5EIIG

Structural determination of an protein complex of a fab with increased solubility
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
152
structure length
144
Chain Sequence
b'SIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Structural determination of an protein complex of a Fab with increased solubility
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 144
sequence length 152
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5eiiG00
2Z3FA 2DZEA 2IO5A 1TEYA 2IIJA 5BO0D 1ROCA 5C3IA 3AADB 4RRPM 2CU9A 4EO5A 5BNXD 4ZBJA 2YGVA 2Z34A 5EIIG 2I32A 1WG3A 2IDCA 2HUEA
chains in the Genus database with same CATH superfamily
5K39B 3ULAB 4GS7C 4UQDA 4BYHA 2QQLL 1NIFA 1LK3L 2RGSA 3DXAA 4Y8AA 1GJIA 4TSAH 2AP2A 4GXVH 2EIZB 3C6EA 1MCFA 4JDEB 3HI6L 4WRLA 4AV4A 2OR7A 3NP4A 1XWVA 4LBEB 3RVWD 3CJJA 3P9WB 3H6JA 5CCHE 1FFOB 1TZGH 5CN1A 4IMKA 3C60A 3B43A 3S97C 4NRXB 1H15A 2PR4L 1QW9A 1BQLH 1H3PH 5ICZA 4ZPVA 3WAJA 5C0CD 4HK0A 3IPBA 2YIHA 2B5IC 4L9LB 3KJ4B 2CAKA 1E4XH 3GMPB 3S3DB 2YMTA 3PGCA 5CR1A 4W6WB 1ETZB 1B4RA 4UDUB 3E0GA 2K9UA 3ARDB 1JZHA 2NW2B 5I15L 4G9FB 3I3EA 5AENA 3DX1A 4NQDD 3UAJC 4E9RA 5LNGA 4D7BA 3IJYA 1Q9LA 3HMXL 1I8KA 1DBBL 4QHLB 4KKZA 3RUGF 4XC1L 4EKJA 2X4OB 3H7BA 5HJGA 2XKNA 1SM3H 2EINB 3L9EA 2OMNA 2D2CC 2Y69B 4NJ9L 2OL3L 4U1LA 1UWGH 3G5VA 1S7TB 3VD9A 1FLRL 4UQ3A 4IS6A 4GP5B 3W9DB 1S6NA 3CHXA 5AB2A 2OM5A 1KCSH 5IKCB 2AC0A 3K72B 1J86A 4HLZG 3ULVE 3MJWA 4KMTH 1RPQA 1WH0A 1XCTB 5C08A 5BOJA 4IKIA 4HS3B 1NMCC 1DCLA 1AANA 5CWSB 2JIXD 2EDRA 2XQYA 4NQVB 1Z3GH 2HFFA 3HJ0A 2DTSA 3U6RB 4KAQH 4YVUA 1CS6A 3P0YH 3TA3A 4AYMC 4BFRA 5IHUL 4MDIA 4G82A 5C8JB 1N5YH 3WS3B 1TTBA 1TTCA 2AF2A 3ARDD 3RJOA 2VQ1A 4OF6A 1WAAF 4G9FD 1P7KA 4PG9B 1RZKL 2BVOA 3ZRFC 4WI0A 3WSQH 2R8SL 4UU9B 1VFUA 3SGDI 2XFXA 2LABA 3MRIA 3T8VA 3UOAB 3EBGA 2WWOA 2E4TA 5DHYA 2EE9A 5IF0B 4URTB 2DIJA 1W15A 4BFFA 1LDPL 4GSDH 3UO8B 1IKFL 3RHWK 3MRKA 4GG6E 5BOPA 3BIKA 4ONOA 1OCOB 2VDLL 3MV9B 2W0FA 3Q43A 4U6YB 1OAYH 1KEGH 5EFIA 4JZOA 5H8DA 5ADOH 4MXVF 2X6UA 3PJLA 3QR0A 4J3BA 3PNWA 3RZCA 2R9HC 1XGPB 2D7TL 2JXMA 2VLRB 1UJTA 1A3RL 3F62A 3O45B 4GI9A 3RWJA 2OXGA 3SE3A 5AG8A 1UOWA 1A1NB 1G9HA 2TSBA 2YZ8A 3CFQA 5KSBB 5JMOC 2J2ZB 1JGUL 4JRXB 4HDIB 2WXLA 3F7LA 3B2DC 4Y5XB 4CNIA 2ED9A 4V2CB 3RWIA 3LHPH 1JHLH 1Z9OA 2IPUK 2FYVA 5KBLA 5JLZB 2ICWJ 2Y72A 4ES9A 3NIDE 4NXKA 3S5ZA 3S35H 5C0ND 2A9ML 4DKEH 2R2HB 4GKSB 4CSSA 4WJ5A 4B9PA 3LMJH 3CX5J 5BZXA 3L95B 4KO5A 4YAQB 1S3RA 3K4DA 3ATAA 4NWTH 5CJQH 1M56B 2VAJA 3QEQE 3PXJA 1LP9B 4X7DC 4Y4HB 3HKFA 3MV9D 4I2XA 4OJEH 4XVJL 4GBXA 5IFHL 4JUSA 2AJYL 2YPLA 3OKKB 3U9WA 4JE4B 4TUJB 1A1OB 1JCVA 4W93A 3DETC 2E7CA 1N59B 4L1SA 3PL6C 1P5VA 4W9ZA 3FUDA 2VLRD 4W81A 2CLVB 3T3ME 2X3AA 3QXDA 5FO2A 4WV1C 1YEKL 1CDYA 4MNQE 4NO3A 4XP6L 1S7SB 3UTQA 5I5MA 5M7QA 4WI7A 3VNYA 3AGVA 2FATH 3NQIA 1MFBL 4JRXD 4XBEL 1LWRA 5FHBH 1E3FA 3CDZA 3UAEA 5I6NA 4GW4A 2LHAA 3CXHJ 4QRTB 5TFSL 2FX7H 4TXVB 3WKNA 5F7UA 4J2XA 1J8HB 1FE8H 1KPRB 3DURA 5CLZA 1WWCA 2ZWNA 3ABZA 3SE8L 2FQGA 4I0PA 3SDAD 2ZX7A 5D8JL 1ZT4B 4HD5A 4GXUM 1ZIAA 1JF6A 3DUHA 4W9GC 3ZTEA 3IKCB 4KKCD 3BVNB 1D9KC 1J88A 3KH4A 3N06B 2OMVA 2LQRA 2GBUA 4XOEA 1A14H 1F1GA 3U4KA 2PTUA 2WQAA 3TBSB 5MEQA 4P05A 5D2LF 3CXFA 4Y4HD 1RUAH 4I3GA 1U8KB 1W72L 1R3LA 3UADA 2W92A 4YSQA 4JZNA 3FU8A 1LQSR 4ODXB 3KJ6L 2P49B 5F8QC 2HG5B 2NRDA 3EJPA 3KLSA 5I6OA 2GBTA 3LVTA 4RMWA 2R0ZL 3OXRB 4IBWA 1JERA 4PTTA 4NNPL 1UD6A 4NKOB 3GO1L 4LARH 7FABH 3BUYB 2R27A 3NH7L 3DTXA 1MWAH 3NVQA 2ZX8A 4NM4H 4Z7VB 4RWYL 2G9HB 3RX5A 1AXIB 2XXMB 3QJQB 4ZQTA 2EAEA 4B5ZA 43CAA 1S46A 4ANKA 4XN1A 1K9TA 2VSMB 4NM8L 4WK2B 3HE7A 1BAFL 1YECL 5D5MB 1EZLA 3L7EB 4Y16B 3DX4A 3D51A 3IU3A 3HZKB 4D9QE 3DV6A 1XV8A 4PPTA 3WIHL 2AJZB 4LKXA 4PJEB 2I26N 1CGVA 2GJPA 5DMKB 2NUTB 2ZP8A 1FV1B 3ATEA 4G43B 4URKA 1YN7A 5FB8B 2FHFA 4KQ0A 4JGNA 3AQDA 1ZTXH 3B4NA 2VR6A 4HAFA 4NKIH 5IM7B 3VD4A 4TQHA 4XCCL 2APSA 5TQ2L 4OFQA 3OHXC 4P2RB 3CK0L 2SEBA 2YLKA 4HYTB 1KTBA 5FX3A 2ESVD 3FXIC 3ZT7A 4K3JH 4QTHB 4RRPM 2BSTB 4JN2B 2BXZA 4PR5A 4DKDC 2CD0A 5I0XA 4XAWL 3SDDB 2A74A 4WU5A 4LLVA 2VZSA 1U8PB 3E2HC 4FGMA 5LCVA 1T03H 3X13B 3RQ3A 3AM8A 5A7EA 4L0ZA 2G3NA 4L3FA 3WIFB 2W07B 4WY7H 2BIMA 2X7LA 4NQUA 3MJ9A 4JHBA 2P8MB 3U4AA 5FWRA 1VZGA 4Y16D 3IS0X 3WOVA 5F9OH 3KCPA 1TKWB 2AKRB 2NXZB 1OGTA 2CGYA 3PS6A 4WUUE 2MPAL 2XXGA 4EUPB 2E86A 2I24N 4KTYA 3MRCB 2V5SA 3K3QA 4OZGE 1CU4H 4QT5A 4YN3A 1BVNP 4Z7NB 5HVGB 1XEUA 4XVSH 3DVGB 3BGAA 2EEXA 4ANXA 4FA8A 4JFFB 1CFVH 3V5KB 1MJ8L 2AI0L 1PKQB 4J27A 3U30B 3GMOB 3OB8A 2BY2A 2PPDA 2YXMA 3G08A 5H94A 4P2RD 5FECA 3H42H 3ZL4L 5IOPA 1MVUB 4YBLC 2BNQA 3SYPA 5JPNC 2VISA 4QRQB 3D69A 2FSDA 4R5VA 4LASL 4KUZH 4G80B 4R7VA 1VGEH 5LAPA 3SDDD 4C4BA 5MP6L 1TMQA 3LH2H 1UWEL 2ZKYA 1D6VH 1E67A 1JVKA 2UZIL 5FCSH 4DGIL 1K72A 1JZ4A 2B15A 2ICWI 2IH8A 5IMMB 3U25A 4GAFB 2BSRB 4XCEA 2H5UA 3W2DL 1S7XA 1YAZA 5MENB 5C0AD 3NZHH 4N28A 4MD4A 1HEZA 4OD3H 1H5BB 1N7MH 4QRPA 4NFCA 4UT7L 3V0DA 5BRPA 4ZK8A 5I66A 3ZU8A 5K69A 4JL2A 2NXZD 4GKOA 4DJMA 3RWEB 1U8LB 2LV4A 5IK3A 3DGDA 1HU8A 4MQXD 1PGRB 1ES0A 4JRFA 