 1E4WH 5ICZB 4G6JH 4M1CD 1AQDA 2YLKA 1CXLA 2C9UA 4P57A 2FLBT 4ZFGH 3MRJA 3DX3A 3QEQA 3CFBA 3N44B 4U4BA 1UA3A 1GRWA 1G7PA 5DU7A 3PIQB 1T4WA 3FTGB 4JO3L 1RUQL 4LRNH 1FFOA 5E56A 3U7YL 2WNKA 4AVIA 1UM6H 1AGBB 3ZU8A 4ZMTA 3PJSB 3KD4A 4LL1A 5EIVA 3AUWB 4CVZA 1MRDH 1CD0A 2FQDA 4X99B 4CU6A 4A7GA 1R5VB 1IE5A 1ZVSA 3DKHA 4BFNA 2OJ1A 5B39G 3O9WC 1T7WA 1IGTB 2DQFB 1E7UA 3HC0A 1YUHA 3HRZC 3ZHDA 3IMBA 1IGFH 2WNXA 2WKGA 2VTFA 2MQCA 4XPAL 5GGVL 5CBEB 4MAYA 1P4LB 4HJJL 1CFVH 3JVFC 1U91A 3RTLA 2BOCB 2ITEA 5MEQB 3CDFA 3ASOB 4QNPF 2AV1B 3C5JA 3BAXA 3WTXA 3QUZB 1EIBA 1BJ8A 3IDNB 3L2NA 1TQTA 2EC9U 5KJRH 2E0PA 3RIAF 2CM5A 5AL8A 5CZVL 5IEKB 4PI2A 4OFVA 3D85B 3MUHL 3BGMB 5IB1A 3SY6A 3TJEH 1PZ2A 2AXGA 2LLNA 1D5MB 3FUMA 5EU6A 5AZEL 1RZGA 3C8KA 3DIFA 4XXCC 1CZ8H 1JOIA 1KTKE 3PJNA 3B2VH 2O26U 4M61B 4TULH 2L4OA 1O7SA 4HDIB 4Q7DA 2WV3A 4XNMB 3SDAA 1KBKA 1X5LA 4DP1X 3NIFF 3S36X 3ARBA 4EEEA 2X38A 3OLGA 2OMWB 1INDL 3S36H 4UOW1 1QFWH 3BC9A 1KCRH 4NUQA 5TE4L 1COBA 1UWEL 2IPTL 4IBVA 4JFTA 4K7FA 1QTPA 2EYRB 4JZOA 4K8RD 2ZX9A 2CXKA 1NM4A 3NFPB 3D3VD 3BPNC 4LSSL 1QRNE 4TSCL 1Q9WB 1CGUA 2Z7ZA 3VTMA 5SX5K 2NY6C 1JFQH 3UAJC 4NB7A 5ID1B 4LMQI 5KAQF 5T3XD 1P84K 3S6CA 2OW6A 3EFFB 5A7EA 4PLNC 4UQAA 3SDDA 2QKIA 1FJ1A 4EQ2A 3QHZH 1QSZA 1Z3GH 3NZ8A 3QIBB 3FJTA 3JWDL 5DHVH 4XMZA 4H8UA 5DRNB 2BIPA 2MKLC 1F18A 3UAFA 2BX5A 2AAVA 4M6ML 5T3XL 2C3HA 2K0RA 3HMWH 5EORL 4WDIA 2Q8AL 3UERA 4YIQA 4JVPA 2IALB 4FFWC 1BZ9A 5DZ9A 3FU3A 1GKOA 2H8PA 1UACL 4KY2A 1KC5H 5I8EB 1AHWA 1CB4A 1W0WB 4JY6B 4DUXA 3QCUH 1JZGA 2PCXA 2BZ7A 4NQED 3QZWB 3U0TA 1SQ2N 4H7VA 1IBZA 4ODHL 5DQDL 3OB8A 1T1WA 3L7FB 2ZOUA 1PPIA 5IVOA 1KEML 1J12A 4JFDB 5E00A 2PYFB 1PW3A 4WUUA 1RZJH 3DUUB 4OZIF 5KG9A 2XVGA 3NIDB 1EAPB 3C60A 3D2UD 1QASA 3WJMA 3L3DB 4X5XA 1SXBA 1L9MA 1SLWA 3HMXA 5F1NA 3SOBH 2TRHA 4G8GD 1IT9L 2CK0L 4XNQB 5DR5H 3VRJA 3TVMB 3BW9A 1B0RB 3N04A 