5EJ2A

Crystal structure of carveol dehydrogenase from mycobacterium avium in complex with nad
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
277
structure length
277
Chain Sequence
TGRVAGKVAFISGAARGQGRSHAVRLAQEGADIIAIDICGPIENLAYPHSTPEDLAETADLVKDLDRRIVTAQVDVRDFEALKSAVDSGVEQLGRLDIIVANAGVGTDGRKLHKIRDNVWQDMIDINLTGVWHTVKAGVPHVLSGGRGGSIVLTSSVGGRKAYPNTGHYIAAKHGVIGLMRAFAVELGPHMIRVNAVLPTQVSTTMVMNDQTFRLFRPDLENPGPDDFAPISQMMHTLPVPWVDASDISNAVLFLASDESRYVTGVSLPVDAGSLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
molecule keywords Carveol dehydrogenase
total genus 102
structure length 277
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2015-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ej2A00
1Z75A 4OM8A 1GUZA 2IZ0A 2YDYA 1UAGA 5CEJA 2HCTA 3VKVA 3LSYA 3WTCA 1ZZEA 1TA4A 3H9UA 4XB2A 3JQEA 4E0BA 5BSFA 2VT3A 2VHXA 1ZXBA 1XDWA 3S2EA 3OHSX 1PX0A 1UAYA 5JCJD 5DN9A 3GG2A 2QRJA 5BSEA 3PFFA 2VZ8A 3JYLA 4D43A 4CQLA 1GQYA 3V1TC 2CSUA 1EVIA 3QWHA 3PHJA 2O4UX 4GSLA 2FRDA 2PKQP 2C2XA 4WJZA 4BIIA 2FWMX 2FZEA 4RF5A 4AJKA 4EJ6A 3HDJA 4YJFA 4J9UE 5JAZA 1H2BA 3WGZA 1NVTA 2E6UX 4F3YA 5H81A 2I3GA 3NDJA 1PIWA 3LC1O 3VPSA 3JD1A 1E6UA 3TFOA 1T2CA 5FI3A 1LSUA 4E2WA 3FBTA 4DBVO 4KOAA 2D59A 4A03A 2F00A 1PJTA 2VZ9A 2YV1A 1MC5A 1DSSG 2QW8A 1XYGA 3H9JA 4QO8A 4BO2A 1NQTA 1P1JA 4NBTA 1C1DB 1HTBA 2EGHA 1EBFA 4HP8A 2PD4A 4PG6A 4L75A 3VTZA 1ONPA 4Q3AA 3WGIA 2CDCA 1PWXA 5C37A 2Y1GA 2EP7A 3K8ZA 2HMVA 1BXGA 4YT5A 3JSAA 3NJ4A 4ZHSA 4CM7A 1EQ2A 2R00A 4FFOA 1NVMB 3D1LA 3GH3A 3VH3A 3F1LA 5A1TA 3IQDB 1C0LA 3DZHA 3RU9A 3OA0A 1EK6A 5DBGA 2VHVA 3VZRA 4FGWA 1DLIA 1PZGA 4GX1A 1P74A 2QRKA 4ZVVA 3STHA 2P9CA 5DBFA 4FOOA 4MVJA 3KETA 2PZJA 1LEHA 1PJ3A 1U5CA 3PHLA 4E5PA 1PL8A 3SX2A 1FDSA 2HJSA 1DJQA 3A14A 2VUUA 4JJIA 3TZHA 1HZZA 1PQPA 4NBUA 