5EIQA

Human oscar ligand-binding domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
188
structure length
188
Chain Sequence
SYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for collagen recognition by the immune receptor OSCAR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Osteoclast-associated immunoglobulin-like receptor
total genus 33
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiqA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eiqA02
1C5CL 1FZMB 2VE6B 3LS5L 3OX8A 4YHZL 2FLRT 3LKSA 1QLFB 3P9LA 2ERJB 2BSRA 4ZQKA 4LSSH 2BVUA 2P8MA 2XTJC 3PP3H 3RL1B 1TQCB 3MRLA 1RIUH 1P7KA 4Y16B 4HGKC 1FHGA 5CJ8A 1S3KL 1CDUA 1PD6A 3CFEB 1YEGL 2VL5A 3KPRE 4ODVH 4N9GA 2UVEA 4IJ3B 1EFQA 1M71A 1JFQH 1IAOB 2FEDC 4EN3C 3MFFA 1NLDH 2VDML 4RRPA 4Y4KD 4JO1L 1TENA 4CJ0A 1OP3H 4TULH 4NO2A 4FZEL 1HDMB 2YC1B 4Q9QH 4U1KA 2G5BA 2EXYD 3PUCA 5BVJA 2RBLA 1P7QA 1JF1B 1ZSDA 2P8MB 1A3RH 4ZS7H 1B0RA 3P30H 5HVWA 1KNOB 2AKRA 2MKWA 2UYLB 5E70A 4OT1L 1JGEB 3VD9A 4NM4H 3F5WB 2H26A 2CLRB 3MCLL 3C6SB 4GAGH 1UWXK 4HFUH 5CWSA 1MHPL 4HIXH 4PJHA 3QNZA 3QNXA 4NKQB 4DEPC 2FNBA 1ZE3C 4F3FA 1T0PB 4Z7QE 3UTPE 4IOSD 2NY1D 2FJGB 4OBRA 4LVOB 3ZKXB 1T6WA 1GGTA 5DHVA 4P99A 3LKQB 4LOUD 3I6LE 2I25N 1FSKB 2ESVE 1ZVHA 3IDMB 2BDNH 3RTQB 3O6KL 5E08L 4P2QD 1I9RH 2EEBA 1JZ4A 4LU5L 4PG2C 5B21A 3D18B 3VI3F 1K5NA 2EZ0C 3QIBD 4L9LC 5K9OB 3QUZB 3VFPA 5JA8B 4LARH 3DVFA 2P42B 4W4OA 1RZKH 1A7RH 5IHZB 3G6DH 2WZPD 1I1FA 2BSTB 3TBWB 2YZ8A 1UC6A 1DANU 3OJDB 2B5IB 4F7MB 3LPWA 5JXED 4AT6A 4RMSA 3RTQD 1KIRB 1VENA 4CGTA 4CU7A 2P8LA 3T8XB 3H0TB 3R06B 4OLXL 3GSUB 3CCHA 3DROA 2I60L 4LDLB 5CEZH 3IDNA 3PNWA 1CF8L 1HQRB 3MJ9A 4XT1C 3WSQL 4NQED 4Y4HC 4KH2A 2DN7A 3U0PB 5I1LA 4MB3A 3F7VB 1CI5A 4NO0B 4JKPL 3SDYL 3FO9B 5IP4A 3UYPA 3QIWD 3MRPA 4K94C 3UTTE 3IDYC 4WIQA 4U49A 1CGSL 3CX2A 1NCAL 4JPWH 1HILB 1NQBA 3H9HA 3F65A 1U8KA 4LNRB 2JELH 3RUGA 3MLVH 3VH8B 4MCZB 2VN7A 3U82B 1MCEA 1DL7L 3WDJA 2XA3A 4OLXH 3RQ3A 1EXUB 2FCBA 4G9DA 2GJZB 4GXUM 1RUML 4NO3B 3NFSH 4J6RL 5HGHB 3ILPA 2AGJL 1U8MB 3MZTA 4R2GD 4UB0H 2D9CA 1H3UA 5B8CC 2WIIA 2WUBH 4QRRA 1HXYA 4LLVB 3V4UL 3S36L 2AEQH 4PJFE 4YC2C 4HKJB 1NMAH 2YSSA 1IC4L 1HOCB 4Y4FA 1SBSL 1T1XA 4ZXBD 5DGRA 1RURH 5I1DA 2BSED 4ODXA 4JQXC 2JB5H 4K7PH 3O3AA 4HT1H 1AR1D 5C3TA 1PKOA 1B90A 3QCVL 4JFFB 5FYJU 1XIWB 3VXSD 1NCBH 4GQPH 3P77B 4H8WH 4LIQE 1FVDB 4K9EL 1G7PA 1QACA 4GO6B 4KI5C 1JP5A 4QRRB 3IRPX 2VJXA 4JCLA 2B20A 3CX5J 1CCZA 3BIKB 3D18A 1TTGA 3WLWC 3BP7B 4ELKB 1OSPH 1KB5A 3QUZA 3NTCL 4M61A 2J6EH 4YXKH 4RQQB 1A1OB 1AKJD 4U1IB 2E6PA 5E8NB 3T0DA 1I9IL 3V0WL 5DD1H 5KBNC 1HNGA 2ZOKA 2CUMA 1WWWX 1MFCH 2W9EL 3U46A 3BEWA 3P77A 4ZAKC 2PXYA 2YA0A 1A6WL 4HWNA 5E6IC 2V2XB 5HJ3B 3VI4F 2DQUL 1JWSA 4MB4A 3HNTH 5KVDH 2APVA 2DF3A 2Z4QA 3MV8A 4J4PD 1BFOB 3IU4H 5C0FA 4P3DA 3Q5YA 5GRJL 1MFAH 4KTEH 5ID0B 5TE4L 1S7WB 3FO0H 2XQYK 1I7RB 4OGYH 3ZE2F 5JORB 3HZVA 1P4IH 1AGFA 2B1AL 4APQC 1MCPH 2ADGA 4RFOH 3JUZA 1GVIA 5E2VL 2HN7A 2VDLL 1HKFA 1WLHA 5I19L 4XCFL 5EUOE 2FJHB 2HMIC 3D2UD 3D25B 2BSSA 4ZPTA 3IXTA 3KHQA 5DC9B 3TN0C 2DLFH 5ICXA 3HNTL 3FB5B 3T3PE 1OF2A 2WWKO 2X1XR 3EO0B 2W59A 3QXUA 3AC0A 4X6CA 3AFLA 5TE4H 3QEQE 4OGYL 2CIKB 1U3JA 4MAYB 4U6HB 3FQXA 5E8EA 4QHUB 3VXRE 4F15C 1OM3L 1RIVL 1F6AB 3EYOB 4XNYH 1P9MA 3ULSB 4D0BA 2QLVB 4HUUA 3DTXA 1KXVC 4P2OC 1CD1A 5GS2H 4FQ1L 1KACB 1U8HA 3K8LA 4LCWD 5T5FL 4PJ5D 3BZ4A 4I0PD 1A21A 3I50H 3D25A 1ZGLB 4GFTB 4HIEA 1D5XA 2BY0A 2AXJA 4XNQB 3ET9F 1MLCB 2AJYL 1S7UB 3PL6A 4PRAA 3LRSB 3F6LA 2Z31D 1XCQA 4I0CC 3RZCA 1KT2A 3L3IB 3EO1B 4U05A 4CVXB 2XV6B 1XGTA 5JTWA 5D2LF 1RULL 5D7SL 1Y18B 1AC0A 1UCBL 4U6HA 1NGPL 4L4TA 1A7QL 2IJ0C 1KCRH 2OJEA 2R1WA 4AEFA 3VWKC 4PS4H 3JWOH 1S8DA 4HHAB 3Q3GB 1QKZL 1WCBA 4EUPA 3P0VL 4KTDL 4I0PB 4MX7B 3W5MA 4KY1L 3O3DB 1VDGA 4JFQB 3SE4C 3O81A 4Y1AA 3CXDH 4M7LL 3GRWH 2GCYA 4WCYH 5C0JB 2HVJB 4WHYH 5JO5A 4WI3A 3BFOA 1DQTA 4KJQD 3DI2B 3IFPA 1T2QH 3QEUA 5D1XB 5ADOH 5CP7A 1GGCH 2OYPA 3M07A 4PRHD 1N6UA 5LGJA 2NY7H 3WLBB 2H2SC 3TLRA 5JLZA 1EMTL 5CD5D 3FQNB 1PAMA 2OZ4H 3WKML 2VLJD 5EOTB 3CXDL 5IHUL 5BRZD 2F54A 4HWEH 4UV7L 2UZYB 3JTSA 4IEFB 4K71C 2N1KA 3ETBF 1FJ1B 5EORL 1P6AB 3EOYG 4I3GA 4RBPK 3QHZH 4OD1H 4DTGH 1JF6A 3QG6A 3FQTB 4PRDA 4BUGA 3KHOA 1PVHA 1GGCL 3IGAA 2ZCKH 2NNAB 3EZJB 3MRCA 3TO4B 3MOAH 3MPCA 4JDTL 4UU9B 3VXMA 5EO9B 2ENSA 3HG1B 4P3CL 4W68A 5IV2A 4MD4B 3MLTA 1MREH 3QZWG 4UT7L 5DJZB 1I85A 3QQ3A 3KYOA 2IALB 3U1SH 4J3SA 4OI8A 1TCRB 1YUHA 1ZHKB 3QHZL 3WUWG 1I8MA 3ZSSA 4OZGF 1I3GL 1OGTA 3RDTD 1R3JB 2PXYC 3STLA 3K80A 4I9WD 2C1OA 3ES6B 2GUOA 3BWAA 1F13A 3NIFE 4TN9A 3BN9D 3NFNA 3O2DA 4JZJC 1BP3B 2P5ED 5GZND 4BKLB 3ARFB 1R3KA 1O0VA 4FQ2H 1X5YA 4WFFD 5CZXC 4JANB 3BW9A 3D39E 3U1SL 4QWWC 2ESVB 5JOPE 2H32B 4ELME 4AZ8A 2JIXA 5KVEH 2ATPA 4TQEH 1FFQA 3OR6B 4OGAC 3NIGF 2GJ6D 1ED3A 4DGIH 4ETYA 3G04B 3MRQB 1HKLH 1FNEB 4PG2A 1S5IL 5KSBA 5DRXB 4ZXBB 2A9MH 3QUKA 4YFDB 1J8HB 4I1NB 3O6FB 1JGVL 4LPXA 2W0PA 1LD9B 3QDHA 4U1NA 4WJ5A 1QFWH 5C0EA 3FT3B 4Y5XC 4JJ5A 3MJ8B 4EI5C 3GHBL 4X6EA 1T20A 2FATH 4TTGA 4OV5A 4OFIA 3G5VB 1AQDA 4ZOAA 4BZ1H 5IT2L 