4Z0XB 1GXEA 12E8L 5L2KB 1SQMA 2CR3A 5GJTH 4AGMA 5IIEA 3UC2A 1DLFL 2K0RA 3KGSA 4JFFD 4ALAH 4YSRA 5EN2A 2GTZB 2CXKA 4E5XA 1GGBL 2VXQL 4GAYB 4FQ1H 4LBAA 3MRGA 1DEDA 3D85D 4YHMH 1YEFL 2ADGB 5KJ4A 4BIKA 5EIVA 1BBJB 4E41B 3SKOB 1NIBA 2E6QA 3PWJA 4YDVA 3VI3E 2VOTA 4XNXH 4AIZA 4X4MA 3S3BB 1GH7A 1TJHH 3QEUB 2YA1A 3N9GH 1OF2B 3P3UA 2HPTA 3V0JA 1BA9A 2FEJA 1SFDA 5DK3A 3HLAB 1BX2B 4FXLA 1OO2A 3DROB 1ZANH 4MX7A 1KCBA 1QEWB 3X2QB 3CQQA 3O4LE 4IJ3C 4B27A 1MJ7L 3CH1A 2OZ4A 2XT1B 2EVIA 2OX5B 2ZPKL 2ALWA 1EO8H 1ZXKA 3V52L 3CSGA 1T7WA 5ICYB 1MW3A 5GGSA 5HGHA 4Z3EA 1XD1A 2MTAA 1A6PA 3AUVA 3GNML 4CMMB 4X7TA 4KVCH 3VI4E 3VFUA 3VGEA 4G6AD 5JIQA 3QJHA 3PAYA 2YC1A 3FTYA 1PZDA 2BP8A 5CGMA 5L2KD 2F53B 3UCQA 3VSUA 4KO6A 3OKNA 1IBHA 1P6AB 3OQ3B 3BGMB 3OPUA 1IGIL 4HCRH 2HZHA 1M3IA 2B1AL 5F7BA 3DUUB 1S3KL 4J3WA 4FN0A 3FRPB 5ELIA 5EWIL 4G7YH 5IB1A 2H2SC 4E41D 1UXSA 1V3LA 3Q2CA 4WK0B 1GC1H 4FI6A 2DLFL 3HRZA 4TLTA 3GMRA 3SE4A 3WEBA 4FZEL 5GSRA 1WS7A 2BH0A 4JM2A 4GB9A 5IB3B 1MW0A 3GI8H 2R59A 2GG1A 3OJVC 5EBWA 4OSUH 4MA8L 4PRIB 1CYXA 2E6JA 4FQ2H 4XP1H 3IETB 2JELH 4WHCA 3VTMA 1UM5H 5CN2A 1JWMA 3M1OA 3FPYA 1OTUD 4KTDH 1JWSB 1ETA1 1M05B 4FQPA 4F20A 3JTSA 1QBLH 2JJSC 5CLWA 15C8H 1YUHB 3FQWB 3I9IA 3C2SA 2CRYA 2IGFH 5KVEE 2ZCZA 5AKSA 2H41A 3OBAA 5JORA 2OMUB 5E7BA 2IG2L 5DC9B 1U3ZA 1JZDC 2ALAA 2Z31A 4ZX4A 3VD0A 4YSOA 2CWRA 5E8NB 1C5CL 5DD1L 3UTZA 1F8TH 32C2A 5D6DA 5HYJA 3TEWA 4PLKD 3R4RA 2X1OA 1N64L 2J8UA 3CDYA 3GBDA 3GIZH 3FT4B 1Y1DA 1LNUA 3Q6GL 1MRDL 3HRPA 2H47C 4Y9GA 3G5XA 2DMCA 3PGDB 3AG4B 2XWCA 2COVD 1NCAH 1OB1B 3AC0A 1J48A 3RL2A 5EIIB 4RFNC 4EI5A 3GSNL 4N8VA 1MCWW 1XSIA 1BXAA 2ZXGA 4CSPA 1NEPA 5HHOA 4YFEA 4PRID 1KEML 2GT9B 3ATDA 1DQLH 2WBJB 3ESUF 3K46A 1KULA 5BQ7A 1WHOA 3FTVA 4JDTL 4JFEE 4RAUA 5ACZB 1FL6A 1QLRA 1QX1A 4Y5YC 3B3IB 2W38A 3UJJH 3P4LA 4QLRA 3V4PL 3CDFA 4FTDA 2D0GA 3ZE1F 2TSAA 2QQKL 1KLGB 3N44F 4K07A 4JGJA 1BZQK 4JFVA 1A7RL 2EO7A 2GSIB 1KYDA 2WLHA 2XRAL 1XQ4A 3O3EB 3B34A 3RA7H 3UTPD 1D5MB 4H1LB 5L2JB 3D25B 2D73A 5DJ2B 1YEHL 3QEHB 2YAHA 1DL7H 2X3BA 4LRIC 4QHNB 2V2WB 3QHZH 1F56A 4PBDA 5B38G 4YGVB 5GRYA 3HUJE 2AV7A 4QOKB 2F58H 4ZDHA 5T1DH 4KTEH 2IVFC 4ZFFB 1I3GH 3NACH 1WZKA 1PBYA 1DBKL 4OLYH 2VRAA 1GGYA 4MA1C 1W6WA 4ZZKA 3M6DA 3NBNA 3P9LB 3KPLB 2BFVL 4XPBL 3IFNH 2WBJD 4LXFA 1KTJA 1S9XA 3DRTA 3VWKC 2ATPB 2IPTL 4OH2A 1OWWA 4U1JB 1NCCH 5DVLA 1FYTE 1CGXA 4XT1C 4OM1H 2QPFA 3S34L 1NGYB 3G7TA 5C6PB 1FGVH 4KO9A 3T5WA 2VERN 4CC0A 3MMEB 1GRWA 3CFUA 5KANI 2W0PA 3JVGC 1I7UA 2H1XA 2XN9E 3IKKA 1KF9B 4XN4A 4ZMQA 1MCLA 1OAKH 2ITDA 2VN5A 3P4MA 4GMTL 3FBKA 5AD0B 4HIEA 2GTWA 5E6SB 4AQAA 3LPPA 1AR1B 1A64A 2HT4D 4OIIH 4Z7AA 3LRLA 5JO5A 4JFYB 4U1GC 1IVTA 5I6MA 2QVTA 2WWKT 3IDXL 4DSYA 3DIFA 1ETJA 4QOKD 4LE8A 3JBG7 3AG3B 3VYNA 2J88H 4U1HB 1HL8A 1KXTA 1UC6A 4M62H 4JX0A 3CLFL 3S8GB 2NZIA 3S2CA 1FSKB 3V6OC 4NENB 2OK0H 2C9AA 4H0IA 2NZ1A 3BIBX 4GW1A 3AACA 3KGTA 4ODTL 5C3IA 1ADQA 2QPSA 2CKBA 3BVUA 2Y3NA 3KAAA 1MRFL 2UWEA 1B90A 4TF4A 5FO7B 5TGBB 1T66C 1FBIL 1UM6H 4PVLA 4JO8A 1LO3L 4N0YH 3EO1A 3MOAH 2BC4B 2CRIA 4GW5B 3MBXH 3S5LA 5GGRA 1MCHA 4K7PX 4WEBL 5IVOA 4MD0B 4HMDA 2IANE 4YHPA 3B9KA 3T0WA 5A43C 1U92A 4XVOA 5E9AA 4PFEA 5KS9A 1JGEB 3N6YA 5BRZA 2BO0A 1U8IA 3FSWA 1QFWM 1OPOA 4IGBB 2V2XB 4KFMA 5D2NA 2Q2EB 1Z9SB 3QNXA 2ENYA 1JRHL 3A6BH 1AR1D 3B9DA 4MNHB 4FTVB 3ML9A 4U3SA 4ZOEA 2NY1C 1EO5A 1HE8A 1OGAB 4MVBD 3CSYA 1INDL 1WFIA 1YPZA 3QNYB 1YNTF 1BSIA 1T22A 5ALBL 1KCUL 4PGCB 3MRNB 3QCVL 1AOZA 3UTSB 1FGNH 2V7HA 5IROC 2EYRB 4QGYA 3CMGA 2VNCA 1R33A 4GLRI 3VFRA 4ZS7H 1O9ZA 4J3UA 2EH7L 5F71A 4DVRH 4YXHH 1UB6B 3BUQA 4HPHA 4KU1A 1L3WA 4F7EA 2YPVH 4BRVA 5DWPA 3GZOA 2CHXA 4XTRC 2GFBA 2O5XL 4OQTA 4FNTA 1EIBA 2FIKB 2AEPL 4AM0A 3SDCB 4B9GA 3T0EA 5ADPL 3CC1A 2OMYA 3TCLB 4ENEC 4IGBD 3GM0A 4TNFA 4H2AA 1KYOK 4BFOA 3QQDA 4J12A 3TO4B 4HJIA 4P4KC 1FVCB 2O5YH 3AXLB 1IILE 3UDWA 1H6FA 4FTVD 1HFUA 3D0VA 3N85L 1OGAD 4XXDB 3ZKNC 5FUZL 5CJOL 1FO0H 1UCTA 3UTSD 1C5BL 4UAOC 3BW9B 2X6AA 3TWCH 1JPSL 1QUPA 4JVPA 3LKPA 4ENZA 1ODAA 4HK3J 3BVWA 1C5DA 1EDQA 5T3ZL 2B08A 4Z3JA 1MNNA 2VR3A 5FM5O 4BFJA 2OW6A 5CEYB 3SZ6A 5HBBA 3QUXC 3HOGA 4QNPE 3KCWA 5KBDA 3SDYL 4AEFA 3P2TA 4DGVL 4FADA 3MLYL 3FN3A 3O3AB 4MWFB 1CGWA 5H37H 4AK2A 3LKNA 3SDCD 1AKJD 3G6AB 3OKLA 5I1KH 5KVMC 3J8F7 1GOHA 1J8HE 4IKJA 2VN6A 4JJOA 2ARWA 1OGPA 1XDTT 4LAJH 5J5EA 3TO4D 2E59A 1F4AA 1AGDA 4JG0H 3SKNA 1BIIB 4LDEB 1J9SA 3AVEA 3EJQA 3SDXF 3UZEA 2AJXH 4FFVD 3WYRA 3TBYB 4LCWA 1NKRA 4P0DA 3ZE2B 3LHAA 1BPLB 3FB8A 2R1WB 4B41A 2EVFA 3OLGA 4HOZA 3INUL 1CE1H 3QGVA 5G2NA 4LP8A 2BCKA 4QAWA 5EULV 5I1EH 4P4RA 5IWLA 1VESA 4ALAC 3OR6B 2Z91B 3ARED 5I8KL 4XNYH 3UAAA 5FF6A 5EZJB 1Q94B 3DK0A 4A7TA 4LCCB 3GSUB 4PJIE 4JAMA 1F3JB 1TQSA 4W9EC 5JHLA 1QAWA 5INCB 4HX1B 4MMYB 1WEJH 3S4SA 1I9JL 3NRQA 2YGNA 3QUMA 1IEBB 4KK9D 3NJHA 5J3HC 3MLUL 4ZS6D 1TDQA 4LAQL 3WJJC 4ABWA 2OI9C 3ESVF 2V37A 5DRXA 4RFOH 2LTQB 3UJIL 4J5VA 3NPSB 5BQDA 1XR9B 2ZYHA 3SQRA 3BSHA 1NL0L 3OMNB 4GMSH 3GGWA 4NN5C 1JZIA 5TE4L 4OFVA 5JW5B 1QTSA 1NIAA 5E5MB 4NQSB 4PJEE 1I3VA 2NY6B 1EERB 5DD5H 1OM3L 2VJ0A 2WP3O 2BIQA 2EDEA 