3ZWMA 5ICMA 1ADGA 5TT1A 3ITDA 1SPXA 4IMRA 4XQCA 5TT0A 1XKQA 4CM8B 3QHAA 1N7HA 4QT0A 1DHTA 2EG9A 4H16A 3H5AA 4AICA 1E5LA 4GGPA 1K0UA 4K26A 3WNQA 4RF4A 3LLSA 4BB5A 3COSA 1C0KA 1QYXA 1V0JA 1KOLA 3MWEB 1JKJA 1SNYA 3KYCB 1PU2A 1K2WA 1G6KA 1XCBA 5MDHA 1R66A 3NT5A 4RVFA 1VRWA 4KP7A 3QY9A 3UAGA 3BMOB 4LCEA 3VH4A 1R4MA 5JY1A 4A27A 4EZBA 3JQ7A 3VH1A 3ZZNA 4B3HA 3DBRB 1Y5MA 4DYVA 3DBLB 4CR6A 1KERA 5T64A 1IYZA 2H6EA 4QSMA 1RJWA 1SB9A 4YAEA 5IXYA 3DAFA 4YJGA 1NPYA 4J6FA 4HX5A 1JU9A 1T1SA 2JL1A 5G0WA 1YQXA 4YACA 3ZU5A 1FXSA 1F17A 3MCVA 3HHPA 1NR7A 4WEOA 4CL8A 5TLSA 1QKIA 1IPEA 1H93A 2GO1A 2B5WA 1NWCA 4DA9A 2UUOA 2BGKA 4HNGA 1E7YA 4DUPA 4YAIA 4O59O 3HE3A 5EINA 1R0LA 3PRJA 4FFPA 3PTZA 4RCVA 2UAGA 3L9WA 4MVJG 1G0NA 1HKUA 4OGWA 3BAZA 4O63O 4Q3EA 4AJ4A 2Q4BA 4KUEA 4IGFA 4WLFA 4WOJA 1P1RA 2W2KA 3IP1A 2PGJA 3RUEA 1X7GA 3VC7A 2C07A 3D3WB 4IDGA 4YPOA 3PIIA 4XJTA 4BO6A 2GN6A 2PGLA 3PYXA 5B4TA 3TPCA 2JFHA 2ZTVA 1JKIA 1DJNA 4BMSA 1UP6A 2VN8A 2DKNA 4XX0A 3MTGA 2Y1FA 3ULKA 4KWHA 1YE3A 4J49A 2YFHA 3BA1A 3UH1A 4L4XA 1JQBA 5T67A 1F8FA 4P4LA 5JYEA 1UXHA 3UUWA 4HKTA 5C5IA 2BI8A 1EDZA 5EIOA 2IYOA 3NTRA 4JN6B 3W8DA 5A05A 2EW2A 4I5FA 5J23A 2SCUA 4Z0HO 5THKA 1I3KA 1IULA 3GA0A 3Q3CA 2ZJ0A 4NJOA 3DBVO 3QV1A 1KBZA 3JQGA 4K6CA 4GSKA 3LF1A 3ENNA 4MVJM 4CR7A 4F45A 3O9ZA 4A5OA 4ZQGA 1YL5A 4RLHA 4UVIA 1DHRA 4EBFA 4IJKA 2HK9A 2X1HA 4OSOA 3ZWAA 4EUEA 1ZMTA 5A04A 3OIFA 3GGOA 4OHUA 3TZCA 5AOVA 1J5PA 2DBQA 1ZH8A 3M1AA 3UFXA 5AQ1A 4J1TA 5LDHA 1SOWA 2EGGA 2Q2VA 4XR4A 3ZHYA 2IDZA 4TRNA 1NNUA 3AI3A 1QSGA 2XAAA 2RIRA 4H7PA 3OQ1A 3AFMA 1DRWA 3QWAA 3V5NA 1N8KA 2ZTLA 1JKFA 3A28A 1E1KA 1B14A 2DT5A 4GMFA 4CM1A 3WGGA 4RVGA 2WJPA 4G5HA 4BNIA 1X0XA 1KEWA 1QLJA 4B4OA 1P0CA 4J1QA 1AGNA 1TEHA 3ZNNA 2JD0A 3WGYA 3PQEA 4N5MA 1CYDA 3HN7A 3E82A 4AJLA 2IZZA 3JQBC 3GVCA 