3EYVB 1RZGA 4P4KA 5CEYA 3SDAA 3FFDA 2Q7YB 3RU8L 3A6BL 4NC2B 3SOBL 1DQDH 3UZVB 3KS0J 4KKCD 3W9EB 5I16A 3TH2T 3FT4A 4XP4H 1E28B 2ED8A 2CLRA 3B2VL 2DMKA 2I5YL 3INUL 3GHEH 4BK4A 2ARJQ 4ODUA 2WINB 3K1KC 4XCCH 2P48B 5I8EA 4HIXL 3QPQD 1A6AB 2LTQC 4X6FA 1G7MA 2DQHL 3C6LC 2NY4D 5D2NE 2IAMB 2ZOLA 2P1YA 3QSKB 5E8PB 3BPCB 1G7QB 1EVTC 1K4DA 4ZUVA 2IANB 4M5ZL 4ZQKB 2XG5A 4H0HB 3FN0H 3RGHA 2OXGA 1I8IA 2APXA 5IB2B 1MCRA 1UM4H 3QDAA 4ODVL 4PJEE 5CP3H 1YEDB 3B9KA 4X8JA 1YQVL 4NWTH 5I74B 5E4EB 5BOPA 1KEMH 1GXEA 5KVFL 4FQXC 2Z93B 2VQUA 3HMXH 3MRRB 2DQDL 2V7NA 4X6FB 1FPTH 2GFBA 3C5ZB 2XKUA 1SQ2N 2L0DA 2Z8VC 1A3RL 2IAND 3VA6A 1T83C 3MV8E 1T80A 5H2BB 3VI3E 4RGMC 5C07E 3SHSA 3IETB 2XWBA 2BOCA 4NQSB 3IDGB 3F7VA 3GBNL 5IVZA 1WJ3A 1YQVH 2R23A 4WGVB 2JJTA 1AGDB 1CXHA 1JZ7A 1LK3H 5GZOC 2AV7A 1YEJH 2GTWA 2R9HC 3VFMB 1K85A 5C0BD 4M93B 4XB7A 4MJID 4KDVA 4PJIE 1LO5A 2EKJA 4PRPA 1KYOK 4U1HB 3L5IA 5D1QD 4XBGA 1RZ8A 2DL9A 4PJGE 3V6ZA 2JELL 4HUMB 2DI9A 1DQJA 2NY3C 4WFHE 5HYSB 5KSBF 4KKLD 3FMGL 1XH3A 4NUJB 3RA7L 2AGJH 4LCUB 3RL1A 3DRTB 3ZT5A 4E9LA 1PW3A 4AIZA 3FL7A 1CTOA 5CJQH 5K9OA 1I7UA 2Q3ZA 1RZKL 2YD6A 2VL5B 3NZ8B 5MEND 3BP5B 1ZLVK 2X9WA 2OR9H 4IRSB 1EDQA 3WFZA 1DQQB 25C8L 3ZTNH 4X5LA 3TPUA 4BSVB 5I1DB 4D0DB 5HSFA 2IAMA 2UWEF 1DANT 4WNQB 3D0VB 1G7LA 1ZA6A 1QEWA 3EFFB 3OV6A 5CEZL 2PW2B 5M95B 3WL9A 3SDDB 5IB3A 5FFLA 4OF5A 5J1TC 4N90D 3MODH 2DD8L 3BPLB 2W65A 4P5MB 3SDYH 5D8JL 4K7PX 1V3LA 4UILH 1NMCC 1CD8A 3RJDA 3DECA 4EDXA 5BOZG 3THMH 2YD5A 2X2YA 2NZ9C 4UIMB 3L3HB 4Z7VE 3RGVC 3DX8B 3MV7A 1NCWH 3E0GA 5EULV 4U6TA 4NJ9H 5F9OL 3ARZA 3MJ9L 3U79A 3N85H 5MI0B 2XXCB 4AMKL 1YY8A 4P2OD 5TDPB 1I3RB 5DSCB 4JFDA 4HPYL 1EHLH 3S36H 3RVWC 5F1IB 2A6DA 2OTUB 1S78D 5DI8A 5F8RC 1HHIA 1IC4H 5D7KD 1AHWC 3VGDA 3ARXA 3CD4A 2VZTA 4ZYKA 1FN4A 4EZMA 4DGYL 3TWCH 1BD2D 3DIFB 4NRZB 1AHWA 2JB5L 1I7RA 2QQLL 1T22B 4NZRH 1YDPA 1NJ9B 1Q38A 2GT9A 1EIBA 5HYIA 1MCLA 3HE7A 4KRPB 1GGBL 3FOMB 4R7DB 3O9WD 3JSSA 3FZUD 4RFOL 1H9VA 1JNHA 4YIQA 3UBXG 4JZNB 2FJFA 5C09A 3RRQA 1F90H 4DUXA 1GGIL 2X41A 2P5EB 4AG4H 1FL6A 5KSAC 5GIRA 3W9DB 1EO5A 4Z7VF 4ZO8A 1MQ8A 1I8KA 2JKXA 3H6JA 4UIKL 2H2PD 1AXSA 3CVHA 2X89A 4JPVL 2R2BA 4G8IA 1CFVH 1N6QL 4DKFL 4LSRL 3HI6H 2HFFB 5DTFA 3QB7C 1GOHA 3HTLX 4LHUA 1NAKH 2VDOH 2W91A 4S1SL 1FZJA 4BJLA 5JOFB 3HE7B 4XNYL 4PGBA 3L9RB 4NHUA 3QXTA 1IEAA 1KV3A 1A6WH 3GSRB 4GS7C 3N1GC 1PG7H 3ZKND 1U3HD 4JZNA 2W0LA 1B0GB 4PRHA 5I0ZA 2R4SL 2O5ZH 2KBGA 3IU4L 2VWEC 3MREA 4G7YH 1S3KH 4AIOA 4J3TA 3RVXD 4HWBH 4DUVA 4JREB 3HC3L 1JF5A 3SDXB 3HZKB 5F7UA 3KWWA 1DN2A 5J11B 4HQQH 1I9JH 1Q9OA 1KUMA 5D5MA 1NCUA 2EE3A 1IQWL 1U8NB 3AMKA 3ZE1F 4NM8L 4ZTOH 4YHPA 1E4XH 2XACC 4FMKA 4Q9QL 4FG6D 2NMSA 1ULVA 5TDPA 3NCBB 3UEZA 2XN9A 4CW1B 1WBYB 3QRGH 3SDXE 3NCYP 5JOPD 3GUTB 1BVLB 1QA9B 4OT1H 3EO0A 4EDWL 3VG0L 2OJZH 1CLCA 4HWBL 4GKZA 5LCVH 3MCLH 3GRWL 4N1HB 3U4EB 3KLHD 4P57A 3IRZA 4X4YA 5IFHH 1I4FB 3LS4H 4L8BA 4ODTL 4Q6IC 1TZHA 4QXTB 4X9HA 1T2QL 2VABB 4PLNC 43C9A 2EIEA 3CFCH 2BY1A 2WBJC 4PRNB 4Y4HA 1W0VB 5DRZB 4Z78A 4QRPD 5DK0B 4AJ0A 4OZFA 5FF6A 1KB9J 5F6IB 3CC5B 4JEGB 2BDNL 5A16A 2H2PC 5IR1A 3F12A 4CW1A 3B9KC 2ZCHH 1ETZB 2AK4E 3VGEA 1VKXB 1NEZA 3S5LB 4YHKH 1QA9A 4LDOB 5IFAL 5EU4A 2FB4H 3S35H 1XMWA 3B9AA 2R2CA 3WDHA 3E1F1 3PV6A 1KT2B 4I9WE 5EU6E 2Q1EA 3MROA 4LARL 2HJKB 1KPVA 5HGBA 5K59E 2P5EE 1I4FA 2AK1L 3MBXH 4HAFA 3O45B 3QFDB 4ODSH 4UOW0 3VXQB 1LO2L 1FORL 2HN7B 2PCPB 3NA4A 4RGNC 4I18A 4F9PC 5JIIA 4KY1H 4L4VA 1R0AL 2CUHA 2DWEB 1X4YA 4UT7H 3UYOD 5IFAH 4P2YA 1RJYB 2AQ2A 4QO1A 4YXHL 2UWEB 1N26A 2XKSA 5IW6A 4D9LL 4E41D 4XP5L 3H9ZA 3P4MB 4A6YL 4OIIH 3A67H 2C3HA 3X12B 3MLVL 4MA7H 5EZLB 1I1AD 2NY7L 4I3SH 4MQ7A 1AC6A 3OWEA 3WLWD 5DJDB 3HB3D 1MCHA 1GIGL 3WKMH 3AY4C 1FFPB 1RIHH 1FZKB 2MSPA 1OT2A 5IBLC 5DEGB 4CN4A 5F3BB 4F37F 5CILL 4NQVB 4L8SB 4U1MB 1Z0NA 2E9JA 2ITCB 4MDIB 5TE7L 1CGYA 3O8XA 5FOJA 3UTTA 4W6XB 4DTGL 1IFHL 1YN6A 1GH7A 1WZKA 4IOFD 4JO3L 3JWNC 5GGUB 3FQTA 1NMAL 3DYMA 3LKPA 5D1QA 5GISL 5IB5B 3A67L 2EDBA 4PJHE 3T0XA 3V6OA 5KSBB 4DW2H 3MOAL 3CMOH 3O6FA 3U7AA 1XR9A 1FLTX 3GMOA 4JHWH 1UJ3B 4ZDHA 4XVJH 5FA4B 4KDTC 1OP9A 2OTPA 4HT1L 4ZO7A 1J0IA 4OB5H 3I3EA 4JDZA 2VZVA 2AXHA 4XRCA 4ELMF 1J05B 4YHNB 5GRWA 4H8WL 3GMLB 3ESUF 2G60L 4WFHD 3O11B 3HI5L 1U36A 1V8HA 4EKXA 1YPZE 3Q6GL 2ID5A 4RWHA 2G75A 1DTUA 5EU6D 4DW2L 3MNVA 1DQDL 3STLB 3GMQA 3BWAB 1HH9B 2VZ1A 4ZUTB 3TIDB 1EFXA 2VC2L 3V5KA 5I9QC 1A7OH 4QRRD 4N5EC 4PJ7F 1JFQL 1UM5L 3LV3A 3T09A 4G8EA 1MQKL 3CH1A 5KSVA 3G6JB 4P9HL 1KELL 3O3UN 1RJZB 1C5BL 3K46A 5C09E 5IHBA 2EYTB 3IAQA 4GQ9L 3WE6A 4DZ8B 3LZFL 4M48L 4NBZB 1CBVH 4DAGL 1JL8A 5DJAA 4OQTA 3QXWA 2E7BA 2CIIB 4TPRH 5IMOB 1OP5K 2FHFA 4LPYA 1C08B 5GRJH 3U9UA 2KL6A 5EZLA 4OAWA 1PSKH 1ND0A 4HFUL 3H7LA 1JRHH 1UH2A 2DI7A 2FATL 4WENB 3HMWL 3TVMC 5LJYH 2VN4A 3RZCC 4XXDA 2A9NH 4J8RB 3QUMA 2SEBA 3A6BH 5BVPH 4BQBA 3LN5B 2CK2A 4MD0A 1HI6A 5FYLH 4EI6B 4KHXL 1IGCH 3E6FA 1N3NB 4PJEB 1XGRA 5E99H 5D70L 3GHEL 4Y5YB 3BP6A 1ROWA 2NXYB 3MJ7A 3DO7A 3SQOL 5BJTA 5C0BB 2HKFL 3M17B 5DLMH 3V7MA 3FFCD 4NKMB 4D0CA 2V9TA 2XQBL 3FFCB 4L3EE 3TT1L 