3ZE1E 4EIGB 3IDUA 1JYNA 5E95B 1T1XA 2QVFB 3BH9A 4IMLA 3T2QA 3SPVA 4K94L 1GL4B 3IETB 1UACH 3GT6A 4GI8A 2JXMA 3MREA 4WNSA 2EEAA 3N41F 2WM0A 5JXAH 3SIKA 1U8MA 4L3ED 2R0WH 2CUIA 1OAZH 3OHMB 4FQXA 3WO4C 3FB8B 4DETA 3HI6L 5ID0B 1NANH 4JPIA 4Q6IB 2RD0A 3WELA 1FQ9C 3S5ZA 4F5CE 4OY9A 4PJCA 3L13A 4RMUA 3MRFA 1E30A 2R0ZL 2KLTA 4FFYH 2F7QA 2OR9L 2OCJA 1YRKA 3PRZA 1EHAA 3NK3A 6FABL 5K9JL 2QQQA 3ATAA 3DSFH 5MERA 1PY9A 1F4XH 1NCIA 1U8OA 1HHGA 1FNHA 4BHUA 1Z9LA 2QV2A 2Z8VC 1ZT1B 2V17H 3WXVL 3WIHL 2XY2A 1DN0B 2XQBH 4ZO8A 3OZKA 4PGJA 2IWEA 2NT0A 2BHFA 1FNGA 3KYNA 1G6RB 3QK0A 3STZA 3HB3B 4LCWD 5DZVA 2HLEB 1E28A 4U2YA 3LSOB 2PTVA 5J6HA 1M1SA 1TKWA 1QYGL 3CX5K 5HP5A 1N6QH 1NBZA 1W8OA 1B4JH 2ZXDA 4M03A 4R2GD 3O8XD 1DN2A 2ADYA 3H7LA 1I8KA 1M1XA 2EVHA 4PRAB 1YNTF 1UT1A 2EXYC 3D48R 1MWAA 2VDLL 1J8HE 2HRPH 3BAEL 2VLJD 3L9YA 4HJGA 4JRYA 2F8VA 4R4FH 1ZA6B 3RB7A 3S3DB 2NLJB 3TC9A 2O93L 2ICES 4Y5XB 4OUUB 4P3WA 5FWQA 4F1SA 4P2OA 1S5IH 1Z5LA 2ZP0T 3QIWA 1NGPH 1F4HA 4TSBL 4ZT1A 3O4OB 5I1KL 5F8RC 5KVDE 3K71A 1S9VA 3JVGA 3Q7JA 1WFNA 3UYPB 4YZFE 3KL0A 3RVWD 3PQYE 4U0QB 3NSCA 2E75C 4JFPB 3MA7B 5DS1A 4QY8A 3ZDYF 2E9IA 2IPKB 5DJZA 1KGUA 1KCVH 3RPIA 1T4KA 2Y2TA 4PW9A 1QZ1A 5I15L 1T5KA 2QDVA 4KPHH 4JO4H 3TH2T 4KUCF 4BXSV 3ALXA 5CWSA 5A2CA 1TNMA 4CVWA 3LRLA 3RVXD 2AJZB 3BMWA 2WK2A 4B9PA 3SDCA 1CU4H 3Q1SH 3RNKA 1OB0A 1IJNA 4TSBH 1JNHA 1PX3A 1P7HL 3FQTA 2W1NA 1DQJB 2NY1C 2Y7MA 4Z3JA 1MRFL 5C97A 4K9EH 5F88A 1YECH 1AKJA 3BO8B 3HUJE 4KGLA 2AANA 1E2ZA 3KPRD 2E4TA 2DD8L 4L5FL 2XICA 3HNSH 4MXWH 1XF2B 1TZIB 1IVLA 3SKOB 1QKZH 5JPNB 2R0KL 2FT8A 4OV5A 3GC3A 4YUEL 5G4NA 3QZPA 2LGNA 3DV6A 2WQXA 3BZ4B 1I4FA 4HXAH 4CVUA 5IKCB 2DTML 2Y07L 1YY8B 3OF6D 4DCQA 2X4PB 5D1QE 4BFJA 3HAEB 4NCDA 4UM8A 4PJ7B 4DEPB 4R0LA 5C0AA 1GMEA 2O5YH 1SJEA 4OB5L 5E1IA 3QJUB 1M71B 5DVMA 3SDAC 1EANA 1T0NB 5BOPA 1P6AB 1JZ8A 3G6JF 4HPYH 5H37G 