1SOVA 1VSVA 4MVJD 5JS6A 3TOXA 1IUKA 2D4AA 3X2EA 4LW8A 2YHUA 3TF5A 4NBVA 3HZZA 3RIHA 5GZ6A 1BWSA 1NFRA 1NFQA 3IUPA 4KMSA 5IN4A 4ONEA 3GHHA 4R5HA 3JYOA 3OSUA 2D8AA 5I8ZA 1I33A 2J3IA 4M55A 2JCYA 3E9MA 1O89A 5B37A 4IZHA 2Y1DA 2YY7A 3FBGA 3CXRA 1ZK1A 3PJDA 2D3TA 1EUDA 1UZMA 1L7EA 3HNPA 2P4HX 3NT4A 1G0OA 4IINA 3P2OA 1H9BA 5A03A 4I9UA 1SEPA 5COQA 1ARZA 5TC4A 4Z0TA 9LDBA 4GPD1 1KY5A 1H5QA 1T4DA 3G3EA 1LRLA 5TSDA 3WJAA 5JDIC 1ONNA 1FDUA 4PZDA 1VL6A 4E31A 3GNTA 4Y6PA 4Z6KA 4J91A 2CDBA 4PVCA 3ON5A 2HJRA 2AE1A 4DLBA 3Q1LA 1H6AA 3VKUA 3K9QO 2VRCA 1PWZA 1R15A 1ENYA 1WDLA 1GZ3A 2HUNA 2NQ8A 3TJRA 3HDHA 2X9GA 4XJSA 2I5PO 3K73O 3KLPX 2Y1OA 3I1JA 3IJPA 1CWUA 1Y8QB 1PZHA 3C24A 3CINA 3FTPA 3IS3A 3U4CA 4JK3A 1F0YA 2I76A 3KZVA 3C1TA 4JGBA 1MFPA 2DPGA 1NPDA 4A26A 4J3FA 4BNJA 3VZQA 1P3DA 3O26A 1MGOA 1U7TA 4EEZA 3Q2KA 5KTKA 4OJNA 3DDNA 1DFHA 2PZMA 3VH2A 3JQ6A 3H2SA 5L9AA 3PQFA 4W7IA 1FF9A 4DPLA 4AJEA 4BNUA 2AMFA 1F12A 1R0SA 1N9GA 2EWMA 3CMMA 4MO2A 4Y6SA 5IG2A 3RASA 2WYWA 4D3FA 1GQQA 4YQZA 2EP5A 2FPPA 3IOYA 4YRDA 3PHIA 5JPIA 4QECA 1FDWA 4JBHA 2B36A 3V2GA 3OF2A 4F46A 1R0KA 3AM3A 4MINA 2JCVA 3MOIA 1IE3A 5TJHA 2PD3A 2NVBA 5JDCC 3PDJA 3O8QA 4XQ9A 4HFNA 3L07A 3NAQA 3WGTA 4DC1A 4BO9A 4IDAA 5EN4A 4DQVA 1A4IA 5T5QA 1C0PA 3R0IA 1D7OA 2AEMA 1E7MA 3AY7A 1GYRA 3RBVA 4FD3A 2BGMA 4YTEA 4JP2A 2GZ1A 2YQ5A 4DLLA 2O7SA 2ILTA 4YBZA 2NVUB 3T4EA 5GY7A 3BYZA 2WYUA 1ZVMA 4JCOA 3OEYA 4HBGA 3TDKA 4KDEA 3BZUA 1DRVA 3RFXA 3FI9A 3U3XA 3JD4A 4HUJA 4MIYA 3F3SA 3ZWBA 5CDGA 4XCVA 3DAPA 5AXAA 2D5AA 4ZRNA 1SCUA 4GBJA 1BXGB 4FBGA 4DQXA 4GX2A 2G5CA 4FB5A 5A9SA 1V3VA 3I9JA 4RGBA 3ICPA 4U0KA 3UCEA 1C14A 1E3SA 4GLLA 2ZB3A 5CDYA 2NTVA 2DTXA 2OFPA 3AU9A 4RDHA 1NR1A 1AXGA 1LRKA 1O95A 4WPGA 3U62A 2VNSA 1MUUA 3DZBA 2V6GA 3ZWOA 4GVXA 1KEVA 3JCZA 4XYMA 3DTYA 4Z0PA 2P5YA 