2P47B 3PRZA 3HVDA 4F7TA 5AWNH 1U21A 4IU2A 4QRRE 4JPWH 5GRJH 5FYJH 2FD6L 1V05A 1WGOA 3V6OE 2CPUA 1E5UI 1GZHC 4N8PA 2XQBH 3SE6A 3QDJA 4CILA 1AD9A 5DFAA 4TMPA 4UINH 5HHMB 3UYOD 2FBJH 3VFSA 1U8QB 4RFEA 1BOYA 4AEIH 3FQUB 4RX4A 4NT6A 4AOFA 4CADB 3IXAB 5DJ6B 1YEWA 4BFGA 1GC1C 1NFDA 5B3SB 1SMOA 1NC4B 1HWWA 4F80A 4JQIA 1THAA 2VN4A 5LAXA 2Y4SA 3KVQA 5HJBA 3QPKA 4X6BA 1JCKA 4P2YA 5HHPA 4XNZB 1J5IA 4HS6B 4Y9BA 5BV7H 4P9MH 1DQJB 2BS8A 2IAMC 1YJDH 2H3KA 1HWHB 1O5DT 3UJTL 3Q05A 4WWOA 3MUGA 2NY3B 3HHRB 3BI9X 7TAAA 2QQLH 1TU2B 3JTBA 1YQ2A 3SEPA 1AGFA 4W68A 3ESNA 3KYKL 1XH0A 5EO0A 4F3FA 3SB3A 2GY7B 4A7VA 3BEVB 5A6LA 5BCAA 3CBRA 2YD8A 2B4CL 3NIGF 4JZJB 1ZTXE 2B14A 1C16A 5ECGA 4BZ1L 3MV7D 1TF4A 2AZUA 1T0MA 2IMMA 4HJ0D 4XNBA 1RULH 2IH1B 3S8FB 3NPZB 2I9LB 5HHMD 2F74B 4MJHA 1RPKA 3R8BB 2R1YB 3N41F 1NC4D 1JXGA 3DPBB 4XPTH 3QUZD 2YBRB 3FFCE 4XMKL 3MFFA 3QVAA 1JV2A 4ZBJA 3FQXB 3U0WL 2P24B 4OZIF 3ELQA 2J21A 1SLWA 1I7TA 4H2CA 3KLHC 1N26A 2XA3A 1YQVH 3EYQC 4FQHA 3QCTL 2HTKC 1DBBH 3PU7A 2NY3D 3CZLA 4N6RB 3T3PB 3VRLF 4NN6B 4OU3A 5A2JH 4YDLC 3B7TA 3EFDL 4AGNA 3L9YA 4Y19A 1FFPB 1FLRH 2XZAL 1TZHB 5E2UL 4NPYA 1FPTL 3Q1SH 5JTWA 2EQDA 3K71A 1FH2A 4B0MM 3QUYA 2GB2A 3S2AA 3BH9A 4MS8D 2P5EB 4JQXC 5DQ9A 5B22A 3MFGB 3LKQA 2UZXB 2PWDA 1WCBB 3VW3L 3K6SB 4L1LA 3HZMB 5AKVA 3RWFB 1M7XA 4WWKB 5FUOL 3RAJL 2ZICA 1N5AA 5ITFB 4PJ7F 5GGQL 1IFGA 3T71A 3GTTA 3UYRL 1X5KA 3DUSB 3QDGE 4Q56A 4HULB 2BDNH 4RMTA 4A38A 3LNGA 4L4VD 4R0LA 1RZKH 2FJSA 4PJCA 2AQ1A 5HHVH 2H32B 2WOBA 4S1QL 4F15C 4OBSA 4PV9A 1JGLL 2E7BA 4K7FA 2IPUG 1YEEL 1XGUA 4OKVB 4PY8I 4BSVA 2PXYB 5HVHC 4MRBA 4YX2L 1RK1A 2DL9A 5CR8A 1EZSA 5HY9B 3EDEA 2GBVA 2HUEA 5F9DC 2UXVA 1TCRA 2WSPA 1KZYA 4N0FB 5L7XL 4KUCD 2F53E 3QFJA 3R06B 1RK0B 2VDLH 3MLSH 1DJGA 4PM1A 5I0VA 3D8MA 1AO7B 2OXHA 1EWHA 3EBIA 3KYOA 4RISH 5L88H 1JXFA 3L4ZA 1DQQB 1E2ZA 5DEGB 4D94A 1FYHB 4I87A 4R96A 2P5ED 4JM0A 2ZTBA 1NCOA 1U41A 2D7TH 3KGUA 1A3RH 1PY9A 3CC5B 4GKLA 1OE3A 4PGBB 1CFTA 2ZUWA 2XA8L 1JUFA 1MUJB 1KB5L 1WFUA 5CGYC 3MRLB 1KY6A 4UILL 5C9JB 4HBQA 3L9RA 4X6DE 3WLWD 3CQFA 5C09A 3T2QA 3MACH 4H88H 4MA3A 4X5LA 3AGWA 1OP3H 1DSWA 1F97A 1HOCB 4NFBA 2NSMA 1QVOB 4H8WL 4P57A 1G6RH 5TQ0L 3WUWG 3L1OH 3BRFA 1KENH 1V54B 1ONQA 3HFML 4DTGH 4TSBL 4XO8A 2PXYD 3GKZA 4L3EE 1KYAA 3CDCA 4QHMA 1QOKA 5SX4H 3OMIB 2Q86B 1KBVA 3BLPX 4W1TA 4AMWA 3BLKA 5DJYB 4Q14A 1EXGA 5IFHH 4JY6B 4JFQB 3QIBC 3VD5A 1F42A 1O6SA 1S5HB 4TQPA 1AO7D 4BE5A 2WLKA 3QIWD 3DMMA 4PRHA 1NCDL 5FM4A 4UTAL 1LTXA 3DX8A 5GGSY 2MQCA 1IIIA 3MO1B 5DO2C 1OALA 3EGXB 4E9VA 3DO3A 4O2CB 3CBKB 3ES6B 4A2DA 1JZGA 5CSZA 4FLOA 2VC2B 2YGOA 4XP6H 2OZNA 5CEZL 3VXUE 1GVIA 4IIQA 5GZNA 4XBEH 1KELL 1T5WA 4AC4A 1HHIA 4XO4A 4G7SB 5IQMA 1K8DA 1RZPA 2BVPA 5EU3B 5GSVB 3APNA 2DQCH 4CRPA 1I8LA 1ZV2A 1VKXB 2VABB 3WJLC 1KJVB 4TQIA 4CVWA 4EDWL 3DJZA 2MOGA 4C56D 4QY8A 3STZB 2O30A 1E4XI 4D2NA 1H19A 5F3BB 2CR6A 3MUUA 3N55A 4NI6A 4S1RH 5F7KC 5HDLA 1XXFC 3AZUA 4XO9A 5T3XH 1B6UA 3QWRA 4WGWB 4Z23A 3MUHL 3LKSB 1O75A 3S5YA 4Q6IA 3OX8B 2MEJB 4XPHH 3HLKA 3D18A 3UERA 2WK2A 3KJ6H 1NPNA 1U95B 4BFNA 5JOPE 1JHKL 4ZTOL 2QEJA 1H9VA 3LZFH 3S96B 3VQ2C 3DXAB 3BKJL 3Q13A 5J12B 2XLLA 2R0ZH 1ZK5A 4RNRB 3V0HA 2YD7A 3SSGA 5CP3A 1G7PB 3NH7H 1GZQA 3ISWA 5DJ8A 1XH3B 3LRMA 2EH8H 4I77H 3C60B 1MCJA 5TPWL 4M61A 1L9OA 4NM8H 4I5BB 3JWDL 4ZRGA 5E1AA 2FECI 4HK0B 3ME0B 5EO9A 4OF8A 3DIDA 1MNUL 3WIHH 4GNKB 1UD4A 2AEOA 5L4IA 5DRWA 1CFSA 1BOGA 4A67A 5DSCB 3EUUA 4LGPB 3WTXA 1FG2B 1A1MA 2LTQC 3TNMA 4XMPL 1W72B 3FQNB 3FO9B 4XCCH 5CZVH 5TQ2H 5JZ7C 4Y5VA 5KSBF 2X70B 4FNUA 2MQ3A 3FQTA 3DXAD 4O51A 2XKNB 3D7PA 4EN2A 1I3RB 4QKXB 2B20A 4P2QB 3QJRB 1U36A 3DO4A 5LO7A 4WIQA 1G43A 4F9PA 5AQ0A 3LZPA 4Q2ZB 3QR2A 3EDKA 4HGWB 1IGFL 1J8KA 4YO0B 1XGTA 1A8JH 4ZSOE 4XBPB 4B9CA 3C60D 2V9QA 3NJIA 4XI5C 5F1IB 1OP3K 4IRZA 3L9BA 1VFAA 3L45A 5BVPH 1U6AH 1LP9F 5FYLD 3E8VA 1XF2A 1J1OL 2D7MA 3FHEA 3OL2A 5IVXE 1UENA 2VERA 1PAMA 2MPAH 4DETA 5KBPA 3RB5A 1KXQA 3TA3B 2ZKHL 4PJ5A 3N91A 4DHLA 2CDFB 4F24A 1V10A 3IEAA 3FRUA 1AGEB 1VCAA 3QIUC 1XR8A 3ARBA 4F8PA 5DDHA 2X42A 1U8NB 3ZL4H 3S35X 3APMA 3U1PA 1AXSA 1OXYA 2I7SA 4G70B 5AKTA 2YEVB 4LASH 4E9YA 2N7SA 4P23A 2CO2A 2VB5A 2A6IB 3MRKB 3OAYH 4OV6F 4P2QD 1UWEH 3M7OA 2UZIH 3BVTA 3M1BB 1X5AA 3PHSA 4PEEA 2OCCB 4I13B 4JZOB 3RUGA 3TX4A 2JJTA 1PAZA 1XH2A 2SODB 2XG4B 4HKZA 1Q9WA 1XBDA 3PNWB 3OAWA 1OAUL 3WE6A 5C08D 5EO1B 4LLQA 1J9RA 4XP5H 2WLLB 1O7VA 1X5GA 2V17L 3SYAA 4ZW5A 4WHDA 3DK2A 5D4IA 3BZEB 4P3WA 2QSTA 1YN6B 2EO9A 1CFQA 3FF7A 3PXLA 4ZD3L 3TA3D 2K6WA 1S9YA 4HXAH 3FO2A 5E0FA 2IWGA 4CNIB 3BZFA 2DWEA 1RP9A 1XGQB 4H0LC 1J12A 1DLFH 4XHJC 3VD3A 2VE6A 3SYCA 4G6KL 4FKHA 2DLHA 3MDJA 5BV7C 1VSCA 3CXDL 4LLYA 1YEFH 2ZT9C 4HWEL 3TN0C 4JDZB 1YJDC 1YNLL 3O3BA 4L3CB 3WO4B 4D9RD 1MG3C 3QZNA 4Z7VF 3FOMA 1IUZA 3BPLB 2FLMA 2L0DA 4DUWA 3ARSA 3MOBL 4JHUA 5DTFB 1K3IA 1T1ZA 2HFEB 3KEHA 2EUZA 4R2GB 4LLDB 5GGRY 3LB6D 2L8AA 4WW1A 4I2XB 4MJIA 2J72A 4GBXB 2ROYA 4JE0A 2IGLA 4M6MH 3RPKA 3SYOA 3ZMNA 2AK4A 5LG6A 3FCUB 1TJGL 4FFYL 5D55A 2E9GA 4J3OD 4ZG1A 1LE5B 1F6FB 4FA7B 3V52H 4QF1A 4EEEA 3GBML 3RZCD 3NG5A 4H0HB 