3P3YA 2JE8A 3SKNA 4PTUA 1FCCA 3WFDL 3GJEB 1HHHA 1Q9LB 3WFHB 3EFDL 2DLHA 1KIRA 4RWYH 5EIIA 7FABH 3ARGB 4PGZA 4JFOB 3BRGC 5K9QG 5CIPH 3CDGB 3QDMA 3CXHJ 4B7IA 5FGBC 4XGZB 5JR1H 2EDFA 3RWCB 2Y7QB 5I76B 4PJ8C 3O3BA 5JW4N 1UM4L 1F2QA 3L3DB 4YHMH 3ZDYE 4X99A 3QUMH 5F72S 4ISVA 1MIEL 3T0EB 3OKDA 4QXWA 1VB9A 3QIBB 4EI5D 5DJ2A 3RWGB 1TMCB 2D7MA 1KCRL 4CU6A 1KLGA 4KGLA 2EE6A 4G43A 1WFNA 2ADIB 4R8WH 2IG2H 3FHQA 4IDJL 5TQ0H 5JUEH 4G8FB 4TSCL 1WF5A 3QDMD 4JQXA 1D5BB 3KPSB 4KKCC 5JIPA 5DFVC 1RZJL 2V6HA 4PB9L 4LK4A 4YDLC 5FYKH 1UXWB 1FL3A 4QXUL 4AL8L 2GQHA 3X11A 1WITA 4WCYL 4JLRB 4NC1C 4PD4J 4ZUWA 4APQD 3MA9L 1XGYL 2MWCA 5CIPA 5EO0A 5HHNA 4N0UB 1BOGA 1ZVSA 2EIZB 5KANG 4KZDH 1C7TA 4WDIA 5K33A 4PJCE 1SBSH 1E0OB 2NY2B 3VXSE 4XCNB 4ETQA 1EH9A 4F7CB 1HIML 1DBMH 2DM7A 2K7QA 2ZG1A 5GJSH 1ZHNB 1MJJA 4KU1A 3ZDYF 3BUTA 1RZJH 3FN9A 4PP2B 4JFYB 1A1MB 3SJVA 1BBJB 2EKSB 4FQIH 2QSTA 4NKOB 3DARA 4P0DA 5HYEA 2EDDA 1F5WA 1A5FH 4HWEL 1NCBL 4P5TD 5E9DE 3E6FB 2WIMA 3MA9H 3C2AL 4UT6L 2GAZA 4C57C 4ZUWB 4IBLT 2A6DB 5DI8B 4L1DA 1VADB 5D7IE 1WZ1H 2IADA 4LSPH 3DO7B 3KJ4B 4OLYH 12E8H 1VFAB 2OR9L 1ONQA 4YUEH 5KW9H 3CK0H 5T5NF 1MY7A 1HIMH 2EH7H 3GSWA 3BPOB 3CZJA 1QFWI 4K8RH 1UENA 5C0DA 3WXWL 4JY4B 3VXTB 3O6MH 1G6RL 4JFOA 5DUMH 1JHLH 2NYYC 3QUXB 5K9KB 4XHQA 1S7RB 3T1WA 5D9SB 2VDNL 4LFHD 5L9DH 5ADPL 3BWUC 4YHOL 5I74C 4G5ZL 3BGMB 4OLYL 2AXFB 1LQSR 1F90L 1J11A 3EYQC 2VOTA 4NQDA 4BSWA 4U31A 4EUPG 3V7AG 4NOBA 3MLZL 3QXVA 4JG0L 4S1DD 6FABH 4GG6E 3WXWH 3VRLF 4JM2A 1OTTC 3MJ9H 2XZAH 4PIRF 4FQ2L 2CLVB 2YD3A 1JUFB 1CFTB 2XPGA 2R2EB 2HYMA 1P4IL 1RZIA 5A2KH 3Q0HA 1IEAB 3DOSA 4N1CA 2D7TL 4PTTA 5DSCA 4R4FH 2FO4B 4DGIL 3EJZC 2YN3A 1MEXL 1QR4A 4P9HC 1QBLH 3DSFH 1T1ZA 3ZHLA 4G80A 3S36X 1WK0A 4G42A 5DUPL 3HAEG 2HG5A 4PJBE 1KYOJ 3IS1X 1WBZA 3VD5A 4HLJA 1YJDH 2V5SA 4JFEA 4U0RC 5C08E 1J1OL 1QFWL 1BVKB 3OAYH 2AEPH 4X5XA 5E00A 3BKJH 3D5OF 4GSDH 1YZZA 1I9JL 4IOIA 4HUVA 2CUIA 3KYMB 1S7SB 2C4FU 1X5JA 3HKFA 5IROA 5IESL 4KKNA 1JGLL 4JM4L 4Y89A 3RUGE 1UEYA 1FL6B 4DQOL 4LMQI 1QBLL 4MD5B 3QCUL 1UM6H 3RIAK 5FO9B 4GRLA 2BVOB 4FA8A 3OB0H 2X7LA 3HI6L 1WAAF 3ROLA 4JM2F 5AAWA 1Q72L 4GAYB 5C70A 4YJZL 1J1OH 5DURB 1NAKL 1DN0A 1UB5A 3NFPA 2CDGA 3V4PH 5I8OL 1R3IH 1U8JA 3LS4L 1B3JA 1HH6A 3PDGA 2AK4A 3U0WH 3QDJD 2DLEA 4TULL 3ZT7A 1EEZA 2NCMA 2ZPKL 4M1CC 4ZTPL 3EYFB 2O5ZL 1LDPL 3FN0L 3NPZB 3DROB 1DVFA 1HHIB 1CK0H 1VGKB 2VWEE 1BZ7B 2DOCA 5A1AA 1Z9LA 1EAPB 3LSOA 4V1DD 1TTFA 3VDCA 3ARBC 1OAUH 3BKYL 4U0QB 5EUOB 1V3KA 4N0YH 1KJ2B 3WNOA 4NJAL 2MPAL 1EJOH 4MCZA 5ESQB 4DUWA 4LSQH 3BN9C 4PGCA 4MA1B 5GRVL 3UTOA 5JLZB 1MRFL 1ITCA 1SYVA 2HT4D 1IM9A 4PJ5B 4R0LC 2OJZL 4ZS6D 1SEBA 3MBEC 3SCMD 3PL6C 1J10A 4UMGA 1R5IB 1P1ZB 3DXAA 5F9JB 2NLJA 3HFML 4OZFG 5EORH 4ODHL 5C0FB 3RWDB 3GFUA 5DURD 1UKQA 4JN2B 2JB6B 4PV9A 5FB8B 3PV7A 3RVUD 4ONOA 1CE6B 3G5ZA 1DEEB 4Z8FL 4YNYA 3KR3L 2W0FB 4LSQL 1J0KA 5AG8A 3FQWB 2X4SB 1NH6A 3GZKA 3SQBA 3D69A 5I73B 4W70A 5AUMB 1TVHA 2ZCHL 1F2XK 3I02A 1FG2B 3MLSL 1MREL 4I77L 5DVMA 3PE9A 1ZLWH 3MXVL 3WHE1 1DBKL 1G7PB 3VFGH 4XMKH 4ODHH 2Z91A 4Y88A 2B8OT 5A2IH 3SDXA 4F7EB 4RQQA 4NC0B 1L7TL 2R39A 3ILQD 2F54D 4YDKL 3MRJA 5C0GB 5JIKA 1F4WL 2X4UB 5GGTA 4DN4H 1DL7H 1QSFE 4RA3A 1QRNB 4HBQA 3MRIB 3D69B 4NRYB 2R2HA 2YA2A 4IMKC 2YK1L 2JJWA 3QIUB 4JPIA 1AD0B 1U95B 2F8OA 4BFBD 3OKNA 3VFGL 3P0GB 4I5BA 1NDGB 2D3VA 5I1KH 5F3HB 1JPGB 1OTTD 4F9LC 1ZVYA 3T2OA 5M7QA 3WV0A 3BO8B 3C9NA 4XP6L 5HTSA 2W60B 1T0MB 3QAZC 1FZOB 4IRJB 3EYQD 1MF2H 2WK2A 4PGEB 3UC0H 2O26U 4E41A 1PKQB 5F9OH 1BJMA 2CMRL 5HHMD 4RAVA 4X5WA 1MIMH 1N0XH 4XC1L 4EEEA 1RJZA 4GRWH 1U93A 3GI8L 4P46C 1XIWD 5DXWA 4DJMA 3C5JB 5GGSA 2B1HL 3I75B 5FKAB 1HN1A 1S9YB 3UTTB 4GQ9H 3F7YB 3VJ6B 5FYJE 3HR6A 3W0WB 5IOPB 2OQJB 5IW1B 3SOBH 4GXUN 1W72B 5HI5C 3TN0B 3E8UH 4UTAL 3EAKA 3D85B 4Z7UA 2A83A 4IRSD 3WFBL 3V0AC 3MRHB 5MENB 2HAZA 1D5MB 4MXVE 2AS5M 1N6VA 5FECB 2QADD 3LDBB 5E94A 2FRGP 1JTTA 2SEBB 4OUUA 3MRMA 3FOLB 1EHNA 1CGTA 3T1FA 1HSBB 3VFOA 2OQJA 1KF9B 1TCMA 3STZB 3FB8B 3I6KA 5GSVA 2AEWA 5D70H 4FP8H 3ILQC 5E0QA 1SVCP 4OLZH 3OXSA 2F54E 1AY1L 4ZAKB 2XRAH 5KVFH 4B53A 3LEVH 2VITA 4X7DC 4EXPX 4D9QE 5I19H 5B3JF 2RJMA 1A0QH 4NQDD 4C54A 4F9PA 4K7FB 4E41E 2B7DT 4N90E 3VGHA 4H5SA 5FKPB 5D2NA 5ESAB 2ICEB 4PRIE 1LP9E 2NPLX 3GGWA 1NFDF 1XF4A 1TZIB 3KPOB 3MLYL 1AY1H 4X4MA 5E6ZA 4QHNB 4Y2OA 3T0ED 4GG6A 3EDEA 4YDJB 2X4TB 1CXLA 4QY8B 1R3KB 3CDYA 3OJDA 3AMLA 1RSFA 4PP1C 4NM8H 2BNRD 4FQ1H 4NQEA 4BELD 1D9KB 2A9NL 2WBJB 4PRBB 4BFIB 4NQCB 3RGVB 3TJEL 5FDYA 5H35A 2YWZA 2E5EA 3FQUB 4UAOC 3B4NA 1WV7T 5DJ6A 4AIZB 1A14L 5FOBA 3B3IB 3D3VE 4FQHA 5DLML 3LRHA 1C1EH 1I7UB 5AYUH 1OGAA 1GCFA 2EDLA 4Z9KB 2NY6C 2BHUA 2FD6H 5HHNB 3GJFH 1FC2D 4NN7C 1R5VB 3OKLB 4ODTH 3RY6A 3CVHH 2RB8A 2ZG3A 3H9HB 3NCYS 4LLDA 3WD5L 4RWYL 3NCEB 7FABL 2Y1VA 2IPKA 4EVNB 1IE5A 1K8IA 3S6CA 5BW7A 1FZMA 3OX8B 1EEYB 2BRRH 1EHAA 3EFFA 2OL3B 4LDEB 2Q87A 4U0RB 1HINL 2ICWI 5HY9B 2F53E 5JW5B 2DQTH 1MHHA 2GSGA 4HKXB 4ZO9A 3WIIH 1UWEH 4NO2B 5E6ID 3N1PC 4XVUD 3IT8D 1P7QB 4XP9H 2RFXB 1GZQA 4UQ3B 5D6DA 5E2UL 1ACZA 1GJIA 2H45A 4G6ML 3L3JB 2KUTA 4PJ9D 