4XB1A 3TZ6A 1BDMA 3ZV5A 5DULA 2YW9A 3M1LA 4GX5A 2PD6A 1TI7A 3R6DA 5CFZA 4DMLA 1LC0A 4R01A 3ZWCA 1BGVA 4L0QA 2O3SA 1LSJA 3JQ7B 2NM0A 4HWKA 3MJTA 4YCAA 2FP4A 4P38A 4JBIA 1UP7A 3OM9A 3NJ8A 3I9KA 2GCGA 5JSFA 3AUSA 4KQWA 3DQPA 1Y9AA 1ENZA 1D1SA 5AXBA 3OQBA 1PS8A 4I8XA 5C7IO 4PLYA 4XYEA 4YJFB 3RKRA 2H5LA 2FR0A 3AM5A 1HYEA 4YA6A 1U8FO 3GFBA 1BMDA 4II2A 1LLQA 3P2YA 4DIBA 5BNIA 2ZB7A 4WGGA 1ISJA 1I8TA 2E4AA 1BRMA 3GPDG 5L7YA 4AJ1A 1FJHA 3H8VA 3DTTA 3O38A 3RAJA 1H9AA 3ANMA 4E32A 5CEEA 4ZQHA 2VUSA 4AL4A 1Z73A 4J4BA 4XQGA 4MVJI 5KVQA 3AWDA 2BMAA 3RCBA 1WZEA 1QP8A 4GL4A 3VPHA 1I24A 1DC5A 3WX0A 2QX7A 2VYND 1EFLA 1SB8A 3GAZA 3L9XA 1A7KA 3GGPA 1QORA 2DBVO 2EJVA 3KOUA 3IC5A 1P45A 1H2HA 4KZPA 1H6BA 2WE8A 2B83A 5TF4A 2X0NA 1BDBA 2FOIA 3F4LA 3F5QA 5EQDA 1T26A 3K2EA 3JQGB 1V35A 3FPCA 1HSZA 1MX3A 1P1IA 1RPNA 1U3WA 5A9RA 4ALKA 3DC2A 4QFDA 2IEDA 4YJHA 5BQFA 3KRTA 1PS9A 1EMDA 4GWGA 3PZBA 5FI5A 3U9LA 4NHEA 5K6AC 2HU2A 1Z7EA 3G1UA 1U4SA 5JYDA 4RQTA 3VHRA 4ALJA 1E3WB 2NU8A 1ZXLA 3QVSA 3OICA 4RPGA 3RJ9A 4CR8A 3O8QB 2JKVA 1TT5B 2YJZA 1C1XA 1E6WA 1OC2A 1NP3A 4U6QA 3RU7A 4WLUA 3U4DA 1GEGA 1CETA 1GPJA 3LZ6A 1PJQA 1BHSA 1SBYA 3I5MA 3QWIA 5F21A 3D7LA 2RHRA 1XGKA 5BT9A 2NU6A 1OFGA 4E5NA 1HT0A 1KVRA 2BH9A 2WM3A 4D45A 1M6WA 5B4VA 5IDYA 3BMOA 4E30A 1AHIA 2CF5A 3QW2A 4CLRA 3RSHA 3PK0A 4RL6A 1XU9A 2OP0A 4E4YA 5JNLA 1U7HA 2WTBA 1Y81A 5DCWA 4E12A 1T25A 3MJEA 2X58A 4ILKA 4CMKA 1W4ZA 3TWOA 1DAOA 3QVWA 1DPGA 2QRLA 2QG4A 4UAGA 4WLOA 1M6HA 2OBYA 1AE1A 3ONDA 5L4LA 3ZNPA 3UXYA 2Z1MA 4W9NC 3V2UA 3JQ8B 4UEKA 5FEUA 3RWBA 1LQTA 2WD8A 4CV1A 3JV7A 3W4IA 3X2FA 2PH5A 3L4BA 4DBZA 1U2GA 3PJEA 4CUJA 1R37A 1WLYA 3E9NA 1JWBB 2X5JO 2H1SA 5CP8A 1P33A 1ISFA 1U3UA 4FJ1A 4FS3A 4CODB 4CMJA 4OH1A 2D5CA 1PEDA 4BO0A 4F6LA 3NEPX 2ZCVA 4FGSA 3TQHA 3KYDA 4O0LA 2FSVA 