3GNMH 3QXDB 1EAJA 4LZKA 2BFGA 4YFLI 3OMZA 3RKPA 2CDEB 4LSQH 2IMNA 3QHTC 3TASA 4OBRA 1ASPA 4YSUA 2CGZA 1COBA 3AAZB 3B2MA 4JDVA 5HDQL 3UBHA 3MYJA 4UBDD 2BP5M 2B1AH 4MMZB 3RGHA 2QVKA 1N3NA 4F8LA 4HKBB 4HKXB 1S3KH 2WZ0A 4MLIA 1WBYA 3T4AB 2VDQB 3ZT5A 4AW7A 1A3LH 4LMQE 1FG9C 2DLFH 2OMVB 1M71A 3COOA 3UBXI 1TYRA 2IPKA 4XWGL 4PJ8C 5E1QA 5D1XC 1I3UA 4R2GD 5HJ3A 3D0LB 1Q1PA 2ZYIA 4GBXD 2HLFD 1CYWA 4NRYA 5GPRA 4HPYL 1CIDA 4Z7NF 5FYKD 4F9LC 4B9JA 3NAAH 3KW8A 1GL4B 1NTDA 2X4SA 3FUEA 3C6LA 3PAVA 1YUKB 1NDGA 5ESQA 1DLHA 1LJMA 4PTTB 3VG9C 1LE9B 4PJHA 1DE4B 2DWTA 3CVDA 2ZSWB 5DZLA 2WOYA 4B3VA 4HETA 5KWYC 3BD4A 4H0GA 1MEXL 3T1WA 1NJ9A 2OTWB 3WFCL 2JTDA 5HGGS 1C5CH 3S37L 4ANUA 4PIRF 5ACLA 1YCSA 4O9HH 5F89A 4NHUA 3RDTB 4DK6A 1W8NA 1G9ML 4Y1AE 1FFQA 1N64H 1RZKC 2YKKA 4UQIM 3FO0H 3IU3B 1MRDH 1KIQA 3DV6B 3FMGL 1WISA 1O5PA 2VDPL 3ERXA 3VMNA 1WWWX 4Y4FC 1SLUA 1P6FA 3BX7C 2KMWA 5IW1B 4Y7OC 1KWKA 5HDRA 3OAYK 1QPKA 3H54A 2NT0A 3MA9L 3RYMA 1AZVA 1YG9A 1OCRB 2VLMD 1IM9A 2EDFA 1J1PL 1KEMH 5TH2B 3WY3A 5E8OA 5CFHA 3CQPA 3D4YA 3JTTA 4HW6A 3EGDA 5D7KE 3HB3B 4PSRA 4FXGA 2XKUA 4PR5B 3T0XA 3QWNA 5HPMA 5D2LA 2CUHA 4FFZA 1I8UA 4JRYB 4LU5L 3GMLA 2Y22A 5DUJA 1VACB 2QQKH 3PV6A 4QXGL 4FYRA 4X0KA 1A7RH 1MJJA 4JJ5A 4UIMA 1I1YA 5KYUA 3RX8A 2HRHA 3RDTD 2P9RA 2G60H 4J1UA 4PP2A 5G4OA 2J8OA 3UTTE 2NYYC 3ZMEA 3O2WH 4BWTA 1LILA 2JTYA 4FXKB 3NUKA 4JFWA 1YEHH 3ARTA 3TO2B 4DOHB 1YEDB 4DGWC 4X5XB 5I1JL 2Y6SC 2ITEA 3QDME 1CL7L 2ICEA 3GSNB 1ZHLA 2DTMH 2F7IA 5EU5A 2QTEA 2VJ8A 1WHPA 1DBKH 4KXZH 4NZJA 2WO2B 1AZCA 2J6WA 5FYJE 1WS8A 2DQFB 4U6HB 3WKML 1CDUA 3JYCA 4LSUH 2BFVH 1J8SA 2ZP0T 3II3A 4OQ1A 5EU4A 5F0JB 1M9SA 4G8GA 2OYLA 5FECB 2DQGL 2WB1A 2BNQB 2IPTH 4IHOA 4GAGL 4N26A 1WFOA 3A6CL 4AYGA 1F3DJ 5AAWA 5CCKL 3V55A 1KJMA 2OP4L 3ARFC 1RJYA 5LXVA 4KWUA 3QEGL 4WO4B 4M5ZL 1JHTB 2OV0A 4ZOCA 5EBLB 4ISVA 3RDJA 3UO1L 5FYJU 1LL1A 3UROR 2ARJB 4UM9A 3GHBH 1D5BA 2GEEA 4QRUA 5B8CA 2EIKB 1KBWA 4L4TA 1EANA 3OJMB 4PHZA 2M1KA 4NQEB 5I66B 2BSCA 5IG7B 4F57L 5IK3B 4MYPA 2QHLA 2FQEA 1DUZB 3L3HA 4P46C 1CICA 4AJ0A 2EIDA 2LU5A 4LVHC 3MGOB 5AOMA 5K1JA 1U4EA 4O02A 1GGTA 2WAQA 3CLFH 1MFAH 4HJGA 1YLBB 2YQBA 4E5XB 4X98B 4JFHD 2Y7OA 3UZVA 3MRGB 5I1GH 4OGYH 4B5EA 5ESAA 1LD9B 2B16A 2F7PA 2OSLA 1YEGL 3SPCA 3QG6B 1OW0C 2I85A 2ODHA 3IMTA 1MRFH 2BNQD 4JL1A 4ELDA 4C8XA 5L8KB 3MXVL 1FBIH 1IZKA 1SF5A 2CALA 2IBGA 1PZBA 3LQZA 4WO4D 1QSVA 1VIWA 4JS7A 1LMKA 1H3GA 4W6YB 4A6YA 2IBBA 5TK2A 1R9FA 4MX7B 3MBWA 3CH1B 1DVQA 3GUTA 1XT5A 3RIFF 1JIBA 4HHAB 3OJDA 1EXUB 4ELMA 5IW6B 3U7AA 4YSSA 4ZFOA 4DP6X 4IOFD 1TR7A 3MBEA 3RNKB 3HHSA 2R29L 1Z5YD 4G1MA 4NQED 4GRWH 4P5TC 1S7UA 2J1WA 3QJHB 5EEVA 2YC1B 3AUWB 3ECVA 3IPFA 1INDH 3MAWA 1T4KB 5MHSD 5CIPA 5D1XE 3IFLL 2QELA 3NJVA 5ALBH 3ZDWA 1A0QH 3HC0B 3TNNA 5IQOA 4BQ9A 2APBA 4IOIB 3OXSA 1KGIA 3VXMB 5A6IA 5JPMB 1LK2B 1M53A 43C9B 4NQCE 4TUKH 1I7ZA 1OANA 2HMIC 4AIXA 3VYOA 3HN8A 3O2VL 1DDHA 3IJSB 2HG0A 4OD2A 2DH2A 3H2WA 5T1MA 4YSCA 3D30A 1HSAB 3HRZB 3GMRB 2OJZL 2YUXA 4WFHD 3T2NL 5EOCH 4WFEE 2RIKA 5DXWA 3N0PB 4EDXA 2NLJA 4C4UA 3GI9H 5JQHC 2BY0A 1EX0A 1G7HB 5J89A 4YPGB 2Y7MA 4A7UA 1KPUB 1RFDL 4K71C 3EOAB 5IV2B 1CBVL 3RVXD 3OR7A 2ITFA 1WA0X 4MCZA 4HSAC 3PP4L 1JNJA 2YSSB 1T2XA 4BGLA 3ULSB 3BXNA 3C08L 4D7PA 3DO7B 4M00A 1L5GB 4UT9H 1SDDA 3H7LA 2VIRB 1V7ML 2VLJE 4XCYA 5CJOH 4KI1A 1ZLUH 1QLEL 3KS0J 3LDBB 4RQQB 3RI5F 2CIKA 3K0WA 1OT4A 3GLDA 4QXUL 5DS2A 3VXMD 3JV6B 3U7YL 1WZMA 4I3SL 5B4MD 5IT2L 4FJZA 3LXBA 1E8YA 2PTTA 5I8EA 5T3ZH 4TNWF 4C59B 3SCMA 3SDXE 3K2KA 4D0CB 3BAYA 1X7TA 1UZGA 4X4XB 2ZCHH 1EPFA 3VMOA 5I82A 4OLWH 4NYLA 1A4KA 1OD7A 2GK0B 4N8VB 3SDYH 3VX0A 5ILTH 3HTLX 4LHUA 4U4IA 1AHMA 1UWFA 5ITBL 4DEPC 2X0UA 5HHOB 1DN0A 4G8IA 4ODSL 3OLDA 3P02A 3C5SA 5JHBA 4HUVB 1TQUA 3IWUA 3WKYA 3EYUL 3IAGC 2V3DA 4KITB 3ECWA 2NR6A 4QHPA 4Z7UF 1QLRB 5LVEA 5AOZA 1BF8A 5I1LB 1U8HA 4M5YH 3V8CA 3ORJA 3UC0L 2ZOLA 1MFCH 3WE1A 4BQBA 5GGTA 3ZT6A 1IKNA 1PL3A 1S78C 4ZOAA 3EJYD 3F84A 4M56A 2XVGA 1FZKA 2CNYA 3P73B 1P5UC 1AGCB 1JZ2A 2J4WL 3RL1B 3INUH 4RAHA 1QFWH 5HYJD 5M95B 1SMAA 5TDNA 2EEAA 3BPCB 3WNNA 2WXFA 3BQUB 3ZL2A 3H3KA 4LGSB 5I8KH 1U3HA 5I71C 2JSFA 1ZGLB 3HE6C 4DZ8A 3KPOA 3HMWL 4N5EC 4O2EA 4M1CD 4P48A 1D6EA 4XMXA 4YDKH 5T5NF 4GFXA 3LJ3A 2A6DB 1ACYH 3U1SL 3QJFA 2AV7B 1ZWIA 1I9JH 3O8XA 1ZT1A 4QYOB 5E6YA 1Y6NR 4LLMA 4JY4B 3ZZSA 4N0UE 2IBZY 1BJ1J 1PLAA 5HHOD 4ONGH 4BFBD 1SPDA 5K9OB 2QGCA 4LSRL 3LRSB 2J1XA 5DHVA 4V1DB 3DRTB 3BVVA 4MAYA 5E6IB 4UWQB 3ZSTA 4JHAL 1ZLVH 2ILLA 2ID5A 5BZWB 3TL5A 5TE4H 5GIRA 2OW7A 2C9SA 3HC3L 3HNVL 4BKLB 4D3CL 4RAVB 5HGDA 3ZY7A 1F6AA 5E1GA 2X05A 3O2DA 3SO3C 5IB2A 1E28A 3FSAA 2BJML 3LZLA 2XVLA 1JYWA 6PAZA 3CPLA 5AVSB 2J71A 3RWDA 5BS0E 5T3XE 5AL0A 4NWUH 4F2ME 2FD6H 4JPIA 2ZKXA 1BP3B 2ITDB 1PCSA 2BOCB 3BDYL 1Z3RA 3ILPA 4ZO7A 3BQUD 4YUEH 2PO6B 4X6EB 3T0AA 1P4LA 5DS8B 5KSVB 1R19A 1NDTA 2XJKA 3EO9L 1UACL 1Y0LB 1WLHA 4FMFA 1OTTD 1X6LA 4W9FC 5JW4M 3AB0C 1WO2A 3BFOA 4LCUB 1SXSA 4PWGA 4PWJA 1M6OA 1H9DA 1EUUA 1KXTB 1SN5A 4P3DB 2F19L 2FWOA 3GBEA 5B39G 5DEFB 4ABQA 5D1ZC 1USZA 5K9QG 4X4KA 2NZ9C 2WSKA 1SXCA 3VXPA 1UZ6E 