1J8HD 4ODSL 4QRQB 2EDQA 2IQAA 5K9JH 4PJXA 1A8JH 1PFCA 4QOKA 4Y8AA 5GQBA 1OWWA 1EEYA 2IMMA 4AL8H 3FQRA 3O6ML 3N85L 3PDOB 4JY6A 1JGUL 4L4VE 1P4LB 4M6NL 2WWMD 4MNQB 5LGKA 5T33L 1BD2E 3BXNB 4Y4HD 1V7MH 1VACB 3U36B 1RZ7H 4HGWB 5CEZE 1MCJA 5EO0B 5GRZA 2NXZD 5HD8C 4ORGA 4XAWH 4MNHA 2X9XA 4A6YH 4NUGH 1UVQB 5DYOB 5FDWB 4JFPB 3UPRB 3L3JA 4JDTH 3RTQC 4DGYH 1N7ML 3BH9B 3BKCH 4MJ5A 6FABL 5CJXC 3C5ZA 1RUQL 3T0WA 5DHVB 1XCTB 5JNYA 2EE2A 3F7PC 4HXBL 1BF8A 3RGVA 4RMTA 4M7KH 4M6NH 5DC0A 4Q7DA 3QFJD 4FQXB 5TE7H 4Q0XL 4K3GA 4K3EL 1BGXH 3QDJA 9CGTA 2R8SL 4PJAF 4MAUL 5TDNA 3UPCA 5KANI 4L29A 1S7XB 3QIBA 3HPJB 5DTFB 3NPSB 3OKEA 1DUYA 3DURA 4ZNEA 3BKCL 1YQ2A 4BH7B 1P84J 4KC3B 3WNKA 4CMHC 2IPKB 4EVNA 5T1LB 3WEXB 4C4KT 4M7KL 5HPOA 3EKCA 4C58B 2DLIA 2V17L 5ADPH 1NFDB 5DJYB 3X14A 1L9MA 3HI5H 1KCKA 5LAXB 3DUUA 4PY7B 1H8SA 5ICXB 1NLBL 2DQGH 1NMCB 1DE4B 4JM4H 4KRMB 5GS2D 1I1AB 2R4SH 2AV1B 4ONFL 1BM3L 3OZ9H 3MV11 4QOKD 4Y16C 3MXWH 1RK1B 4Y19E 3I9GH 5HHOE 2XTJB 1YN7B 4Z7UE 2X09A 2EH8L 1UB5B 1WZMA 3HC3H 5I75B 4GLRH 1UM5H 1FFNB 1KTLB 3LEXA 4ONHB 4WW2A 1KTDB 1I7ZB 1KGCE 1CFTA 3UMTA 2GJZA 4TNVF 3LN4B 2YXMA 1A6UH 3PGCA 1MVFA 4FN0A 4JCMA 1IQWH 3WFCH 4LNVA 3T4YA 3ZSTA 4G6JH 4C56E 1E4XL 2DQGL 5TPWL 2EZ0D 3QIBC 1T83A 3VXRA 5JHDD 4YAQB 5CJOL 1CBVL 2ZPKH 4K23L 1I1AC 1UXSA 3S37L 1WAAE 3VH8G 2BMKB 2X6MA 3MXWL 1SEQL 5C8JB 1T1ZB 4TPRL 3B2VH 4FQQB 1D6VH 1X3DA 5EIQA 2GY5A 1AR2A 5MERB 3AM8A 4M6AA 2DL2A 2DKUA 4PRHE 3BKJL 3HS0A 3ZT6A 4FXGB 4JO1H 2LQRA 1Z6JT 2IH1B 2VXTH 4S1RH 5FGRA 3SDCB 1X5LA 2A74A 4V2CB 3MRBB 1MFBL 1T7XA 3QUYA 5I1EL 2HLAA 1W2KT 4FQXA 5HHME 4DQOH 1MPAL 5ISZB 1A3QA 3J7HA 4HWZB 4LEXH 1BJ8A 2YPKA 4JZJB 5IFJB 1QSZA 1BAFH 1UXSB 3P30L 4QT5A 4N68A 5E99L 4NM4L 2P45B 1H0DA 3IJHA 3SQOH 1F6FB 4WHDA 4ZNCD 4QHMA 4OZIB 1R3IL 1JJUA 3QQ9D 3EDKA 3QZWA 4HMDA 1YNTB 1KEML 1WFUA 2AW2A 1KIQA 2VXTL 4MAYD 3K3QA 3VG9B 5T1LA 1RZFH 1X9QA 3QXAB 4YHIB 3PWNB 5CZVL 2W1NA 5DR5H 3DSNA 1AO7B 1W0WA 4O58L 4RFEB 5F1NB 1ZS8A 4I18B 5D6DC 1HHJB 3SJVE 5DUBA 2ZUXA 3QDGE 1BAFL 1FG2A 2KQMA 5LAXA 1YNLL 5ETUA 3HR5A 4HWUA 3SDDA 2UWEA 3MRLB 4XCEB 1CG9B 3QUML 3K8KA 3GBNH 5D5MF 1YECL 1MCWM 5GS1A 5BO1H 4Z7QF 4Y19D 4K71B 4X98A 2VDPL 2DQIL 4NFCA 3UBXA 4XP5H 4Y2DC 1CDCA 3G6DL 4X6CE 1SJEB 1A1NA 4G8GB 1BVKA 2C4FT 1TXKA 1KG0B 3EDFA 1EJOL 4KMQA 2Z31A 2I9TA 1JZ8A 4RGOL 3VFNB 2VR5A 3ZKMC 1H5BC 3FMGH 5I9QB 4XTRD 5DEGA 2JCCE 5MP6H 3BOVA 1IZJA 4OF6A 5I6XC 3TA3A 1CF8H 1A6ZB 4Z77A 2YK1H 2XZZA 1MNUH 1WVZA 2VIRA 1EGJH 3AY4A 4JPKL 3KPMA 3IDIA 1BPVA 5D2LB 4I3RH 5HDBE 4X98B 1ZEAL 1WBXB 5CWSB 3GJFB 4PRID 4QRUB 5CMAB 5D93B 3CMOL 4P23A 3DO3A 4PPTA 3KYNA 1AKJB 2GJ6A 5GJSL 3WN5A 5KS9A 5IB1B 2EIBA 1IBGH 5D5ME 4IRJC 5I2IB 5MP6L 3BQUA 4Z5RB 5EH1A 1DBKH 3VMOA 2Z8RA 4PYHA 3FOMA 1MIML 1N0XL 1A5FL 1FNHA 1X5KA 3O9WB 5AZEH 1S7QB 2V5YA 3U2SB 4BM7A 2WUBL 2X10A 3BGAA 4DFHA 1WCBB 2CKBB 1QSEE 2DM3A 4R90L 4TTDC 4JKLA 3BT2H 3VMPA 3O41A 1NDMB 3S88H 3CLEL 1KIUA 1F4WH 1SJHB 2DMBA 1RURL 3PIQA 4GW5A 1LO0L 4HHAA 5JA9A 3MUGB 4K7PL 3WYRA 5E5RB 4JJ5B 1NGQH 2VNCA 1UZ6F 2NY1C 3NVQA 3C2SA 4P2OB 3AREC 4PGBB 3QFJB 3N0PB 4N8PA 5F9WB 2DBJA 2E9BA 4OFYA 3RKDD 3GSRA 4G5ZH 3MC0A 4DZ8A 1Z9OA 2BRQA 4ZFOA 1NGZA 3IFOA 1CG9A 2R69H 3ARRA 1KB5L 1R5IA 3DXAB 3FCTA 1HSBA 3HAEB 3CLEH 4E0RA 3W2DH 4WWKA 3CFEA 1I9IH 3TWCL 3RDTC 2CDFA 4KI5D 2ED9A 4FP8L 4IMKA 2QHLA 2CR6A 5MEQA 2CMRH 5I73C 2XZAL 4RGNB 3VRIB 1Q9OB 3TBVA 4XPGH 1LO4H 4JR9L 3GI8H 4MNQD 1TVHB 5CZXD 5DO2D 4APQB 5TFSL 2B1HH 2D7TH 3PWLA 3TESA 1LDSA 1Q9WB 1A0QL 1A2YA 4ODBD 4LSDA 1MEXH 5BVPL 4R4BA 2XFXB 1N3NA 4PJEA 3CU7A 4PJ9B 4YQXH 8FABA 1CFVL 2OXHA 4MB5A 4R0LB 3K4ZA 2GY7B 4KTEL 3TN0A 4AENA 2PYFA 4HUNB 3MLYH 3PWPE 2VLKE 2X4TA 2B1AH 3T4AA 4QF1B 1NKOA 2GKIA 1OPGH 3MRKA 2DM4A 1PG7L 3PWUA 4Q6IB 2NW3A 5IG7B 4TOYH 1TJGL 3DMMA 1MCBA 5AD0B 3ZMRA 1HNFA 2ICWB 3IXAB 4JFQA 4LCCB 5JR1L 3QHTC 5D1QB 1HYRC 3C5SB 4YDVB 4YHML 5BQ7A 3MOQA 3D1MC 1A6TA 2E6JA 4J23A 5F9WC 4EQ2A 5DJ0B 2XY2A 2O5YH 5F7DA 1R5WB 4PJXE 5DRXA 4ZXBA 5F89B 5A3IC 2ZP0T 1CDJA 1VFUA 4V1DA 3TF7C 1Q8MA 4OZGA 4R8WL 5F93C 5FUOH 5ALCH 4KKLC 3PHSA 3H0TA 3R06A 4LSUL 1JV5B 5JW4Q 2EEDA 1ZT4A 5INDB 4ZFOB 3VXUD 2D2OA 1HINH 3PQYB 4PB9H 4P2CG 4H0GA 2DQTL 5HYFA 2VXUH 4XVUC 3PQYE 3GSQA 1KCSL 2XICA 4HX1B 5HHOA 3QIUC 1XGYH 3BN3B 1KTKE 4AQ1B 5GSRA 4YBQC 1QR1B 4KVCH 4L9DA 4JGUA 3C8HA 3KPQB 3DV4B 5BV7L 1QKZH 3MCKA 4PJXB 3IFNH 3MX0A 5D93C 3T2NH 3U6RA 2P5WD 1HHKB 1BLNB 4C56A 1QLFA 3L95A 5IM7B 1UB6A 1F45A 8CGTA 2CH8A 4JREC 4MNQA 3QUYD 2FH6A 1JGUH 1I7TB 1K2DB 2E7LC 1QSEA 3C2AH 4UT6H 1A22B 5IVNA 1ZLUH 2IFGA 2EYRA 3DETC 5E5MA 3WJLC 5ADOL 4BZ2H 3WD5H 4TVPD 4GS7B 5ACLA 3U83A 3F5WA 4MCYA 1G7IA 4YEEA 5FUCE 5CINH 5I0DA 1BQLL 3DBXA 5C0DB 1BVZA 4NPYA 1TJIH 3MV9D 1XEDA 4Q9RL 4POUB 4QGTA 4IOFC 1L0QA 3ARDA 4PB0H 2PETA 1A64A 3MRGA 4YXHH 2KH2B 4XMKL 3HUJA 4Q0XH 3CFBB 4D9LH 5C0RL 1ZGLM 3EYUL 3WUWA 3QUZC 5KOVC 5E8OB 5SWQB 3ZYOA 1W72H 4PJ7B 3RX5A 4HIIB 3VRJB 4JKWA 4I48A 4QGYA 4MA1C 4NT6A 4HG4J 4G6AC 1BQLH 3CAFA 2BNQD 4DN4L 3VFPB 2GFBB 1LO3H 1Q1JH 1RIHL 1IRAY 4NQDE 3VMNA 4L8CA 1OQOA 4GBXA 1PBYA 3IDMA 3FQRB 