4RZIA 4LRSB 5CAEA 4BNMA 3NT2A 4NPCA 5IDQA 3DOCA 1PJBA 3BHIA 3CZMA 1KC1A 3WSVA 6LDHA 4NK4A 5DOVA 1LDEA 2YFQA 1AHHA 1ML3A 3DHYA 1FMCA 3E9QA 2YV2A 5IDWA 1VM6A 4RORA 1HXHA 1SEVA 3M2TA 3TL2A 3I9NA 4B7UA 2B5VA 3H65A 1KC3A 2X9NA 4FC6A 5CDUA 4C4OA 4IDEA 1X15A 3FCOA 3B6ZA 1EVYA 3PJFA 4K9DA 4CMGA 3I52A 2E82A 1H0KA 5T8KA 3ZWPA 1E3LA 2O3QA 2Y66A 4NU6A 3GOHA 1QV6A 3H9QA 4K1LA 4EYEA 2HK7A 2I6TA 5JW6A 3SLGA 3FHLA 3SLKA 2FN7A 3KB6A 2A94A 3IP3A 3DWFA 1YKFA 2OXIA 4NI5A 5FWNA 3SBOA 2V6FA 3AK4A 3INGA 4AFNA 2A35A 5DDIP 1KETA 2VHZA 1U4OA 1WVGA 2R6JA 4PLGA 2G17A 1QR6A 4ZA2A 4UUPA 4GVLA 2PLAA 1GEEA 4AVYA 1OMOA 3EMKA 3PLNA 1SZJG 2AG5A 1U9JA 3UCFA 2PA3A 2B37A 1WZIA 2VOJA 2Q2WA 2W2LA 1K3TA 2CMDA 3RUAA 5KJEA 1Z7BA 3RUCA 1WDKA 4I1IA 4JNKA 3SEFA 4HFJA 3DZFA 1NPTO 3JTMA 3FNGA 3MJVA 3QJ5A 4G65A 4XDYA 3WIEA 4CMCA 4IQGA 3RC2A 3JQCA 1A5ZA 3JD0A 4PRKA 3SJ7A 3JQAB 4DLAA 2QZ9A 4D46A 2VHYA 1NM5A 2FMUA 3D4NA 4GGOA 4L4RA 2VTDA 1IZ9A 2J5KA 2Y93A 5TIIA 1KIFA 1LSSA 1ZJYA 4CMEC 3A4VA 3T7EA 2CDAA 3E5RA 3ZHBA 2AA3A 1JTVA 1LNQA 3GZNB 4Y9DA 4YWJA 2DU8A 2XPCA 3RJ5A 4R1SA 2GF2A 4PG8A 5JBIA 2Y68A 4D42A 2Z1NA 4DPKA 4ND5A 4WCFA 1ZMOA 2GASA 2DBZA 3AJRA 1YB4A 3ASVA 3K30A 3L6OO 1QYCA 3IIEA 5CDSA 4GWKA 4RLSA 3VZPA 3FTNA 4NBRA 4CLDA 3GEDA 3DBHA 1H6DA 4NR0A 3PWZA 5HBRA 4UULA 4XYLA 1I2CA 2GNAA 2YQ4A 4GLOA 3DZIA 1XR3A 1WDMA 3R3SA 4E5MA 2WWRA 3BTOA 1ZNQO 2J3KA 3GZNA 1NTOA 1B8PA 1VJ0A 2FPGA 4RDIA 4XGKA 3E03A 2C82A 4BL5A 3BTUA 4DRYA 3LF2A 3KYDB 1ZK0A 1IPFA 1KEPA 4R5MA 2IE0A 2HRBA 3EGOA 4BMNA 4FW8A 5FFFA 4BNVA 5KKAA 1ZFNA 2H63A 3TFQA 1Q7BA 3QA9A 5I7VA 5ER9A 5HM8A 1WW8A 3N74A 2FR8A 3HUDA 4YRAA 1XQ6A 3WICA 4HV4A 3VPFA 3VVBA 3OFSA 3WMXA 1DC3A 1CERA 1LA2A 2PK3A 3GY0A 3MJCA 4WCDA 4W7HA 1T4BA 4AJJA 2X9VA 3ZWVA 4BUCA 1M66A 1Z74A 3A9WA 4NFYA 4Y6RA 1GDHA 1HDRA 4I5DA 1R4MB 