4P5SA 1WBZB 3GRWL 5LBVA 1JL8A 4V1DD 2ZXBA 3E3QC 3K81A 1CXLA 5E6ID 3UJTH 3FQRA 5C0BB 2OQJA 4GUPA 1J87A 3GQFA 1KIUA 5JUEH 4P2OB 1M7IB 5F6IB 4X9FA 2YGQA 3KG5A 2BIOA 2IC2A 3NTCH 1KCLA 5L8JB 2NQ3A 2KL6A 3KYKH 4UOJA 4L8SC 1SQ2N 4ICXA 4YHPB 1ZLUK 1WZ1H 4HU8A 4ZXBA 4GQ9L 5BRZB 4GG6A 3LZNA 3QDAA 5AZEL 3CCHA 2HN7B 3HNSH 1CDIA 3K6DA 1GIGH 2XNAA 3V4VL 2ENQA 2PO6D 3DTUB 3BQVA 2NSQA 2W9DL 3A4FA 2WMPA 3DOSB 1TVBB 4XOAA 5I76B 4BA0A 4FG6D 4GSUA 1QASA 4TRPL 4LMQI 4U6VH 2H6UA 5GQBA 4LSPL 4Z7OE 2XWBB 3L1GA 2YWZA 3PCYA 4IRSA 5IB5B 1DQIA 5EUOB 4AMXA 1EFXB 1WFNA 4M4PA 5E5UB 4CSZA 4XP4L 1MHPL 3DX6B 3OWRA 2CO6A 2XG5A 3OGCA 5DJZB 1CD9B 3BPNB 3JWNG 3PFQA 3EJZD 5HDBE 3X3GL 5ISZA 3U0WH 3ZE2F 2B3RA 3IJHB 1F02I 4ZUUA 1IX2A 1FN4A 3ECQA 3PWLA 2W81C 2VDRL 1J9QA 1G1CA 2X0VA 5C0BD 4F7EB 1HDMA 3FTSA 5I1HH 4AXWA 2YRZA 3SDAC 5K9QI 4X5RA 2GFBB 2O6PA 1ZA6A 4PCKA 4MXWL 4E0RA 4MJ5A 3Q9PA 4JFTA 5I6LA 2VR4A 3QI9C 5F3FA 3DHMA 3QRGH 3TBYA 2GITA 3QEQA 4PREA 4RGOL 2CUMA 1Q38A 5BRZD 4XNDA 5EU6E 3IE9A 1LHZA 5AB9A 2OMYB 3U82B 4HFWB 4CW1A 2D3VA 1A9EB 3PJSB 1F58L 5DJDA 1E6JH 1KIRA 4KKPA 3HEIB 4V2BA 1GSKA 1ET5A 3APFA 1A5FL 2Z4TA 3RWHA 2C7UA 3VW3H 5IMKA 2EDHA 1QYGL 1G7IB 5A3ID 4H26A 1NLBL 3ZDYE 4MNQA 1EFXD 3RAJH 2W65A 1WT5C 2MQGA 1OY3B 4MRCA 5GGQH 1DBAL 1ZSDA 3WMSA 5HHQB 3UYRH 4PUBH 3W38A 2PCPB 4TVPL 1TTUA 2Z64C 4ZUSB 5ESVA 1UQSB 2K7PA 2DMKA 4OCWH 5IB4B 1ZLVK 5GS2D 4C47A 4R90H 4S1QH 4WFFE 1J5DA 2EVHA 1YNTA 5F96H 1HNYA 4UUJA 5EMYA 1E5ZA 1YEEH 2WKOF 3CPUA 4A7SA 1HHJA 4YX2H 3Q8BA 4PRPE 1IAKA 5E4IA 3KNBB 4M1GL 3RX7A 3OKLB 5E03A 1HKFA 4MQTB 3T0ED 3B2UD 4PJAE 1EBPA 3BSGA 1XF5A 3HCVA 2AGJL 2PP9A 1DFXA 4KRPB 5BNXD 1CZ8L 4WFGD 1R5IB 2VZOA 3VCLB 4L4JA 5IEHA 3N1PC 4BH8A 2A77H 1GS7A 4JO1L 4M3JA 4QWWC 4BZ2H 5DZOA 3O9WA 3TPUA 1KB5H 4F1SA 4EN3A 2YFOA 4AYFB 4P4RB 4XNUH 2LLNA 3RWCB 4DO5A 1PTZA 1TZ8A 2OZ4L 4KI5D 3TZVB 1ZS8B 3ULVL 1J05B 4MDJA 3FZUD 3X12A 2V2TB 5TQ0H 5I73C 2O61A 3ABLB 4XXCC 1FVEB 3I74A 4KDVA 3NN8A 3S4SB 1A6ZB 1OSEA 2ZWKA 3Q3GB 1RSYA 2F54E 3LYRA 4TSBH 2WQRA 1ZGLM 2HYMA 4E42A 3P3TA 1J5OH 5D72H 5HI4C 5IUSA 3E1ZA 5HI3D 1CR9L 4FP8L 3G5ZA 2F7OA 5E2WL 3T8XB 2YMOA 5LWYL 2WIIA 2PW2A 1CG9A 1SY6A 2A9NH 4KRPD 4WNSA 3SPVA 2GJJA 3V0WL 1XIWC 4NKDA 1NCDH 1CPUA 3F5WA 3ZXAC 3AG1B 3K4ZA 1OP4A 3TFKC 2UXTA 1BV8A 5LXGL 4WKZB 5KYWA 3BD3A 1W9XA 1HQRA 2KLRA 4KHTH 5T1LB 1NUGA 1VEPA 4OT1L 2LGNA 3MXWL 2AEQL 1IC4L 2Z4QA 2MCPL 1NAKL 4U7SA 2CBQA 2BCMA 2A2QT 2BNUA 3T3PF 5H35A 1EK3A 3QDJB 1QNZL 4X5WA 1S5IL 3SJVE 2QMKA 1QRNA 3E3QE 3TYFA 4JFPA 1AD9B 3U4BL 2AANA 1SFHA 3WL9B 1AS7A 1P9MC 4HIJB 4KUCF 4RFEB 4OM0H 2NXYB 3U0PB 2W8CA 4EDWH 1NFDB 2JI1A 3BPOC 3KXFE 1JZFA 4MMXC 4JRYE 1EGJL 4WUUA 4YXKH 2EDOA 5CJXA 4OGQC 2FWUA 5D1QA 3M1CA 5CSGA 2WLIB 5AALA 4YHIA 2ZXWB 5I8OH 4K3GA 4UAHA 3BWZA 3NIFB 1OAZL 2CXGA 5EEWA 3UG3A 1H8NA 4HIXL 4LOUC 4N86A 4QUOA 1CURA 1IBDA 3O6LH 3QZWB 4FI7A 1C9SA 4FF9A 1JHKH 1E4WL 2FLBT 1RURL 1TQBC 1JG9A 1RZ7L 1VFBB 3CU1A 4LEOB 3ETBF 4Y0GA 3RI5K 4W9IC 2VO5A 5T1LD 2V3EA 3O6MH 3T9WA 3L5XL 4XVTL 2MCAA 3G6JE 1S7RB 3ZHDA 4X6CB 5IQ9B 1C16B 1MXGA 1BEXA 2MKWA 4CDHA 3QDJD 3RB7A 1T0MB 1QUNA 4AH2B 2DV6A 3MLVH 1T83A 2FIRT 3L3GB 4X83A 4Q9RL 2NXYD 4EIUA 1HNGA 1MNUH 4RX4D 2R56L 1L0PA 3C09C 2N1KA 4NUPA 2F8OA 2BM3A 5C07B 3CLEL 4K7PL 5JXED 4YSPA 1F11A 4IBZA 1JV2B 5E23A 4B3EA 3SBRA 2DLTA 2W80C 3HG1E 3QO1B 4QYAA 2FTAA 2YD1A 4K94L 1I7TB 3MRMB 1JI1A 4JKPH 4M7JL 1RIVL 4NGHL 4NNXA 3V5DA 1KCKA 2EIMB 2KC0A 2CMRL 1KBKA 1NAML 3BE1L 4W9JC 5FGSA 2V9RA 4B53A 5AW9B 1XH1A 3VI3A 1AQ8A 2R1XB 2DKMA 1T89A 5JNYB 2FSEB 5CEZD 4BKSC 5FGCE 3K2UL 1YHPA 3UYPB 1BGXL 1CTOA 3C12A 4GKZB 4YDMA 4NPYB 1KJ2L 2W1NA 1HQ4A 2IH3A 1R3IH 2ZWYA 4F37K 2BOBA 3O4LA 5D93B 1LEKA 4OV5A 5J6HB 3BRGC 4U1MB 4CU8A 3NSFA 3K8LA 1QLFA 3LKQB 4PWFA 4O58L 4RIRB 4A2LA 4U33A 2F68X 1ODUA 1OTUC 4JREC 1Z7JA 3SPJA 4OZFA 1I1FA 4AG4L 2ZKHH 4X9GA 2KQMA 4GRLA 3VFGL 3ZE0E 4TTGA 3FB7B 3L3DB 1ZVSB 2XIIA 5I1DA 3ZYOA 2CDGA 5DUBB 4HEME 2XV2A 2CJ3A 2CKNA 2HVBA 1QTYT 4PJCB 4OGAD 2R0KL 3LEXA 4L8DB 2DBLH 4ELMB 4KJQD 4KPHH 5DD6B 1VZIA 3QFDA 4W9KC 3UPCA 1JDAA 4ZAKB 3MV8A 1RK1B 2YRLA 2JB5H 1QO3A 3OSVA 1MI5A 4Y19D 5SX4I 1B0GB 1WDAA 2GI7A 4UT6L 4LGRB 1NGWA 1WBXA 2QLVB 4UNUA 5D96B 2TRYA 3KYOB 4XNMA 4DZBB 1U30A 4DP5X 3T65B 3IDIB 4DVBB 2DYSB 1IMHC 3WFBH 4R96B 4XBGA 4PH8A 1V27A 1UM4L 3DBSA 5IVZA 2CKBL 1F6LL 1MAML 4DESA 2V17H 2CHZA 1P4BL 2BY3A 3O6FC 5JIHA 2Y1ZA 5BXFA 5I30H 4JKWA 1PX8A 5EZIL 5SWZB 3RWGB 4APQA 3P0VH 3ZRCC 4UQ2A 3UZQA 4X9BA 5IR1B 3WN5C 1B3IA 2H8PA 3L9RB 3LEYL 3BP6B 5C09B 2VYRE 4BHUA 4CSTA 1CGYA 4O2FA 1LWHA 4JHWH 2G2NA 5BOZG 4NI3A 3H9SE 1TEYA 4AQ1A 3CXDH 4HWEH 4FEIA 3RVUC 1WVZA 1H6UA 1KN2H 3D9AL 3TBTA 4PJ7A 3W0WB 1TVHA 4WW2C 4GRWE 5D7HA 4L0PB 5FK9B 4ZAKD 3J27A 4L29B 4CVZA 4QHMB 2MFNA 3NK4A 3CVHB 2EYSA 4Z7QB 3ZDZE 1KGWA 2G4GA 5D7SH 3M88A 3X11A 4OZHB 1TJIL 5HD8C 3CU7A 1X7QB 1TJGH 4R4FH 3NJMA 4FQJL 4BV1A 5AAPA 5FOJA 4M7LL 1EMTH 1KG0A 1MLBB 4LO9A 3KWWA 3VH8A 4KJPD 4XCNA 5C0CA 4MAZA 3CHOA 3KD4A 5MEPB 2GSGB 4N2DA 5B1JC 5A16A 4X80H 4JFDE 5SWZD 4TVSa 3U2IA 1KCRL 2QTVA 4KY1L 5ERWB 2I27N 3VDAA 3LS5H 5GS1A 