4D2NA 3TBTA 3W11C 4WO4B 5SWZB 4XPAL 3QO0B 3MRGB 1J12A 4ENED 4DVRH 3VXUE 4K8RD 3KJ4C 1I3GH 3GSNB 2BSRB 4WW2C 3GSQB 1DQML 5IMKB 3QBTB 1SHMA 3VFMA 3VE0A 1YPZF 1BM3H 4GG8B 3FO2A 4X4XB 4P3DB 1N7MH 1CGVA 4JFPA 3UPRA 5LKNA 4W81A 15C8L 3LOWA 2Y6SC 4G8FA 6CGTA 1XCTA 5JNYB 5GGRA 4KHTL 3CUPB 4XC1H 2VH5H 2FH8A 1CXKA 4IRSC 1HQ4A 5HHXL 3FB7A 1FIEA 2AXGA 1N8ZB 5IESH 1QRND 3MYJA 1ITBB 2C3GA 3CJJA 1QSEB 4RMWA 3MREB 5KVMC 1BIIB 1TQCC 2NZ9D 1EZVY 4S11A 4LCWE 1D6VL 1YMHA 4GUPA 1VEOA 3FRPG 4OIAA 3WFBH 5JDSA 4KQ4H 4XVSL 2J8UB 1WC7A 3HPLA 2FWOA 1G9EA 1KELH 1XGUB 3QDGD 4FTVA 4PTUB 3MUZ1 2QHRL 2ICES 1UQSB 2Q86A 5TF1L 1N64H 4M93C 3CFJB 3OJMB 2ZSVA 5KS9F 1NLBH 4HWZA 1FAIH 3OG4B 3ZKMD 3NA9H 1NGWA 3A6OA 2A73A 1EX0A 5IFJA 3H9YA 1MFEL 4ONFH 4J1UB 2V2WA 1OGTB 1X4ZA 4RGMB 3WKNA 3CSYA 5D1XD 4S10A 1PSKL 2ZUUA 3BP4A 2BNQE 4UI2A 1L4IA 2XRAL 3G9VA 1KENH 1ZT1B 4OJFL 3MA7A 32C2A 2X4PA 1FGNH 3IF1B 2QHRH 2M26A 5J57B 5EDXA 2MPAH 4Z7NE 1CDGA 1Z3GH 5CD5C 2XIDA 4JY5L 5DR5L 3V6FB 4O58H 5CJOH 5JPNA 2XA8H 1YMMA 2EDRA 2PO6B 1BQUA 4Y5VB 5F7NC 4LSTL 4Q97A 5ISZD 3RBGA 3OR6A 5CEZD 1MWAL 5B4MD 5TDNB 4NNYA 2EECA 2V2WB 2Y06L 2XG4A 3OL2A 1FYTE 3PXJA 4O51B 1R3LA 1S5HB 3TJHD 4KV5E 1QFWM 3FKUS 1UACL 1JPFA 1T7ZA 3QDGB 3BP4B 2BP3A 1JN6B 3RWEB 5CP7B 1A9BB 2RCSH 4YLQT 2FZ3B 5J06A 3HMXL 3MA7B 5A40E 1MFBH 3C6LB 3UZEA 4BQCA 1PDKA 1RZIB 3BPOC 1T0NB 3ULVH 1EGJA 1D6EA 4TYUA 4OZIE 3V52L 5B38G 4G7VL 4HPOL 1A14H 2XKNA 3MXVH 3CIQA 3MRFA 1NFIA 3C09C 5HYJB 1RK1A 3NIDF 1T7VA 3GMNA 4I3RL 4TRPH 2ZKHH 2Q6WA 5CZVH 3ARSA 5KG9B 5FXCH 3QJFB 2IG2L 3CPLA 4UIMA 4RFNB 3TT3L 2AERT 4Q9BA 4RDQG 3LVEA 3DX8A 4TSCH 4NZJA 2QQNL 4JKMA 5FGCB 4YHYB 2FJHA 4FNLL 1S78C 2I60H 3QIUA 4JPIB 5EBLA 2ITCA 4HK0A 3A0OA 5D9SA 1N4XL 4LVNB 1YECH 1XZ0B 4DVBB 5HDBF 3WMSA 2CJUH 2P5WA 5I1KL 5FHAH 4KKAD 4GW1B 4WFFE 3BO8A 1SJEA 1NCAH 4JPWL 4N0FA 3ZTJG 1DUZB 4DOHB 5D2NC 2BY2A 2YXFA 2RQ8A 5HBBA 1WTGT 1LK2A 3UTSA 4YBLC 4H8WC 4K7PY 1IARB 5EU6A 3PHQA 1UJ3C 3OB8A 2DWDB 4E42A 1F02I 3MQIA 1LEKA 4EN3D 1ZGLP 5J89A 1IAKA 5T5NG 3VI4E 3T0EC 1I9EA 1XGPA 3P9WB 5T33H 2JIXD 1XCQB 4NRXA 3V4UH 4JDVB 5D8JH 3VU2A 4WHTA 4I0PA 1G84A 5EBMB 1ZA3B 2V5TA 5FM8A 4MX7A 4P57B 5KW9L 3ZE2E 1NFDE 4Z95H 3SPVA 2WSKA 3NACL 4GKSB 5T1KD 2UUDH 1VGEH 2P47B 2R1WB 4O02L 5F7HA 3ARVA 1NC2A 1S8DB 2FGZA 3P4OA 4GRWE 4RFEA 1Q9KA 1KPRB 4AMKH 3QQ4A 4XPBL 1LEKB 3VWJD 1IM9B 2VE6A 5FAAA 4NNPL 4YHOH 1ZWIB 4KFZC 5E9DA 3DVGA 4MAUH 5TF0A 4NRXB 4LEOA 3P4NA 3MNWA 3SGDH 1FNLA 3NTCH 3H9SE 3FB5A 1J1XH 3S88L 1CTNA 3JWDH 4GRLB 2MHAB 1OSZB 3GK8H 5HJ3A 3K2UL 5C2UB 1SMOA 4NN6B 1IAOA 2UZXB 2W0FA 4GKNA 2PF6A 4QHUA 5CSZB 3C60A 1U9KA 3U30C 2PR4L 5D7JB 1E4XI 1A6PA 2W9EH 2ZUWA 1LHZA 4R2GB 5E2JA 3ILPB 3IAPA 1TVBA 3TO4C 1K4DB 3W39B 2LAAA 2PW1A 2NX5B 3W2DL 5ACZA 1RU9L 5IB2A 2GTZB 3RUGF 2NY2D 3S9DB 4Y4FC 4HMCA 4GRWF 3GMMA 4WV1A 2GK0A 2MCG1 1XR8B 4WWKC 1YEDA 3B9KB 1MFAL 1QQDB 3LSOB 3QIWC 3MLWH 1T1XB 2VDOL 4DN3L 2NR6D 3KPTA 1K3IA 1OAYL 3MMEB 1LE5A 2GW5A 5B8CA 4NQEB 4PBWD 1U58B 5TFSH 3UTSE 3O3AB 3VWKB 3WFCL 4UBDD 4XCFH 5DK0A 4CVZA 2V5MA 2HH0H 3QWOB 5TPWH 3MO1B 5FUOL 1H5BA 1X5AA 4TUOA 2DQFB 4D8PB 4K23H 4LSUH 5E1AB 4DKAA 3QCUH 5T3XE 5MEOB 3UJTH 4Y0GA 2BJMH 2NX5A 4WFEE 1LEGA 3OKKA 4BQ8A 1R3JA 3MJ6A 4FG6C 1A9EA 5C0AD 2CKNA 2NXZC 5HD8D 2EDHA 4X6BB 4GMSH 3P9MA 2F5BL 4MVBD 3CVHL 3OKOB 3O4LE 1OB1B 4YEFA 5CSBA 3QHFL 5BV7H 3TIDA 4Q6IA 4ZTPH 3I50L 3OGOE 2ATPB 2EDTA 4BYHA 1LDPH 5H37G 3DMMB 1U91A 2YD8A 3CGTA 3AAZA 5BCAA 3D3VB 4ESKA 3SO3B 4BZYA 1C12A 4ZSOB 3W11D 3VWKD 4NBYB 4GMSL 4X80L 5IFHL 3ARTA 4LLUA 1G9ML 1ZTXH 2J88H 5BZWB 2DB8A 3RWIA 4RGND 3K0WA 4TSBH 1RZFL 4G6AD 3QHFH 4LPVA 2YS4A 1MJJB 1U8QB 4PJIA 2QKIB 4PRPE 3P0VH 4NHUB 3HUJE 2EXYC 4PP2A 1HSAA 1QEWB 5E94B 2DRUA 4KI5F 4NRYA 5FYKD 5B3NA 1HK6A 2DBLL 4F80A 1P6FA 2FB4L 3S35L 4QCIB 1KCSH 3EOTL 2FHBA 3R4DA 3O8XB 1R3HA 3HFMH 1I8MB 4HGWA 2GK0B 2C3VA 4QOKE 1MCOL 2DQIH 3I84A 3JTSB 2NY6D 4PJ7A 2Y36H 2AK1H 4PJAA 3MBXL 2BVPA 4KUZL 1UJTA 3KPLB 3DUSB 4Z8FH 3C9NB 4HS3B 4MWFB 1XR9B 4F7PA 5J6HA 3MLRH 4PRDB 3JTTB 4U7SA 4YPGA 2QV2A 2X89D 4R3SA 1ZKAA 3MZGB 3N9GH 1R0AH 5I8CB 5GRXG 1REIA 3VFVA 1L6ZA 3T08A 1FIGH 4UV7H 1TFHA 2X44D 4XPAH 1M1SA 2AJVL 3OKKB 3MTRA 3BGMA 3PL6B 5L8KB 2H6PA 5D6CA 4KK8C 4PGDB 3OXRB 5CEXA 2CR3A 5C08D 1ZEAH 1JIBA 1DQMH 2AQ3A 2P43B 4X8JB 3G6AA 4LHQB 5I76A 3HUJF 3FO2B 1L7TH 5IBLD 2HLFD 5F6IC 4HC1A 4KK5C 2X5PA 1BJ1H 1F11A 1IGIH 2VLRD 1G7IB 2IPUK 1BD2A 4BQ9A 4WU5B 3TYFA 1IEBA 5EIIB 5F7FA 3G6JF 3Q3GA 4Y1AE 1IVLA 4QTIL 4CMMB 4MA8L 4F7MA 2VH5L 2V17H 3RNKA 4JQIL 4WEMB 1E6OL 1IFHH 2VZSA 4LCWA 4WTZA 4YC2B 1QFUH 3VXSA 4F7TA 1IL1B 2GCYB 3V8CA 1OGAB 5F97E 3QR2A 4F33A 3DWTA 4LKXB 4M8VA 4M00A 1KPVB 5HGBB 1O5DT 4L5FL 4QTHB 4JLRA 1I75A 3I9GL 3TO4D 3CFDB 2Z8WC 2EH8H 1JRHI 1YYLH 2MCPL 1NGQL 5D71L 5EUKA 4WDIB 2OL3A 4ELMA 3QJHA 4PG9A 5BRZB 4NP4H 3BZEA 3IU3A 1K6QH 4B5EA 1VERA 1FYTD 2LU3A 5TF1H 4G6JL 1N5AB 3T0VA 3LN5A 1A1MA 4XXCC 1B0RB 1RZGB 4GAYA 4MS8C 5E5MB 3VW3L 4PJDE 2DM2A 1A7OL 1G6RA 1JYWA 4KJQC 1JHTB 4HKZB 3JTTA 1U8JB 1F6AA 1KBGH 3N1MC 4KXZI 4D0BB 3GHBH 4P9HH 5EUKB 3MRRA 4Y19A 2X4NA 3SCMB 