3CUKA 4CMIB 4JXKA 1OI7A 4YT4A 5GZ1A 3E5MA 3JYPA 5JLAA 2FSSA 3DFUA 4MIEA 1LDYA 1E0DA 3Q2IA 3H9GA 1R4NA 1RKXA 1OZAA 4GI2A 2FR1A 2G76A 3GDFA 1PJCA 4HNHA 5KCZA 1I01A 2E49A 1U3TA 4N54A 1HDGO 3ZU3A 2VCYA 1KY4A 2X5KO 1T2FA 4G81A 1KEUA 3D3EA 3SC6A 1ULUA 5TX7A 3ZV6A 1NYTA 3OQ6A 2NU9A 5A9TA 4YR9A 1HDCA 1RYEA 1A71A 4CJXA 4IXWA 2X6TA 4RPJA 5G4KB 3GF4A 1P0FA 2D1YA 1CQJA 5DZSA 2OUIA 3ZW9A 1U3VA 1E6EA 3ANNA 4AJOA 1UZNA 1ID1A 1B3BA 3A1NA 4M86A 3PJGA 5G2OA 3WGHA 2I65A 1TVEA 3WR5A 1ZW1A 5LCXA 4P22A 3LQFA 1PSDA 3BMQA 1D4FA 3LC7O 3P7MA 1K6IA 1A4UA 1OC4A 1PGOA 3DMYA 4YJHB 4BV8A 4CL3A 2OOSA 3W8FA 5KJFA 1BTOA 2JAPA 3FR7A 4Q39A 2W2KB 5DCUA 3PWSA 4D79A 1HWYA 1NQ5A 1SMKA 1E3JA 2AEJA 3PP8A 5TS3A 3IDSA 5L95A 4XZ3A 1DIRA 2VNAA 4ZJUA 3WDSA 1P9LA 1YDWA 4CMAA 3NKLA 1J4AA 1GAEO 2DAPA 2EXXA 1WWKA 4MPDA 3L6EA 2Y0CA 3NX4A 1NBOA 5L3ZA 4KTVE 4NDNE 1PZFA 5BR7A 4M89A 4XWYA 4U8GA 1H94A 4JJGA 1YQDA 2ZJ1A 1DC6A 3ORFA 1VSUA 1Q7GA 1U8XX 3GUCA 5C7OO 4OSPA 2OORA 1UJMA 1NFFA 4ZRMA 2IXAA 4IJUA 4H3VA 5AYVA 1DEHA 2IODA 4IGEA 3HFGA 3R3JA 3K6JA 2GR9A 3BTSA 1P1HA 4B4UA 3PWKA 1OAAA 2DLDA 3FR8A 4YRBA 4LMRA 3OECA 3OIGA 1G1AA 1E5QA 4HFRA 1NASA 4RV9A 5L4NA 3FRJA 4CQMD 1LBEA 3ZDFA 1YL7A 3C1AA 1XELA 4CLRB 4IIVA 3PHHA 2BLLA 3JQAA 3KTDA 2AEFA 1LRJA 3MOGA 3ABIA 4D44A 1JAYA 4BGIA 2D2IA 2NADA 4J43A 3EYWA 1Q7CA 4JLWA 3BMCA 3WMWA 4B8ZA 5JFOA 5TQVA 4J7XA 4JQCA 3SC4A 5ES3A 4NFSA 3UN1A 4PLHA 1FDTA 2BD0A 2YDXA 3RD5A 3DEYX 1MLDA 2NVWA 5JMWA 5U4QA 4P4NA 4LRTB 3JQBA 4R16A 4BO4A 1V8BA 1YOVB 2NTNA 3WQQA 4CM4A 5A3JA 3S2FA 3S2GA 2VUTA 4JIGA 1YBVA 5IFLA 3OH8A 3HFSA 4BB6A 5DP2A 4TMFA 1DRUA 4AJHA 3VTFA 4E2XA 3RVDA 1M75A 1I32A 1F14A 3AOEC 2CF6A 3I4FA 3F5SA 3T7CA 4Y8VA 2Q1UA 2ZKLA 1K6XA 4UEOA 1MV8A 4Y67A 2C20A 3LLVA 5LDGA 3GG9A 3Q6IA 1NXQA 2Q46A 4J0FA 4DVJA 5L53A 3AI1A 4XA8A 1X0VA 