1AGBA 5IBTH 1OGSA 4L1DA 5ID1A 1X9UA 5C09D 1WAEA 3REVB 3FF8A 4PRBA 5HDQH 4KKAC 4KVNL 3U4EB 4NQDA 5GGVY 1MJUL 3IFOB 1NCUA 5B7FA 3UXFA 3U9PL 3MGAA 3OG4B 3W0WD 3RILA 2IV9A 5ECJE 2EDYA 3HR5B 4GPVA 1AE6L 4XWGH 2EIZA 4JDEA 2GYSA 4I88A 1RZJL 4ZQKB 1AIZA 4LBEA 5CU5A 4AVHA 3TIDB 3F3HA 3NSYA 1JZ3A 4H13C 1FFOA 2JCCE 3GK8L 4Z0BL 3RZWA 3VGGA 5T3ZE 5E9DE 4JO2L 4NRXA 4YNYB 5C2UB 4PJFE 2XWTB 1EJOH 4YC2B 5MEOB 4CUCA 3ARGC 3LS4H 4ZO9A 4L9LA 1GZQB 4JKKA 3EG9A 3QORB 3WFCH 1N8ZB 1ETZA 2VN3A 3K7UA 3L5IA 3D05A 4UDUA 1OSPL 4JCWA 1UCBL 4M61B 1NANH 3ARDA 2NW2A 1G9MH 4RRPA 4G9FA 4ONFL 2X6BA 2XN9A 3EF4A 4RWHA 5K1VA 3TZVC 3CIAA 4IRJC 5LGKA 4ZFGL 5A2FA 1QSFE 3DDFA 2XTJB 4QHLA 4YPJA 4J3OF 4NJAL 1CFSB 1HL4A 1U8MB 2X4OA 3RGVB 3TBVA 3MLXH 4U2ZA 4V11A 1FFNB 4LPYA 1XGYH 1B2WL 1GJUA 5EV7A 2FNWA 4ZTPL 4MJ4A 4QKTA 3TA4D 5J1AB 3TNMB 5BZZA 2XBZA 2XHNA 2PYEE 3DJTA 3W9DA 4X7CC 4BGDA 5IKCA 4J6IA 5KVGL 5KYYB 2M8XA 5KJRL 1VADB 4E9TA 4Y2DC 2H3XC 5DGRA 1XCTA 1P7BA 4HS3A 3UAFA 5JHLL 4LU5H 1YA5A 4RRPG 5CWSA 4TUOB 4FERA 2EACA 3T04D 4NQVA 4U7MA 1HYRC 4QXGH 1ZXQA 5FEBA 5ANMB 3DHJA 5C8JA 2Z9TA 4X7SL 1IAMA 3C5ZB 4DP2X 4DK3A 2XYCA 1VFAB 1IJ9A 3ZYIA 1D7DA 1HH9B 2KPNA 3ILQC 2R69A 3K1DA 4PG9A 2FAUA 4X8XA 2BVTA 3Q8EA 1NCWL 5JW4Q 4HJUA 2VDPB 3MGTB 4ONHB 4UU9A 1X44A 3DSFL 1UJ3B 2XTJD 3HC4L 4M93C 4R9HA 5GJSL 5I1JH 2WXRA 1CL7H 3JZYA 3RGVD 3K0YA 4L05A 2ZONA 4CVXB 3MVSA 1T6WA 5FCUL 2Y6TE 4OCRL 2L7QA 4J7RA 3G9VA 1I9RL 3ARBB 4TSCL 3ASOB 2UZYB 1CIUA 4UTBL 2O5ZH 4U6YA 5AEAA 4B9ZA 2DQGH 2PF6A 3I3BA 5E8DL 3WI9A 1AOHA 1KGCD 1AXSB 3AROA 1UUSA 1E9PA 1AFVH 3L4UA 5SWSE 1XGPA 2VLRA 3O45A 3QEGH 2EUXA 2WC7A 3VVWA 1CC3A 5DFTA 3ZUNC 2FHCA 5EUOE 5F7YC 1TYEB 1A1NA 4N2LA 1EVUA 5KSBA 3MC0A 3FHQA 1L9QA 2EP6A 4PB0L 3V4LA 4WEUD 3CFJB 1P7HL 4NAJA 4G7VH 3ZDXF 1MFDH 4PMFA 3C5ZD 4Y4KC 3QRLA 2DEXX 3LH8A 1SBSH 2EDKA 3IN2A 2O6DA 4HUUA 1ZRUA 5I6PA 2VQ4A 2PW1B 2KERA 1A3QA 2DJMA 2BNRB 1CDJA 1TLKA 2FL5B 4GKSA 4F57H 3QPXL 3MLZH 3NSDA 1S9YB 2YD2A 5IMLB 5J6GB 1ILUA 3FT9A 3ZTCC 3UMNA 3FO2B 1NOLA 5AL8A 3L95A 2DWEB 5INDA 1R0AL 1R3HB 3P69A 2ENSA 2IALB 1GS6X 2JKWA 1LP9A 1TETH 1ZEAH 3ARBD 4BEIA 2ZE0A 5HVFB 3O3BB 1K4DA 3OKKA 2RACA 3MZTA 4TUJA 1A1OA 3FOMB 3AREC 3NSCA 2OMZB 5ENWA 3O81A 5FYLH 1G4MA 3FN0H 4MQSB 2CLVA 1PG7L 3FQ2A 4Z3GA 4OIBA 3N40F 4FKKA 1S7SA 4IJTA 4HLZH 5D1ZI 1E5CA 4FYSA 1PD1A 1YMMB 5KSAB 5DK2A 3WFZA 1RV6X 4NSKB 4HPOL 3D4GA 4K9JA 3U2SA 4QF1B 3TYGL 2FJHB 4KHXL 1UT9A 2EE3A 1J8HA 1KPRA 1MPAL 3KPTA 5BUAA 3JWDC 3MCG1 3PHOB 2BNRD 1ZT4A 1KIPB 2GABA 3UEZA 2FYYB 3CHRA 3GJFB 3IKCA 3BVNA 4XX5A 4YL4A 1QR1B 1T6BX 3BWUF 3EW3B 5JDSB 1AHWB 5EOCJ 3N42B 5FHAL 2P46B 4JDVB 2WWKO 5AW4B 1T2QL 2XSKA 1NGXB 1N3NB 5IQ7L 1CUOA 4HWUA 1NSNH 2CK0H 4AY0A 1U8KA 1C1EH 1A2YA 3FUJA 4GIAA 1JDCA 2AQ2A 3P2BA 2HG5A 1R5WB 2NX5E 1DBJH 1EAOA 2RBLA 1HYSD 2OJZH 3OXRA 3T0BA 3T2NH 1W8EA 4D0DB 2DWSA 4NKOA 4YE0A 4YXLH 1FDLH 3BUYA 5LGHL 1YMMD 2KS0A 5D7LE 5KSAD 1E8XA 4NRYB 1RFDH 4Z7VA 2HJFB 5EHFA 1N6VA 1CBVH 2G9HA 4P2CG 2DRUA 3BVXA 1QZNA 2APVA 3GKWH 4R4BB 3C6LB 1NDGB 2MQ0A 4AV5A 3QWOB 5D5MA 4PJHB 4Y16A 3C08H 3L7EA 4K5OA 1NCIA 3AFLA 3HZKA 1UGNA 2AJZA 1E4XL 4PJEA 1MCNA 2X6MA 2P5PA 1I9IH 2XN2A 2WWMD 5DMKA 1FNAA 2NUTA 1FV1A 2APFA 2EKSA 2VM4A 4KKLC 4NHUB 1U8JB 4QRRA 3VTTA 3U46A 5FB8A 3U7YH 3V6OA 2FB4L 2IGTA 5IT2H 5IM7A 1WAPA 2YUVA 1IGJB 4P2RA 1HXYB 1DVZA 3IDYB 1E8WA 3OKMB 4QTHA 2BSTA 4JN2A 2N7AA 1MCOL 1SM3L 1J9TA 2AJUL 2FH6A 4HT1L 1CXEA 1BEYH 1IBZA 4K3EH 5F0LB 4A7QA 2WCPA 2MOVA 2I32A 1FC1A 3CVCA 3LIZA 4X4ZA 1GGUA 4B50A 1U8PA 4KXZI 5F9JB 1BLIA 3IJ8A 3X13A 4BELD 2NY0C 5EB9A 3IVKA 3EYUH 1KCSL 3WIFA 4Z3FA 1RLWA 2IDQA 5LBSA 3VAEA 3C6LD 1V7NL 4PRNB 1IAIM 2P8MA 1CE6B 3BN9D 4ZYKA 4F8OA 1WZAA 1TKWA 2AKRA 2MKLC 5GS3A 1TQCC 1Z3GL 1PJ9A 2BMKA 3AMLA 4PP1D 4XVUD 3GXNA 5DI8B 4EUPA 4X0KB 3BAIA 3MRCA 1I1YB 5KYUB 1N5YL 3DVGA 3PPEA 5I75B 1LO2H 5D7IE 4WAFA 4D0BB 2ZKWA 4JFFA 1B3JA 1PY0A 2QSQA 3V5KA 1PKQA 1EEZB 3GMOA 3WSQL 2OTUB 5GS0H 3BAJA 5BPPA 1MVUA 1TPXB 2ICEB 2ZAIA 3FFOA 4N20A 4U1NB 1MRCL 2FR4A 4QRQA 4DAGL 3WTSA 1DVFC 3ETTA 3MTRA 4G80A 1ML0A 4P3CH 4XWOD 1PF3A 4Y7MA 1FL3B 4IOSA 1MF2H 3PQYE 3DGCR 1OV8A 5CAYB 3Q2LA 1OAYL 5LUMA 1KEGL 1MN4A 2BSRA 2ERJB 3OPZH 4EUPG 5EC1B 1PS3A 1SF3A 5FKPB 4OLVL 4TNVF 3SIKA 5MENA 4D3CH 2GBAA 3H9ZA 3LPOA 3RWEA 5C07E 1EHNA 2QKIB 3ULUH 1PEWA 1QNIA 1U8LA 5BO0D 1P6WA 2WXIA 3QORC 5L2KA 2VLLB 3VJ6B 5B8CB 2VL5A 3LHPL 1JHLL 3OC5A 2FO8A 2DWXA 2W9EH 3LY6A 1E7UA 4Y2NA 2GTZA 1GJWA 2YGPA 4GAYA 1IL1A 4DKEL 3TH2T 3EO9H 2ADGA 3BWAB 3Q5YA 1BBJA 1NGPL 1NEZB 4E41A 3BJ91 4RDQG 3SKOA 3LMJL 4KK8C 4J6RH 4RZCA 5DZAA 4MBOA 3QUXA 3MRDA 1CQKA 2XQYK 1DJYA 4NFDA 5CJQL 4NWTL 4OZ4B 3QEUA 1OF2A 1BZ8A 1F18A 3HLAA 1BX2A 3DOHA 2VZVA 3DROA 3QUGA 2I5YL 1B88A 5DD3L 2R4RH 3VXSE 4PVNA 3UCRA 1VA9A 1FZOB 2OX5A 5FA4B 2IAAC 3NGBC 1KTDA 4GI8A 3TBWB 1I8IB 1K6QL 4PGJA 1VGKA 2J8UF 1L6ZA 3LD8C 5ICXA 2ZUQC 1TFPA 2EXYD 3EDJA 2IO5A 4GQ9H 3D39B 2F53A 3OJDB 1IEHA 4ZFOB 4AM0Q 2NY2B 3B7SA 1ZLWH 3TESA 1FE8L 1G9MC 1GSMA 1FIGH 4ZMLA 1RPUA 3QH3B 2JLPA 4G8FB 2W9DH 4G1MB 3DUUA 3BP4B 1ZHNB 4MZRA 3WTVA 2A0LD 4BZYA 3QIWC 1RZIB 