4OQ1A 3ULUL 1Z3GL 1BBDL 4M6OH 5L8LB 3EYFA 5KJRL 2BERA 2XN9B 3TCLA 3RU8H 1SYSB 3JV4A 2B0SH 4FFYL 5I8KH 4JFFA 1BZ7A 1E27B 5FOBB 3B6SA 3VW3H 2FL5A 1WWCA 1U8LA 3BRDA 2GUOB 1FNGA 4PJFF 1KBGL 1YNTA 3EJJX 4MGXA 4XVSH 1SMAA 4XH2A 4Y2DD 3RWGA 3EOAB 3ARFA 4M7ZC 5DFVD 3EGSB 2RCSL 2FBJH 3HE6C 1RHFA 2AJXH 2W38A 4KXZH 2X4OB 5C0IB 1UADC 2B5IC 4U6VH 1T0NA 4NRZA 5CD3A 3NA9L 2UV3A 3MJGX 1D6EB 4G9FD 4PY8J 4M5ZH 2HLFC 4JFEE 5KTEH 2CLVA 4WFGE 4FFYH 5I8KL 3WUZA 5FYLL 3ULUE 4KHXH 4KV5F 4ORZC 5JHDB 4HKXA 3LPGA 2RR3A 3B9EA 1FNEA 3KXFD 4NOFA 5J8OA 3HNVH 5EU7C 5E03A 4XBPA 5GIRB 5MI0C 2XQBH 4HS6A 4OLEA 4BH7A 1FGNL 2Y6SD 2XXMB 4TRPL 2D7QA 4ZPVB 2FIKB 4OKVB 1SM3H 3CPLB 3EFDH 4LNRA 2K3TA 1T04A 4JY5H 2XTJD 4QRSB 5FA3B 3G9AB 4OCYL 4OCMC 3SKOA 1KFAL 1YMMB 1QBAA 2AXGB 3NBNA 2O5XL 4P4KC 2ICWJ 1MWAH 4JFXB 2PTTB 2HP4A 5LXGL 3KYMA 3GSUA 4OGAD 1C1EL 5AYUL 4IS6A 1TIUA 1KTRL 3QDGA 4FTVD 3ECBB 4F7EA 2VLLA 3TBYB 2IGFL 4HBCL 2IBZY 4LQ1A 2VKXA 3UTZA 4FFVD 3C6LA 2C1PA 1L6XA 5BZDB 1XGUA 5EC2B 2HRLA 3ZDXF 3TPUB 1ES0A 2BRRL 1GL4B 2A6JB 5F1SA 2UZIH 5D1ZD 1P5UA 5D72H 1NGWB 2QADC 3FT2B 1S7RA 3UCRA 5TJWK 5AZEL 4JFDB 4FQQA 3ARBD 2DQEH 5EOCH 2Q8AH 4Q2ZB 3RBSA 4Z7OE 3RVVC 3SBWC 3BT2L 5HPMB 3HPJA 2MFNA 3QNXB 5BS0D 4H0IA 4R7NB 5CINL 1B88A 1RZKC 4LLYB 3L3IA 4Z95L 2X1PA 3O4OB 2OSLA 2VLRB 1HZHH 4NO5B 3ZYZA 3HC0A 4EDXB 4F8QA 5D7LA 3LRGA 4JZOA 1AGEA 4AEEA 3JUYA 4TNWF 3I6GA 3B2UC 3BW9B 3WIHL 3HI1A 5JPNB 5EN2B 5C08B 4MMZC 2O61B 1ERNA 1AE6H 3V4VL 4WW2F 1YEKH 3TVMA 1H3XA 2V9QA 3VGBA 1RUAH 5T1LD 1V7ML 3EYUH 1RZ7L 1WZ1L 4LSPL 4NN5C 1CFNA 3T2QA 1M05A 4LLWB 2MHAA 2R15A 4NUGL 3OKDB 3MACH 3THML 4G42B 5B38A 1FG9C 4NQEE 3UAJC 3ARGC 3LKRA 3MV7E 2VABA 1NC4D 3MUJA 1DZBA 5MENA 5D7LB 4NJ9L 3BKMH 1LO3L 1Q1JL 2MOVA 3RZCD 2G9HB 1U42A 1FBIL 2HT2C 1G6RH 5IVXA 5DUML 2AJ3A 1ORQA 2FR4B 4XX1E 1BREA 4E42B 3PJSB 1BFVH 3O3DA 1FNAA 2EEAA 2NX5E 4LPCA 1YEIH 2ADFH 4N1EA 3DRTA 2LV4A 3CX5K 3MACL 1NUFA 1IAIM 4LLWA 1RU9H 4N0RA 3RWDA 3MLXH 3RVTC 2RAMA 4WY7H 3BUYA 5EZJB 2EIZA 3HNSL 3U0TB 3G5ZB 1T1YA 2GITA 3BKML 1U8IB 4O2FA 4NZRL 4EI5A 1KJ2L 5IKCB 3MLWL 3OF6D 4XPBH 1OAQL 1S7WA 5IGXH 2IQ9H 5SWSD 4HH9A 4U3XA 3RX7A 3H7BB 5DK2B 1U8PB 5FM5O 3Q1SH 2XQYG 3QUYB 5HHXH 3GSVA 5EZOH 3GM8A 5DQJB 5HYQA 5F9AC 4U1KB 5DRNA 3S5LG 1GGIH 2P7TB 3PWJA 4AG4L 1FQ9C 3WIFA 2P5WB 2UYLA 1MAJA 1BVLA 1XF2A 3X13B 3IKCA 3OG6B 1AD0A 1U95A 5E1HB 1YJDL 1N6QH 1QHPA 1T7YA 5DMGC 4PFEA 5EFIA 3QA3A 1KJ2H 4MJ6B 4NKMA 3VFWB 3J8F7 5BS0E 1CT8A 4KQ4L 1U8IA 4O2FB 4PR5A 3FFCA 4EI5B 3G08A 5L2KB 1BFSA 2J8UF 4GSDL 4Y5XB 2J4WL 2IH3A 1A6UL 4XHJC 1RJLB 2P8PB 5EZOL 1N64L 5AG9A 1JGLH 3AROA 3EOBA 1PEWA 2PXYD 3ISWA 4M7JL 4P2QB 4WI4A 3SY0A 3S37H 3G5YA 5ALBL 3RIFK 4W6WB 2EXWD 5DEFB 3BIKA 4NC1E 2X05A 5EBMA 3UP1A 4PJBA 4YR6B 4MJIB 3OJVC 3K4DA 3SKJH 2VXUL 3U30B 4U1IA 4K9EC 4MXWH 1UGNA 2GTWB 2WV3A 3NABL 3RPIA 4TNVK 4U6XB 3T0AA 3W81A 2QQQA 3E2HC 1OAYH 3S37X 3FO1B 1ZTXL 4P4RA 3PF2A 4DOHE 4EJ1C 2YBRB 5I71B 3F8UB 4KVCL 2OTWA 3U0WL 5FO7A 3QI9C 4YNYB 1PZ5B 4OGXL 3KLAA 5CKAA 5HI3D 1B6UA 4U33A 5ERWA 5KSAA 4YIQB 3QRGL 5H37H 2PXYB 5IBUG 3MJ8A 4J3OC 3C5ZD 1RD6A 3KPNB 2X4RA 4UT9H 3WJJC 1M7IB 3T77B 2DJUA 2WLZA 4RMVA 3PXHA 3T04D 5LWYL 1LMKA 4KKBD 4POYA 2HA1A 3OKYA 1DCLA 3RP1A 4NJAH 2NNAA 4P4RB 3BJLA 3CFCL 1ZHBA 3O2WL 3FB8A 3QWRD 4O2EB 1A7PL 3TV3H 1G7LB 4XAKD 2EYTA 2F58H 4L3ED 3MLPA 3P9LB 5CBEB 3DPBA 3ZHKA 1NGYB 3TNMB 4IM8A 3BGFB 3C8KA 3ME0A 4OD2B 3SGKA 4ZAKD 1IM9D 4KUCF 2IADB 3RY5A 2CSPA 4PLOB 3MRNA 1EK3A 2VDPH 5C0RH 2WM0A 2C7UB 3E6HB 2J88L 3QI9B 4O5LL 4BH8B 5BXFA 1W72L 1KNOA 2AKRB 5CZKA 3O2WH 2F15A 1MI5D 3QWRA 1F42A 2BVEA 4K2UL 3TEUA 4JFHD 5ESAA 1EBAA 3S96A 5AZ2H 5T1KB 2IPUG 5ITBH 1A47A 1C16A 3BDXA 4CVZB 2EXWC 4Z76B 4YE4H 2DLTA 1MHCA 4M6MH 4A2LA 1QLEH 3PP3K 4LVNC 3C5JA 4ZODA 4LSVH 2NR6C 2RHEA 2CJUL 3QXDB 3TZVB 4L8SA 5EOQH 5A2LH 1IGJB 5DJ8B 4ERSL 4WHYG 4I0PC 1NCDL 4PJEF 2XWBB 3DIFA 4MS8D 2ITDA 3GSOA 3G6JE 3JV0A 5FO7B 4X7TA 2NZIA 1OP3K 1PZ5A 1UWGL 1RUPL 3UTTD 3I85A 1YYLL 4H1LA 1T89C 3I6LD 3CC5A 2J8HA 5CILH 4KHTH 4G43B 3H3PH 3UX9B 2YKLH 3GNML 4NDMB 5DK3A 4NP4L 1N0LA 1NEZB 3S5LA 1U92B 1IAIL 3UYRL 4JO3H 1A2YB 4QRTA 4ISVB 4OFDA 3QEHA 3STBA 3BEVB 2Y5EA 3PWPB 1I1FB 2BSTA 1CWVA 4O02H 4LHJB 2BZDA 5ESVB 1UCTA 4JHZA 1BOGB 1OTSD 4MNGA 5IHLB 4W6YB 3B8SA 4G9FE 1J0YA 2PCPA 1OAKL 2QJDA 2G60H 1XT5A 5CS7A 3D87B 3VGAC 4J8RA 3VD3A 4HFWA 5A43C 3IXTB 1XF5A 5TGBB 2LVCA 1BX2B 3Q6GH 4M6OL 5KJRH 1FAIL 1IILE 5I1GL 2PO6C 4K3DL 5DZNA 3JWDL 1Y0LB 1IM3B 3PDOA 4JY6B 4PJDF 4GMTH 3BD3A 3DYOA 3CSPA 3QDJE 2CXGA 3PWPA 3RKDC 3D39A 5INCA 5C07A 3QNZB 3FHAA 5ICZB 3EGSA 1KXTB 2Z93A 1AXTL 1MFDL 4BA8A 2OS7A 5DQ9A 3FB6A 3PWVA 3DXAE 1TQBB 5CGTA 1X7QB 3VXOB 3ARGA 1TVDA 2IBBA 1ZGLA 1XF5B 3VFRA 2HT4C 5KTEL 3U4BH 5CEXB 1P84K 5DFWH 4QRPB 1R24A 1KGCD 4QNPF 5ANMB 1CD9B 4WTWA 5EUOF 1MWAB 2Z8SA 3OAZH 5L0QC 4HX1A 2LVEA 4Y7MA 1S9VB 1JRHL 2A0LD 3OKMA 4WU5A 4JE4B 3R0MA 1OT1A 4LVOC 1X4XA 1U8OB 4QHKJ 4RRPG 4HDIA 1CFSA 3LQZA 3V6ZB 3QISA 1BBDH 1T21B 1NUDA 1FVDA 4YBHA 4IIQB 4NQXA 2HVKB 4TOYL 3KPSA 3ULVL 2GT9B 2NTSP 5GRUH 4G9FB 3PABA 3V52H 2OTUA 5JXAH 3WS3A 