1UXGA 2AHRA 4UUNA 4W9NA 4DIOA 4AJPA 1PQWA 4FC7A 1GTMA 4IMPA 3LU1A 2DBRA 2PWZA 1AN9A 1QRRA 3UICA 2BKAA 4Z3DA 1YB1A 2ET6A 2QYTA 4MKZA 1GU7A 2P5UA 3LDHA 1XA0A 2X0IA 4L4SA 2HAEA 3I9MA 3LK7A 2GSDA 4GH5A 1HYHA 1DC4A 2P9GA 1WXDA 2OZPA 4PZEA 4D0RA 2TMGA 2J3JA 2BHLA 4BKRA 4EUHA 2I66A 4BHTA 4PLPA 3ZNOA 4Z9XA 4YXFA 1DDOA 2AQHA 4WLNA 1HDXA 3FD8A 3S2IA 3C3XA 3LT1A 1LTHR 1Z82A 1ZSYA 3F4BA 4XIJA 4BOYA 4FFLA 1GYPA 2Q49A 5KWEA 2W90A 1YH3A 4XR9A 1W8DA 1R4NB 3D4PA 1XIVA 4KDFA 3JD3A 3KXDA 4A7PA 5JC8A 4MVJF 1EEHA 2O4CA 4BQRA 3ROMA 1PZEA 2NACA 4GKVA 4PN3A 5DP1A 3B1FA 1V3TA 4M49A 1UZLA 4RPHA 1QV7A 4PIVA 3K5PA 4Z3KA 4IDCA 5EL0A 4NJMA 4OOEA 3RUDA 3N58A 3UOGA 5DNAA 4RF2A 3PLRA 2EKQA 3FNFA 1VL0A 4BNTA 3ZW8A 3PI7A 3DZJA 2Y67A 1YOVA 4A10A 3CZRA 1Y8QA 2D0IA 5GMOA 5KJCA 3EZYA 5IZCA 3GVXA 4TRMA 3INTA 1S6YA 1HLDA 4EJ0A 2VWGA 1DIAA 4NMHA 4R1UA 2BFMA 4QQRA 4NBWA 2C0CA 1I10A 3WYCA 3VVCA 2V65A 3QVTA 5K9ZA 3CTMA 4L9RA 4Q3CA 1K6JA 4MP3A 4J7UA 1KVTA 3PHGA 4ZU3A 3EUWA 3LVFO 4R3NA 1I2ZA 1VL8A 3UHAA 1Y8RA 3GGGA 5ENDA 4CUKA 1PJ4A 1YQGA 4CMBA 5L45A 4JP3A 4RVUA 3QSGA 3DONA 1XU7A 4LCJA 4UVDA 4RZHA 4EW6A 1YGYA 3AY6A 3G79A 4U0JA 4YDRA 1DFGA 2EF1A 3Q9UA 1GV1A 4OIMA 4C7JA 4TVOA 1UDBA 1ISIA 1CRWG 2Q3EA 5EPOA 3C7CB 4Q3NA 2VZ0A 5HA5A 2I99A 2JCXA 4BNKA 1VKNA 3QVXA 4XKJA 3ZWWA 3PGJA 4U6SA 3S55A 2NSDA 3C7DB 3WQSB 1R6DA 2UDPA 4IPTA 3NGLA 3WBFA 5IDXA 4LISA 2VHWA 5ENVA 1A7AA 4OMUA 4R54A 5EQFA 3RFTA 3W4JA 2NQTA 1U1IA 2ZIZA 3MTJA 3PYMA 3C8MA 1VJTA 5A06A 1M76A 4IJVA 4TZTA 4B7XA 1HF3A 4OXNA 4GKBA 7MDHA 3W4KA 1MXFA 2C59A 4RVHA 1KS9A 4KQXA 4CM5A 3B20A 2J5RA 3KM0A 4CV2A 3AFNA 5KJ1A 4LVCA 1ZSNA 3Q9NA 5L40A 2C29D 3OBBA 5ITVA 4YJDA 1TLTA 1VC2A 1E7WA 3WXBA 1XQ1A 3ZI0A 5JO9A 1LDNA 3ETDA 2AQKA 4Z9FA 1NHWA 4TRRA 5TJ9A 1ZK4A 2OHXA 1I0ZA 4YAGA 3TZQA 1B0AA 1SO8A 1I3MA 2YYYA 