4RGMC 1U2CA 4PIBA 3SGJA 1CICD 3TT3L 2DL2A 4G6ML 4NS0A 1HAWA 5CIPB 3C5JB 5A2AA 1JMZA 3TNNB 5LCVH 5IB3A 3WNLA 1UVQB 3MCYA 2ICWB 4RESB 1F3RB 1KGUA 4LSTH 5GGUB 1I7ZB 4PRIA 4GG8B 5DT1H 4LEXH 3IETA 4YL9A 4R7NA 1JDDA 2PCYA 1TEFA 1JWSA 5T1MB 4WI6A 2H45A 3MJ9H 2P48B 3ABKB 3FQWA 3QZOA 3T6VA 4XBMA 4MXWH 4PJDE 4HVBA 2EIEA 3MNDA 5AW3B 4WGVB 3CN3A 4M8QB 3FRPG 3AY2A 4MD5B 4NM4L 4RGOH 5E8NA 8FABA 2R2EB 3OR7B 1Q9OB 2Y0SA 2OJEA 2NY2D 4UI2A 4L2YA 1MCEA 4GP4B 4NHCH 3ZKXC 3V4VB 1F58H 3KPPB 3FT4A 2APXA 3MJ8A 2RJMA 3V4UL 1CFMA 5JHMA 1SDDB 4XN5A 2RFXB 1QYGH 1OB1A 1TFHA 1N70A 4OUUB 1NLBH 3PWUB 1KV7A 5EIIA 4Z7QE 2YHGA 3VXUA 1O7SA 5JHDE 1IQWH 3U6XA 2N01B 1QFWI 4TVPH 5C86A 2Z35B 3HS0C 3E80A 4GT7A 4NKIL 1MSPA 4FHBD 4M4RB 5I8EB 3Q2NA 2GT9A 3WHE1 5G5DB 3VWJB 5F7WC 1NLDL 5F1KC 5ACZA 3EKCA 3I84A 2VDRB 3B3IA 4NYLB 3VGFA 2D3NA 5AYTA 1U8OB 3GBLA 3GZQA 5LNEA 1AXTL 2XIBA 4HAGA 3LN5B 3TURA 1T03L 3N50A 3N3EA 1K4CB 3BZ4B 1KLGA 3FTZA 4Q97A 2H0EA 1ADWA 2GSIA 5T5FA 1U2HA 3ARUA 3O3EA 3H9YA 4WY7L 1X6NA 2AGJH 1D5MA 1GOGA 4H1LA 4IKLA 1CZ8H 3D25A 5DJ2A 5L2JA 5F9OL 3V0IA 3QEHA 3MR9B 4KKNA 4M9PA 1MH5B 2IDTA 3I9PA 5TDPB 4QHNA 4EOWL 2V2WA 5J57B 4RLDA 4YGVA 4PJGE 4S1DC 4ZFFA 1QHPA 2IDFA 1UWXH 2Q6WA 3DJ9A 2OZ4H 3P9LA 3MKGA 2VMJA 1F0LA 4I9WE 3VWJD 3H42L 4I18B 5DUML 2ATPA 3QJFB 1AAJA 3QB7C 2WO4A 1M7UA 1ZWIB 4POZC 4U1JA 1RHFA 4XPAH 3QRFM 1ZT1B 2Y2YA 5IZ7A 4H1LG 4YLCA 5FC9A 4NP9A 3H4FA 3RIAF 2CUAA 1CR9H 3SPGA 4FP8H 4LPXA 1H0DB 2VAAA 3MMEA 4MAYB 5E2WH 4OCMC 1U8CB 1ZLWK 1W0YT 2H26B 5JXAH 2W5PA 4QDGA 1B4TA 3G6DH 3KM1A 5I6XC 5AD0A 4JQXA 5HGDB 1IU1A 5LXGH 2ADJB 3EH1A 2WVVB 5IB2B 5LHDA 4NQXB 1RMFL 2C3HA 5JOFB 1UB5A 4BXVA 2IEPA 3FK3A 5IFAH 4OT1H 3MXWH 4LHQB 3V5HB 1CLYH 1NAKH 5GJTL 3FBQA 3GYRA 3EZ8A 1L0QA 1RUQL 2AEIT 1S5IH 4FQ1L 2MJWA 4NENA 3U4BH 5EZPA 5KW9H 2ZYSA 5DK0B 2HT3D 4WEEA 5FO7A 5TGBA 1T21B 3RFZB 2K4AA 1TJHL 2WXJA 1E42A 3S3SA 3VFPB 1NQBA 3M45A 4GW5A 4OUOA 1ZANL 4U3HA 2EECA 5ANME 1EH9A 1A22B 4MAYD 5C0RL 5I16B 1JGEA 4HIXH 1EO8L 4UIKL 5GXBB 4IGBA 2V2XA 1IO4C 1YYCA 3ZVVA 1KIUB 1G9EA 4X99B 1KY7A 1QRKA 4H8VA 1RZ7H 4MNHA 3WN6A 5ETUB 4ZMNA 3V9CA 3MRQA 4FTVA 2P4AB 4KI5F 1DEEB 4F33B 3QC5X 4WU7B 4LNRB 2PR9A 2ADIB 2Y7NA 5E2TH 1HS6A 3B9EA 3O0LA 4YOKA 4NLHA 4GG6B 2FEDC 4K5NA 3NP3A 3MLRH 4XVTH 1BQUA 3TS8A 2XNAB 4KVPA 5D7JB 1A21A 1TQVA 2EYRA 4HCRL 2Z3FA 4XE0A 3LX9A 3H56A 3X3FL 1T6VN 3ULVD 1BVKA 2PPAA 3AQYA 2NDGA 4HOXA 1BD2E 4G7YL 3V6BR 3MN8A 2R56H 1ND0B 1UB6A 4L5FL 4KXCA 5T5NG 1TPXC 1WFJA 3SE3C 3I6SA 4FL4C 1GW6A 3OGCB 3E7JA 4YHNB 2FIKA 4H40A 4W4NA 2COQA 4XP1L 3SDCA 2JELL 1XMEB 1UM5L 2H3NB 4FMKA 3LPWA 3AABA 3NIDB 4KTDL 4PSPA 4M7JH 1MREH 1RIVH 4PJXE 3TCLA 1QBLL 3PWLB 4OVUA 2GPZA 1HDMB 2CMRH 4AXWB 3BE1H 2IGFL 2IIJA 4W9HC 1R5VB 3TO4A 4GIOA 2EDNA 1FVCA 8CGTA 3AXLA 3BIAX 4XR8C 4G5ZL 3QQ4B 4RH4A 3CZSA 4ZUTB 3QEQB 2ZUVA 2WB7A 1UWXK 2PYFB 3PPSA 1F8TL 4JRLA 3C8KB 4HFUL 3OAUH 1MIEL 3NABH 5D7JD 2WKLA 5TDOB 2YPKB 5DJDB 3GIZL 2HVJA 4F5CE 4JB9H 4Z3TA 5B38B 3EHBB 1BMGA 3WY4A 1S9WA 2C7UB 3ABGA 3HI5H 3J07A 1NCAL 3T3MB 5GS0C 4NP4L 4H26B 5D4JA 2Q20A 1E5YA 4MNQB 2VW4A 1ZSDB 1CFNB 2M26A 5I9QB 1TT6A 3OKEA 3O3AA 2PLTA 1HKLH 4MWFA 2IOOA 3L13A 4ZMTA 4HC1A 1BQHG 5DVOA 1OK8A 2LR4A 2HSIA 3G6AA 5J13C 2E7MA 5KEZA 4FD0A 4NC2B 3E8UL 3CFDB 4YSDA 4PJ9B 5D71L 3MRJB 4FYTA 4HG4K 1E30A 4GS7B 2XX0A 4WTXA 4I0PC 1E4JA 1BIIA 4AGLA 2WXHA 4OJYA 3HG2A 2ENJA 2QR0B 1BZ9A 3ULUC 3QEQD 1QMUA 2EABA 3JQOB 2R1WA 2IQ9L 1OTSC 1KJ2B 1SJVA 2WV3A 4FEMA 4M8UA 4O02L 1XF5B 1NFDF 1RP8A 2KI6A 1R6VA 1JK8B 3HCVB 4HUNB 4LL4A 4MCYA 2NOYA 3RA7L 3NCFB 5HTSA 3T6ZA 2DQHH 1BYPA 2YAEA 4ODUB 3OR6A 2Z91A 5K59F 3NEOA 3EGSA 3EHBD 1ADQH 1UM4H 2Z93A 2WXMA 3OC8A 2CKBH 2FX8H 1CD0A 2WYHA 1YY9D 5BO1H 3FTGB 1MAMH 5EZJA 2B5IB 3GSUA 4LCCA 3STLB 3B6SB 3NIFF 1F3JA 1P4BH 3D06A 3QHZL 4J4PA 5DFVD 5EZIH 4MNQD 2CG9X 5INCA 2DLEA 4ATTA 4HX1A 4MMYA 1BLNB 1I3GL 3NACL 3QJZA 3RY4A 4OW6A 1AZRA 3QARA 4OLYL 3TEUA 1JBJA 1N2RA 4QPEA 5H37A 4GAAA 4AX3A 3LN4B 4M3KB 4MDJB 2Y2TA 3X12B 5KUKA 2K7QA 2PWEA 4JPQA 4MB3A 4PJ9D 4IBTA 2Y25A 1NCCL 3HE7C 5L9DH 1RY7B 2YUWA 3O11A 3BDBA 5JW5A 1ZY9A 4OM1L 4YQXH 2BW5A 4PD4K 5E5MA 4NQSA 5F7EH 4EVNB 2X6CA 1BWMA 1NKOA 2H0PA 4N24A 1FGVL 3A23A 3EOYG 5AW2B 3G5ZB 4A37A 4F27A 5D9SB 1LXMA 4IM8A 4QRFA 3V6ZB 1MQ8A 2WKOA 4FQJH 2F7RA 4LCYB 4NKDB 2A3TA 3ZRSA 5GGVL 5AW7B 1NMCB 5GS2H 5KYWB 5C08E 1HQRB 5C0EA 1U8QA 2JQAA 1LDSA 3FQUA 4CADA 1IE5A 2WQVA 4L37B 5DJ6A 4IDLA 1NC4A 1KCRH 2UX6A 5DURB 4KY1H 5H35B 4PQXA 4M62L 1KBGH 2WXKA 4X5WB 1FZJA 3AM8C 6PCYA 5F7DB 2OK0L 2GHZA 5F93C 4KVNH 3QIUA 2EDJA 4HS6A 4L9DA 3MJ6A 3S36L 2VSCA 3UTTA 4NO0B 1DQJA 3U9PH 3W3BA 1QHOA 1YNKL 3AQZA 4NUGL 4D9QD 5JMRA 5F3HB 1ASOA 1QWUA 3CIQA 4WUUB 4N0YL 4NOBA 4OZGB 3RU8L 4LHJB 5I6KA 3KDMB 1DQDH 1I8AA 2WY3B 4N87A 4Q8BA 3KYMB 1CI3M 1RZJH 3W82A 1OARL 3GSXB 3BEVA 3CZUB 4HUKB 4JZJA 6FABL 2V0AA 5IGXL 3ZHFA 4JPVH 3GRBA 4MXQC 2E4FA 2CHNA 1JPEA 4JO2H 1XD0A 2H4EA 5DJXA 1G5GA 4WWNA 2F74A 3KDPB 3EH3B 3NRFA 1UOVA 4PJCF 5FDWB 3A22A 4TULH 3GLZA 2R1YA 2WIMA 4NZRL 4ELMF 5FO8B 5CLXA 1IBFA 1TZAA 3DPBA 5E8EB 5DURD 1HC1A 2YBRA 1PW3A 