4M1CD 5SX5H 4X6DB 2R9HD 1X6LA 3X11B 3R8QA 2VL4A 1FV1B 1O7VA 4X0KA 3JXAA 3SBWA 1QYGL 1YMME 1AI1H 4JM2C 4JM2B 3UTZB 2AJZA 3WEXA 4FXKB 2Z31B 4MQXC 4XNMB 5HVGB 3A6CL 1ZK9A 5D2LE 1NANI 4J3WA 4NIKB 3K2MC 1MCSA 3TT3H 3BEWB 1MAKA 4LHUB 3G5VA 3TJEH 3BQUD 1FL5A 4RMQA 4FNLH 5E4IA 1OLZA 1EHXA 5D72L 4FFWC 2KPNA 3BAEH 4FQJL 4UQ2B 3OF6A 3T1FB 5EBWA 4BUHA 5HI4C 3HE7D 1JMZA 4U1JA 4X80H 2ILLA 3SDDC 1NPUA 4JFEB 4NKIL 4POZD 3EDDA 4JQVC 4HV8A 3CFIC 4OFKA 2DQEL 1WIPA 1CL7H 5ACMA 1VEMA 5GS0C 4Q58C 3WS6A 3ALPA 3T2NL 1NKRA 1PYWA 1NANH 3RKPA 2ZSVB 3D2UB 3ZDZF 1QO3A 3QUMB 4KJPC 3QPQC 4YBQD 2IALA 3BYYA 5BV7B 4H1LH 5DS8B 1I3RA 3V4VH 1BZQK 4XMLL 1MFNA 3GMRA 2WIIB 2XN9E 2GAZB 1XF3A 4ZYKB 4ZFZA 5IF0B 4Y4FD 4X7SL 4XC3H 3WJJA 5K9JL 5C0CD 4PLKC 2YRZA 5J9PA 1INQA 5C0IA 2FJGA 1PYWB 1OGAD 1KJMB 4JDZB 4OZHE 4HK3J 2XPGB 3O8XC 3RTQA 4XI5C 3BZFA 2AJVH 3VGAB 1BFVL 4OZFB 1IC7H 3OB0K 3P73A 4NZDA 1KSRA 3SDXF 2Q8AL 1TQBC 3QPXL 1XAUA 3RWFA 4G6FB 4YUEL 1ADQA 1EA9C 5BRZE 1CU4L 3GJFK 2IFFH 2EH7L 1IGIL 3O4LA 3ZKQD 1AXIB 5C0CA 1KLGB 3FRUA 4GLRI 4K8RL 3DI3B 1W0VA 5EU7E 1MI5B 2NXZB 4NZUL 4HXBH 5DO2C 1QOKA 4HCRH 5E4EC 1NCNA 3H7BA 3MBEA 1E6JH 3S35X 4JQIH 4NYLB 1DLHB 1SEBB 2HT3D 3FOLA 2R8SH 1QVOA 1YC7A 5DWUH 2DMCA 4WGWB 4U1SA 1I3UA 5GS1B 2DDQL 1YYMH 3HRPA 5BW7C 2Z92A 5KSUB 1OL0A 2W92A 3V8OA 3QQNA 3NIGE 4D9QD 1ZLVH 4RGNE 3KPMB 2L7JA 1CXEA 3B9DA 4HIHA 3L5JA 3FQXB 5E8EB 3LQMA 2LTQB 2XTJE 3VGFA 4HCRL 3FQWA 4MZ3A 2L7UA 2IQAB 4DN3H 1DBAH 4P5TB 1G9NH 1U8NA 1DP0A 3HRZA 5CMAA 3LQAC 1EZVX 2H41A 4KI5E 4R4FL 3IDXL 4MD0B 3IDIB 1PQZA 3QG6B 4PRAB 5F6HI 5JZ7D 3BP6B 3HNSH 1OTUD 4MDIA 4TTDD 1F3DJ 4KTYA 3MRDA 2D4FA 1KIPA 2IBZX 3EO9L 3BE1H 1K9TA 2AEPL 3LHPH 5F7DB 1KC5H 5IEHB 2P5WE 2OJEB 3QO1A 3NFPB 4PRNA 5EN2A 4GRLC 3D3VD 3LD8B 5DRZA 5EO1B 4Z78B 3TZVC 2VDQH 3DTXB 4K3HA 2NY3D 4ZXBC 3QDMB 1BZ9B 4O2CA 3P73B 4JDVA 3RIAF 1XFPA 2ZSWB 2F9BT 2BVYA 4HIEB 2WBJD 1A1OA 5HYJA 2WWMC 4RIRB 3LHPL 1J8KA 2HT2D 2LFGA 3V4PL 1JE6A 4PJHF 3G04A 4PRPB 4OJFH 1G9MH 5L2KD 3PHOB 4OIBA 5ILTH 3CSGA 4WTZG 3ZE0E 3MCKB 1F4XH 2V9RA 1WZLA 5I1EH 3SE8L 5ABDE 4PJIB 5GRYA 3VXNA 1QPPA 2XA8L 1MPAH 2EC9U 2R1YB 1Q0XH 3ARYA 4XNUL 5FF6B 2FO4A 1CK0L 3F58L 4XP1H 4ZSOE 3OGCA 4WV1C 3CFKA 1ETZA 3DJ9A 1UACH 4Z6AT 4CADB 3MV8B 3GDBA 1F4AA 1OAUL 2UUDK 1FE8H 2PTUA 2YPLA 5LQBH 4UOJA 5C0EB 2NXYD 1E28A 1SM3L 4G8EB 1IQDB 3TJHC 4OGXH 1C08A 4K2UH 4X6CB 5JOFA 4YPGB 5L6YL 2B2XL 3TA3C 3U9UB 3L9RA 1MH5A 2O5XH 1KB9K 2YD1A 5LXGH 4JVPA 4G7VH 4HPOH 3L5XH 2QADB 1EEUA 4WUUD 5LWYH 3QXDA 3TZVA 2EDXA 2M1KA 2VLRE 3ULUC 4E5XB 2GK2A 3EHBD 3L3KA 5EOQL 1R6VA 4AENB 5AD0A 5KAQF 1JNNH 1GRWA 4HBCH 3O0RH 2HTLD 3TN0D 1EUTA 4XX1G 4UINL 5D2NB 1EO7A 1NC4B 2VISA 4JFDE 3AXLB 4PREA 5FA4A 1JI2A 1Z2KA 1S9WA 4JVWA 3WXVH 2R29L 3DX7A 4I77H 1UKTA 3NCMA 5HHPA 1QSVA 1VHPA 1JNJA 1MOEA 3TCXA 1VEPA 4IHOB 2DQJL 1MNUL 4HCRA 3KG5A 3MGAA 1UYWH 4H5SB 5FKPA 3I75A 2JTDA 4JPKH 3ARDD 4LBEB 4RSVA 1RFDL 3H8NA 1F8TL 1A9EB 2PNDA 5IIEA 5EOCL 3E3QE 4GH7B 1PY9A 4LCYB 5IOPA 3ARFD 3CVIH 3LQAL 4LAQH 3RPIB 4YDKH 4RFNC 4LOUC 4OLWL 4R26H 2VQ1A 2JLLA 4Z0XB 5ITBL 3VFTA 1I85C 4PREB 4PRIB 5LGHL 4J3XA 1ZT7B 4R97C 3WIHH 5ERWB 4HG4K 2VTFA 5D71H 1J18A 1MHCB 1RUKH 3R1GH 2YN5A 1QLEL 4X6EB 4E41B 1OAKH 2V7HB 4R4ND 1N8ZA 3OPZH 4G3YH 4RAVB 1B4RA 3T77A 5DQDH 3W9DA 2CDEA 4QHLA 3DHMA 5I15L 5D1ZB 4MA3A 5IVZB 4ERSH 5IWLC 2HG5B 3NCFB 1RVFL 5HI3C 2NTFA 3GMPB 3ARWA 1CR9H 5FO8B 1JPSH 1VGEL 2JB6A 4PV9B 2F54B 5HDLA 5B39B 5FB8A 4NN6C 1IC1A 3D39B 1MF2L 3UC0L 5JHDE 4GRWB 3O45A 3IVKA 1FBIH 1NAMH 4HK3N 4Z7UB 3ZZ1A 3R1GL 4OCNC 3W5NA 1OY3B 1RY7B 2YKLL 4Y19B 4LVHB 4BSVA 5IW3A 5K93A 3FQNA 1JYXA 5J12C 3CLFH 5EPMB 1D5MA 2ADFL 5E8PA 2B4CH 4ZFOL 4XZUA 1KB5H 4NO3A 4OZFH 1RVFH 1F3JA 4GAJL 4NKOA 3MLXL 3U4BL 5MENE 1MLBA 3MR9A 3O4OC 4Y16A 5I1HL 5SWQA 5D7KE 4JFED 5FGSA 2Z35A 4HIIA 4YFEA 3T3MF 1LO4L 4JR9H 5I8EB 2FBJL 3L7FB 5DJZA 4WI8A 4NGHH 4KVNL 4WUUA 5EPMA 4U6VL 4NQVA 4N8VA 2FGWL 4FZ8L 3ARQA 2FIRT 1D3CA 4GMTL 5E8OA 3WNPA 1JWMA 2MNUA 2YEZB 5JXAL 1JF1A 2JJSC 1P5VA 2CO6B 3O41B 1JK8A 4NQSA 4EN3A 3DX6A 5F21B 1SJHA 1QYGH 3HNVL 1EBPA 4X7TB 4AY0A 1XF4B 5CJXA 2Z35B 2XWJA 3IDUA 3LEVL 4J3VA 3WNLA 1OPGL 4X4ME 5C86A 1EO8H 2HH0L 1KCVH 1N5YL 3RI5F 3NCCB 2V7HA 5C0AA 4AQOA 2ESVA 2DYPD 2DI8A 4PJ5A 2HJFA 2JK5A 4FTVE 3BP7A 4O00A 2Q8BH 4ELKA 3DGGB 4XCEA 1UZ8A 4L8DA 3RY4A 4KAQL 3LKSB 3NABH 1XIWC 2F5BH 2CO7B 3OQ3B 2WANA 4BK5A 1OGAE 2IGFH 1Q0YL 3IVKB 1BFOA 1MCIA 3HZYA 3ULVE 5EC1B 4MCYB 1CL7L 1DLFL 1LO5B 3AU1B 2GJJA 1V05A 1BWMA 1ZXQA 4R3SB 4MQSB 4NPYB 2WINA 4PTTB 1OVZA 5J1AB 2EYSB 1A6ZA 4EXKA 3F62A 2UZIL 4P4KB 1D5IL 1FYTB 4WO4C 4NZTL 5D2LA 2FD6L 1MVUB 3HE6B 1CQYA 1N2RA 2HFFA 5JW3H 3ULVC 5HDQH 3BSZH 5L2JB 4HLZG 4HKJA 1JI1A 4ZFZB 2MJWA 2DTMH 3A6CH 4R7NA 4TSAH 2WUCH 5F7YC 4ZAKA 1T66D 3HC0B 4AEIH 4LHUG 1K8DB 3LN9A 3IFNL 5F7LB 4X7SH 4XC3L 1CGXA 3WDIA 4PLJD 1WFTA 2W07A 2DIAA 1G7QA 3QEQB 2X4PB 1D5IH 1OLLA 3SDCA 2EYSA 3NGBB 5IG7A 2FEDD 3UDWC 1DDHA 3DNKA 1AE6L 4P48A 1PJ9A 3BPNB 5F1KC 4HD9A 3V6FA 1FAKT 1RUAL 4YWGH 4RAHA 5IK3A 5SWSA 4NQCE 5J6GA 4XP9L 5DA4A 4UDTA 4O5LH 3KWWB 4KUZH 4BZ2L 