5FFOA 1KYDA 3O4LA 3ARBC 4KJWD 5D5MF 4WJKB 1R3IL 2EUWA 3QDJD 4IDJL 4YHMH 2WLMA 1QSEB 2VDNB 4JHWH 2G60L 2KT6A 3LDBB 3P9MA 1RUPL 3ERXA 2BHUA 4NKIL 1FORH 4IRJD 4XMPH 5FYLD 2DTMH 5CR1A 2FJGA 4X8XA 4ZUSA 4L29A 4H88L 3V6OC 3QORC 1QLFA 3PS6A 3RU8H 3MRKA 1EHNA 1T3FA 1UTDA 1EEZB 2WBKA 4AMKL 1O6SB 1OK8A 1D3CA 3QA3A 1JE6A 4NJ9L 5FYLL 1LD9A 1A7RL 2JIXA 1G0DA 3EJSA 4KNSA 3E9TA 5D7KE 1LP9F 3SDXE 2CM6A 2PCYA 4N86A 4DKFH 4D0CA 5T5FL 3QWQB 2ODHA 5KSAB 2JF1A 5GRVL 3L9RB 5A6IA 1CFMA 5IM7A 2ZXBA 1HWGB 1DJGA 4XODA 5B3JF 2PWGA 5EBGA 4U7KA 2YHGA 4V1DE 1AVAA 2QDWA 4HJTA 3DX6B 1N68A 5GIRB 5LUMA 4NPKA 4TTDD 3M1CA 4H88H 4P5TD 5C9JA 4WJ5B 4N6RA 4HEME 5C9KA 3SE3A 3V5KB 1ET7A 1VHPA 3BP6B 3TXAA 3V8CA 4FFZL 1HXMA 4AMKH 1ADQL 3HPLB 1GGCL 3LKSB 4G3YH 1HSAA 3KH3A 5JIDA 4NJ9H 4NNPH 3BVNA 1U0QA 4A6YL 4X4KA 4PJIF 2JB6A 3MRIB 1EJ8A 2I5YL 1CWVA 1CGVA 1NMAH 2P5EA 3DXAA 3RAJL 4CC0A 3GSXA 4OT1L 5GXBB 2YARA 3ZHNA 3L6FA 4FXKC 5JHDE 1BXUA 4LU5L 5K9QG 5AAWA 1R3JB 1UKSA 4G80B 4LSVL 3EH2A 1KIRA 4XVOA 4F2MA 4MMZC 5FS5A 4HX1B 1FBIH 3GB7A 2H5UA 1FPTL 3B7RL 1GS7A 2P45B 1LE5A 5TDOA 3FT4B 4S0TD 2CNZA 3F2LA 1WFIA 2AXJA 3BGFC 5CUSL 5HHOE 5EC2A 5IQLA 3VFRB 3MLUL 3P9LA 3DX2A 1K5NB 2E59A 3RGBA 4NZUL 5F1SA 3ENEA 1LMIA 2J73A 5C0IB 3HTLX 2ZOTA 3V6BR 1EVTC 3TESA 2YKKA 3FO2A 4NERA 3JXAA 3RAJH 4BM7A 3CVIL 5CEZL 4HSCX 2XA3A 2BNQB 2CKNA 5JDSB 1T83A 2XYCA 4JFFE 1MNUH 5EMYA 3WUWA 4ESKA 4XC3H 2UYLA 3WV0A 2Q86A 5T3ZL 1ZVHA 3FW6A 4LASL 3VWKA 3HG1D 1QR4A 1N2RA 1BOGA 3QXUA 5TDNB 5IQ7L 2Y22A 1OGAD 3D18A 1WC7A 3U0PB 1DJHA 3AT9A 5D7SH 5EZOH 3EZJB 1TQBB 4I77H 2CNYA 5ICYA 1F6LL 4OZ4B 2JTDA 5C1MB 2NNFA 2VQ4A 4YSTA 1UOVA 5DQ9A 5JMRA 1WA1X 1RFDH 5I8OH 1LK3L 1AYRA 2LV4A 2JELL 4NRXB 2F2HA 3GLAA 4GB9A 1MJJB 1Q0EA 3EJYC 4AQ8A 3MRGB 4WI3A 4XBPA 4S2SB 4LHUB 2DYPD 2ZSVB 2QQLL 1QVOB 3PFUA 3W0WE 2BOLA 4B97A 5A2BA 3UPAA 4YAQB 2W9EH 3ILPA 1KJMA 2B1AH 3ZXAC