2B0SL 2BS71 2F5BH 1A3ZA 3VXQB 2V9TA 1UCBH 1BJMA 4PLOB 2E7LC 4ZFZB 2L7UA 4ZS7L 4ONFH 4XNAA 2P24A 4NO0D 3TN0A 4DVRL 4YXHL 3OZ9L 5FA3B 2ZG2A 3ZL1A 2YXVA 1T5KA 2K70A 3QJVB 4N6RA 4NJAH 4WUUD 5BMFH 1RJZA 2H1PH 2LVEA 4XOCA 1F1DA 2B39A 1TJXA 2EDXA 2YKLL 4ZTPH 1FFPA 3TV3H 3E9TA 2EUVA 1ZS2A 4CGTA 3BGFC 3CSFA 2UY6B 1TZHA 4CAGA 4F7MA 2ZWZA 3BWSA 1BW8A 5KVGH 3PL6B 4DKFL 2YPLE 2WSDA 2R9HD 2O5YL 2CCVA 1WD9A 1NGZA 3VI3B 4ZO6A 3C8DA 4WV1B 2UZXA 5JHLH 2I07B 1WCBA 3HG4A 3JYBA 4CL7A 3SQOL 3HZVB 3HZMA 3RWFA 5DF0A 3QUMH 4WWKA 5ITBH 1YVLA 5ITFA 1T1XB 1QFUH 3DUSA 3O4LB 3TWCL 4PAZA 1LEKB 4OV5B 2YUZA 1HEHC 5ALCL 2IQAB 3Q6FA 2F9BT 2H32A 1NCWH 2N7BA 4Q4EA 3HMXA 4OZHF 4OZFB 5GJSH 3DSFH 3HC4H 4MAUH 3VI4B 5F9WC 1I7RB 1D9KB 3ZN6A 4OKVA 2W9LA 2PXYA 2PCFB 1AH1A 3ULUE 5DLLA 1ZIBA 4LVOC 2OL3A 4X9YA 2CDGB 4FLQA 2JV6A 2X9ZA 4ADGA 1I31A 5FCUH 1RK0A 3HVNA 5I1KL 1I9RH 4TSCH 1BMZA 5AVUB 3DETD 4NQCA 5I1IH 1AO7A 2HKAA 3PL6D 2ZOWA 5HHXL 1C8PA 3ZMRA 1DQQA 5DEGA 1M2OA 1MCPL 4JG0L 5K1NA 4OB5H 2ZUTA 1G7MB 3Q7JA 3QP3A 2AJXL 3WV0A 4XP9H 2DDQL 3CC5A 4PGBA 3SE4C 4ODWA 4U6XB 1NGWB 4JQIH 4UCFA 1SDYA 5DZ9A 1KT2A 1CE1L 4LESA 1OZUA 4JM2C 5C9JA 5I1EL 3O4LD 2K9FB 2O6CA 4DT2A 2YMXH 3V0EA 3ZTNH 2HJLA 1HOCA 5JYMA 2YAPA 1QVOA 1RKRA 1GGIH 2G2RB 4GUCA 2WO3B 1LWJA 4NNYA 4NX0A 1D9KD 1B9ZA 4PG2A 3UZQB 1D3CA 3GS4A 4NXSA 3Q06A 1R0AH 2YQ2A 2Z31C 2OA9A 4RFOL 3TT1H 2Q86A 2VR5A 3GTVA 4GXFA 4N9GB 4A7GF 1X5ZA 5DJYA 3KHQA 4GMSL 3OHXB 2VDKB 4JY6A 2HFGH 1S5HA 3GBNL 3TBTB 1B4JH 1TVHB 5E70A 4AT6B 3WTYA 4PYGA 1IAOA 4CVZB 3OTTA 3MO1A 5I0WA 3EGXA 4O2CA 3RVVC 5DD5L 3SKUD 1PG7H 3ES6A 2KHAA 2RTTA 3E2HB 3EJJX 4RMUA 3X11B 2Q8AH 3UPAA 4EI5C 3MREB 4XHQA 4NOFA 4OFPA 1AZZC 4OAWB 4BUHA 4JPWL 4KKQA 5FYJL 1SN2A 2EIBA 4JKNA 4Z7WE 2XQBL 4K8RL 3OB0H 4GEIA 3TYGH 1KG0B 4JFEB 5K9KB 5EU3A 1H3WM 5GSVA 1MPAH 5SWQB 1CJYA 2D7PA 3K6FA 2R2BB 2NSXA 1AY1H 4JLRA 2FBJL 4C4KO 4AEIL 2DQJL 3PWPB 5DUPL 2AXGA 4UMSA 2AJVL 3LEVH 3OF6A 3STZA 3BUTA 2VSKB 1AGBB 5F3BA 5ID1B 3H0TB 3OVUB 2DLIA 1T2QH 1EO7A 1NANI 3LKSA 2W60B 4YZFE 5BV7L 5IQ7H 2A99A 2C3GA 4P9ML 2AJSH 3LQMA 1YJDL 2ZF8A 3OX8A 3WCYA 4YBLB 2R39A 1ZMYA 3WFDH 1U95A 5JPNB 2F6AA 3S96A 2L7JA 5AW1B 3NSXA 3HUJB 4RNRA 1OTTC 4JRWA 1MXDA 2Q9OA 1PSKL 1JGIA 1G7PA 3GM8A 5LGHH 4TVPE 1MHHB 3HKZA 3U79A 1XH3A 4S0HA 3PE9A 1NCBL 2D2OA 2G0KA 4JFED 1IB5A 1XSOA 3RPIB 1I4FB 3B9AA 1S7QA 1RULL 4I5BA 4MGXA 5JIDA 1YRKA 1FYTB 3II1A 2FBRA 3IMUA 4QRPE 1PFCA 3ME0A 1AZNA 3MLTB 2QZQA 1XF1A 4AJVA 1A7QL 4WUKH 4AUUA 1FJ1B 1N0XH 4K55A 3EG9B 4P46A 4XN7A 4ZNCD 4XPTL 3KLQA 1JZ7A 4KDTC 3VQMA 1SOKA 4KNTA 5DSCA 1KFAL 1QR4A 1U0QA 4JMNA 4XRCA 4GY4A 1QBAA 5BS0A 5D70L 2AQRA 4F2MA 1FG2A 2XN9B 2X3CA 5CJ8A 2FB4H 1W72A 3B8SA 3FQNA 3FO9A 1MDAA 4J3TA 1YQVL 2FDBP 2IWFA 1U3YA 4DPRA 4MZ3A 2XWDA 4MTMA 4PJBE 2ATAA 2X70A 3ZKSD 3PDDA 3WNJA 4WNJA 3TBVB 3CFTA 1CL7I 1MCOH 1IJNA 1MW1A 2AJUH 4X4ME 4HT1H 3WY2A 1I3RA 2X4NA 4JFUA 4P2QA 4WFHE 1KTLA 4IJ3B 3O4OC 1LGVA 3Q1SL 4HGWA 4Q2ZA 4XAKD 5DJAB 4YO0A 3QBTB 1T7YA 3ZX1A 4XBPA 3DVNB 5F1IA 4LCIL 2QQNH 1V7NH 1D5ZB 2NYKA 2AQNA 1FYTD 5DFWH 1W0VB 3LRGA 1F2XK 4DN3H 2PTVA 1DANU 3FQYA 4OCYL 1QA9B 3I6GB 4YHKH 4KGJA 2CDFA 2IANB 2UV3A 1G7QA 2YXWA 4HP5A 3WUWB 3Q0HA 1CLOH 3QG7H 4L23A 1AGEA 2BDNL 4HH9B 3B9KC 2XN9D 3I6LE 1TUPA 2A6JB 5HHVL 1HT6A 4HU2A 5EBGA 1CWVA 5D2NC 4F7PB 4Y8DC 1U8NA 2H9GB 1H6EA 5L0QC 1HHHA 1MRCH 1TTFA 4BWUA 4DAGH 3L4TA 3D0AA 3FUMA 3IT8D 5IHLB 2A6IA 1I1AC 3M1BA 1YMHB 1R47A 3MLSL 2C9VA 3GHEH 2XQYG 3CHPA 3IGLA 4PB9H 3OB0K 1OIOA 2MMXA 3SY0A 4HIPA 4PWKA 2UUDH 4RISL 5L88L 3NZ8B 1BM3L 1FHNA 2XG4A 1E9PB 4KJYB 4OLUH 3RVTC 1HAUA 4ZW3A 3RTQC 3N42F 4OLVH 3ALXA 3H2QA 3NCJH 4XPGL 5EO1A 4A04A 2O93L 3CFEB 2WLLA 2FUTA 4Z6AT 2HVKB 2XWRA 3GJEB 3WTUA 3BZEA 3Q48A 3DYMA 1YN6A 2XOTA 3KEDA 1SVBA 3LPFA 3VFNA 2J12B 2IAND 2H6OA 2ED8A 4YHYC 3BKMH 2VUYA 1XGQA 3MACL 3NZUA 1Y6KR 4H88L 5EU6A 4HUUB 4L3AA 5ABAA 5HYJE 1KCVH 1BZDA 3AS2A 1RQ5A 1G6RL 2H2PC 2J8UE 2H2SD 3IDGB 3L1OL 1NWOA 4N4YB 2C8NA 4XPFH 1KENL 4JDZA 1NGPH 4L3CA 4DTGL 1E3ZA 1AI1H 5C7XL 4HXBH 1PLGH 2ED7A 4RFNB 2CJTA 3UDWC 3Q2VA 5INDB 3MCKB 1T2JA 5DC0A 5DTFA 2HFEA 3IU4L 4G1EB 3QT2A 4DP7X 1LO4L 4LLDA 4PJHF 5CP3H 1RZJC 2ICES 2I5YH 3VFVB 1XCWA 1CI5A 4M1DH 5DD3H 1BXUA 1K4DB 1F4HA 3HA0A 1LE5A 4UZSA 4Y5YB 5GZOA 3TJPA 1K6QH 1C08B 5ENWB 3PXHA 3MUZ1 4HJJH 1TG8A 1J1XL 3BSZA 1L9RA 3JSSA 2BVQB 3C8HA 4Y9EA 2F5AL 4MZ2A 2VR8A 5DK2B 2LE9A 1OAJA 4F8TA 2CDEA 5I19H 3O41A 3JWOL 1E6OH 1QWHA 1ACCA 2ZUUA 1DYZA 3N1MC 3VNZA 3U2SB 5E08H 4AIOA 4PJAA 1IAIH 3AAZA 2DQCL 1XEDA 5CSBA 2KZKA 2VXQA 4MMZA 5B3JF 2JI2A 3HE6A 4HKBA 4KROB 4NBZB 4HKXA 1WWAX 1A02N 2EDMA 2HTLC 4R5TA 4JJHA 3T4AA 3V6FA 3VX1A 1UA6H 3TT3H 1NBZA 2R15A 4G6MH 4IEFB 4S1RL 3ZLQC 3UZEC 4GAJH 5A7BA 5T3XL 4MA1B 5C3TA 4FLSA 3D0LA 3G5YB 4NB7A 4XPHL 1A2YB 5FO9A 3VWKB 4TPRL 2YBGA 2QFPA 5IWLC 4AJYV 4IRZH 1JXJA 3TVMB 1OE2A 4U0RC 3LZFL 3E6FB 4PJIB 1EJ8A 3T08A 5HYIA 4DO6A 4GINA 4JG5A 1LE9A 3NCCB 1BFVL 1DE4A 3ZIMA 3RBSA 1LQBC 4NC1C 5EA0L 2ZSWA 3X1GA 4LRNH 2RHEA 3ALPA 1IEAB 2EUWA 2JKNA 3C2AH 1HVXA 2OTWA 1X5MA 1RJCA 2EH8L 3GMQB 4I77L 5CZKA 3BHBB 3RDTA 2WAHA