3OR7B 5CCKH 1CU4H 4OKDA 4U1LB 4URTB 4JHBA 4WWID 3IJSB 3ZYJA 5DYOA 2J8UE 5F44A 1D9KA 4PRBA 1CD0A 2BVTA 5ELIA 1T21A 4HH8A 5IVXF 3KXFA 4X6DE 5AEAA 4IIQA 4NQXB 4JZJA 3RVWD 4M6ML 1IAII 4HS8L 1FNFA 1YY9D 4KZEL 1P4BL 3GO1L 2IWGA 2HKHH 3QUXD 3RNQA 3MBED 3SCMC 3LEYL 5HYSA 5J6GB 3GIZL 1MRDH 2Z4QB 1FSKC 2WAHA 5EA0H 3MUHL 3V5HA 4PBVC 2MTPA 1H15A 4BSWB 4U1HA 4Y4KA 3NN8A 2HWZH 5E8NA 1RUQH 3TBVB 4QTIH 1DQJB 1VFBA 1AIFA 2NY6B 4HH9B 5DC4B 3TZVD 1OAQH 2NY0D 1BQSA 1TVBB 2XZCL 2E7CA 4ZO6A 3RUGB 4DVRL 4K3EH 1BFTA 3PWJB 1U6AH 2APWA 2P7TA 3PNWB 1MHHB 3IDNB 1EPFA 1I8LA 1IAMA 4GJTB 5I1LB 4DCQA 1MRDL 1XF2B 3WL9B 2IFFL 2ADJB 4JO4H 2W9DL 1D9KC 4L5FH 1YEEH 2E27L 4OCXL 43CAA 3JBG7 4NZUH 3QIWB 1YEFH 4X9GA 3TGXA 3P4MA 3WLBA 2H9GB 1E6JL 4B0MM 1T03L 4IJ3C 2BFVL 2F5AL 3C08H 4ODXB 2VDQL 5I1GH 5FK9B 1WBYA 3BXNA 3EJYC 4CN1A 5IK3B 4LCCA 3OZ9L 3M1BA 3VXPB 1MAMH 2HRPL 5JQHC 4I4WB 2E6QA 1OF2B 3QCTL 4CNIA 1MY5A 5GJTH 4P23B 1Y6MR 1CE1L 4MXWL 2F74A 4YDJA 4PRPD 3PGDB 2VYRE 4HF5L 1NL0L 3QUZD 1AXTH 1MFDH 4Z7VA 1JGDB 2PTVA 3BX7C 3ULUH 1F4XL 3C08L 5C0NC 3PQYD 3IDXH 3KNBA 1U8HB 4KJWC 2FECL 1MFEH 2B0SL 7CGTA 2RGSA 1H3VA 1SEQH 2HRPH 1M05B 1OARL 3UTSD 3AREB 4XP1L 5E95B 1NDMA 4H88L 2NY1B 5F9JA 3VE0B 1CE1H 1R5VA 3DVGB 4MYWB 3MFGB 1KENL 2F74B 1A1NB 3ZE0F 4AH2B 1FE8L 3WFEL 3V79C 5AYQA 1J8HA 2JJUA 1TZHB 5D7IB 3V6OE 3VXQA 1EFXB 3Q6FB 2HFEA 2B2XH 2J5LB 3PWNA 4IRZH 2DJSA 1ZWIA 5JPMB 4CUCA 2R1XA 4N0CC 3BHBA 3RI5K 2DQCL 1CICC 1M7XA 2Y06H 3TPKA 2G75B 3FCTB 4LRNL 4HJGB 3L5XL 1VCAA 5CP3A 2E7LA 1B0WA 1U0QA 1R3HB 1T7WA 3JV5A 2D0HA 2HJLA 1B0GA 3WJLA 2BSSB 4ZPTB 4BH8A 3PV6B 4OM0L 4S1QH 3N1QC 3FT4B 5T3XL 4Q6YA 3QIWA 5CSZA 4RAUA 3SGKC 3SE8H 2H9GA 1KTDA 3L3OA 4NKDB 1JPTL 3NH7L 1I1CA 2CRYA 3HZMB 1DEEA 3DX7B 4MXQC 3SO3C 1CLYH 2ZUYA 1KN2L 1NBZB 4MXVF 5HVHC 2VXVH 3RVVD 4YE4L 3ZDXE 3VFUA 2DIJA 2IAMD 2K1MA 2R0ZH 1FFOB 3UO1L 1WIOA 2YA1A 3ZKNC 2JCCA 1YNKH 4I4WA 4BFEA 5FEBA 2DKSA 4PJ8D 3KVQA 4S1QL 5LQBL 3GSXA 5I18H 1KJVA 1ND0B 2Z0BA 1NCDH 4Y5YA 1JPTH 4J4PC 1E4KC 4RGOH 4EOWH 4OLWH 1UZ6E 3U4EA 1KN2H 1PX4A 3SGJA 4G6FD 4LCCC 5EO9A 2VZUA 4CMMA 4LRIA 5F8QC 2ATKA 4TVPH 3GJEA 3S3JA 4V2BA 2J1KA 2JIXB 2Z9TA 1EGJL 4XMLH 5DJXB 1VGKA 3OPZL 2GSIB 3SGDI 4F2MA 2BNUA 1OP5H 4YDVA 5FHAL 3D0LA 4X9BA 2LU7A 4QHNA 5DJ6B 3GMQB 3HG1D 4EOWL 5B39A 3RL2B 1A9BA 1CR9L 2OTWB 2QEJA 2C1OB 3ES6A 1QZ1A 2M8XA 3O2VH 3NFNB 2XZQH 2YPLE 4LF3A 1NAML 1CZ8H 1B4JH 1IC7L 2ZWLT 1U93B 5IMMA 3GMLA 3SE3A 1T1WB 1RI8A 2ORBL 5GGSB 3V95A 1FCGA 4Q74A 4I18C 2FX8H 4FFZL 1OAZH 1JTPA 5L2KE 3PP4H 2X1WL 1YMHB 5BS0B 3W0WA 1LNUA 3QFJE 1PY4A 1XR8A 3F7RA 3MNVB 4P59L 1G6RB 4YDIL 4UBDC 2BC4A 3RDTB 3VCLA 1KN4H 4N0UA 3FO9A 4X9FA 3G08B 1CQKA 3ARBB 4DGVH 1RUKL 2WNGA 4IOIB 4HUVB 1AD9A 2VB5A 4NN5B 5CBAA 2R56L 1U8KB 4NNPH 2PYED 4N8CH 3MRKB 4JRYE 1FL3B 4NHCL 3CH1B 4WWKD 1YEIL 1QSFD 1ZLWK 4R4NC 1MJ7H 2PN5A 3JVGC 5I15H 4X9IA 2ZUVA 2CPCA 2R69L 2DQFA 4D8PA 3LPFA 2ICCA 5DJDA 2A38A 1J1XL 2VLJA 1KOAA 3R0NA 4YBLB 1Q9WA 2C7UA 4WY7L 3EJZD 3K2UH 1JK8B 2WLYA 2Y25A 5EU3B 1V7NH 1FNGB 5C0ND 3X12A 2H3NB 2YRLA 4R0LA 5I75C 2YD9A 2R4RH 1ZHNA 2NYYD 3VDAA 2ED7A 2IQ9L 3WHE0 2YBRA 4L9LA 4N8CL 4HDIB 4LLMA 4DFIA 3X17A 5HHOD 2ATKB 1MJ7L 5F70A 4Z5RA 5F3BA 3KYOB 1EO8L 1Z5LA 3U2SA 4KJPD 2HJFB 5IVOA 5E9DD 4F2MB 1LE9A 4EQ3A 4HEME 3DGGA 1G1CA 4HJ0D 4OZ4A 2YUZA 4LCWB 1A6VH 3EO9H 4KAQH 4GKSA 5A3ID 2H26B 3KJ6L 2W60A 1KC5L 1HEZB 1CLOL 5TDOA 3VXME 4GG8A 4M7LT 2VXQH 3BIAX 3BISA 2GYSA 2WP3O 4U2ZA 3PDDA 1DLFH 2FGWH 4OLVL 3DVNB 2WP3T 1AGBA 2VAAB 4M7JH 1B9ZA 1TJGH 3TYGH 1D5ZB 4TUKH 1T5XA 5E9DB 2FEEI 5I6XB 4QHLB 5KSAD 4QRTB 2CRMA 2HTKC 4YHYC 4QKXB 1I7TA 4OZ4B 2Y7QA 3VWJC 4X7CC 2FBOJ 2O5YL 3HLAA 5DA0B 4JN1L 5DRWB 4NQUA 2BVPB 2X1OA 4J2XA 2HVJA 1DQQA 5JO5B 2AABH 1H3TA 1MHEA 4O9HL 4RNRA 5HGDA 1KCVL 1QRKA 4HGMA 1N5YH 3B2UD 5ALCL 5KSVB 4H25A 4ZG1A 3KPQA 5AUMA 1QBML 4LLDB 1RZ8B 4ODUB 4NBXB 5F1OB 2XN9D 2C3WA 1HYSD 3BVNA 4C56D 2X4NB 3CH8A 3SCMA 4U1GB 3W9EA 1UT9A 5JW5A 3QUXC 1QG3A 2EDNA 4M3JA 1QSFA 3Q2CA 1VFMA 5L88L 4M7ZB 5ISZE 4YWGL 2A0LC 3TFKD 1TJHH 1GHFL 2H3NA 3G6AB 4TSBL 2XNAB 5GGVL 3TIEB 2W9LA 1F3DH 5ICZA 1FVCA 4D3CL 3IJSA 3ZYIA 1QBBA 4UQ3A 5L6YH 1AGEB 5MHSD 5ENWB 4EIGB 5HXMA 5IUSA 5C08A 2DBLH 1Z5LB 2IH1A 4B41A 2O61A 4MD4A 2X42A 1U3HA 4XHJD 4Z0BH 4YHPB 4NZTH 1OAXL 3EOTH 2ICWA 3IXAA 4Y4KC 2X7LB 1MJ8H 1UKSA 1DVFD 2FX9H 1MCOH 1ZOXA 4BSJA 4CBPA 4WI2A 3UDWA 3CU1A 5T1MA 5GGVH 3AVEA 3SE3C 5C7XH 1JNLH 2YMXH 4PYGA 5AZ2L 5IVXE 1T66C 2CLZB 2R29H 1V3JA 1YDPB 4GBXC 5C0BE 1JYVA 5DJCB 4Q9RH 3JWDC 4Y5VA 1FIGL 4NQTA 1DLHA 5INDA 3EIFA 2ZNXA 4P2QE 3DUUB 4PY7A 1FV1A 1T89A 4U1SB 4ALAL 1BQHB 2P8LB 3KPRD 4X0KB 2XY1A 3OAZK 4OZIA 2DDQH 1YYML 1KB5B 1HQRA 3OR7A 4R26L 4YGAB 2UY6A 5IMKA 3GBMH 3TBWA 1TNNA 1HWHB 3FRPA 3HA0A 4JB9L 5IQ7H 1UWGH 4M4PA 5DMIL 4NN7B 1KEGH 3VD7A 3H3PL 4MVBC 1DBAL 4LFHG 1PZUB 1FL5B 2IBGA 1ACYH 3GSNH 2ZUQC 5BMFH 5C2BL 4XNZC 1XH3B 3GNMH 1Z0MA 4PJ8A 2A6IB 4PGJA 1QFUL 4P2RE 3BD5A 5E2WH 1URLA 5FUCC 3U0PA 1SBBA 4MZ2A 1SYSA 3GIVB 3JV4B 4JGJA 1JZ5A 1EXUA 3GIZH 2FJFB 5C09B 2GTZA 3E3QC 1FH5L 4I0KA 3S4SB 2Y4SA 4LPTA 5L2JA 3MYJB 1DE4A