3DHEA 4TZKA 1L1FA 4L8VA 3RBZA 4XGNA 3GN2A 3C1OA 2YV3A 3ZNQA 4BO5A 5CG1A 5H82A 5A9SB 4DREA 1HE5A 2B35A 1TT7A 2O7QA 3EW7A 1GUFA 3HQ4O 4TKLA 3QVOA 4BKQA 5A5EA 1ZCJA 9LDTA 3RUIA 2Y05A 1E7RA 3N7UA 2C7GA 2OGUA 4BGEA 5EESA 1K5HA 3ZH2A 1XHLA 1B3RA 2ZCUA 3KO8A 3RC1A 3EY4A 4YB8A 1U28A 1JAXA 2CY0A 2DFVA 3HG7A 3S1LA 1CQIA 2OO5A 1ZBQA 1OOEA 4PLTA 4RPKA 4MOWA 2VOEA 4W82A 3WNVA 2JJYA 2LDBA 4QEDA 4DMMA 4BO3A 2NVUA 4PCVA 3CPSA 5CHEA 4JX8A 4PLFA 2NUAA 4M87A 3ZV3A 3CE6A 4NK5A 1PGPA 4B8WA 4QFCA 2JFFA 3PZRA 2C2YA 4UUOA 3UF0A 1MXHA 2Y1EA 4PLWA 3PXXA 4R1TA 1MP0A 4QO7A 2EV9A 1B8VA 5CDTA 5I9NA 3H3FA 4KTTE 3JD2A 4OXKA 4B3JA 2VWPA 4TVBA 1X7DA 4CMEA 5JCXA 4N5LA 3H5RA 1MC4A 3QIVA 2V6MA 1CIVA 2WDZA 1LSOA 3E1KA 1CJCA 1ONOA 4ROSA 4G2NA 5ILOA 1O6ZA 1N5DA 3IJRA 3VDQA 2B4QA 3GZ4A 2EHDA 3H4VA 1X1EA 1LDBA 3HJAA 1FK8A 4M54A 4CV0A 3LT2A 1HE4A 3PQDA 4W6ZA 5DT9A 1IY8A 2ZYGA 1D8AA 1U5AA 4MKXA 3ROKA 4AJNA 3BMNA 4CPDA 4D41A 3RC7A 2AG8A 4B79A 3EDMA 5A5FA 1PJSA 1EZ4A 2X23A 2H9IA 3OMLA 2GD1O 4LVUA 3TZKA 2NU7A 3NTQA 4XQEA 1EVJA 2E37A 1I2BA 1ZSVA 3CKYA 5ITWA 4OXYA 1LX6A 2ZB8A 2I67A 2A9FA 3G0OA 2DFDA 4BNNA 4WLVA 2FHSA 1AXEA 3ONEA 3WLFA 2AQ8A 3GLQA 2XXBA 4AJ2A 3BMQB 2EERA 4PVDA 3JQAD 1JDJA 3DMTA 4FJ2A 5JXWA 5I7SA 1EQUA 2X8LA 3H6KA 3E8XA 4BKOA 1KVSA 1YS4A 4J1NA 1HYGA 3ADOA 3S8MA 4U5QA 2G1UA 1MG0A 1GY8A 2X22A 1B26A 2QYSA 4XRRA 4DTIA 3KLMX 2A92A 3VZSA 1HLPA 2NNLD 4OO3A 4ID9A 1W6UA 3NRCA 3V1YA 4DL9A 1P31A 4R69A 2JFGA 1QMGA 3CH6A 5F5LA 1YBAA 4LMPA 4R3WA 1Y5RA 1ZJZA 3OJEA 2Q1TA 4MVJP 5ADHA 4UEJA 2IYPA 3O03A 3MWDB 3I9OA 3G17A 3QWFA 4KUGA 2IEBA 1PL7A 1PTJA 2C7VA 3WBBA 1C0IA 4FSHA 4B4WA 1M67A 3DBHB 3LT4A 2AW5A 5JAMA 5KJ6A 3KSUA 1M2WA 3ENKA 4WEQA 4OYRA 1CF2O 2PFGA 4PLZA 4GMGA 5G0VA 3AM4A 4WCFB 1LU9A 2QHXA 3ADPA 2WD7A 2X7HA 4E6PA 2Q1WA 3OJLA 1EE9A 4EITA 4ALNA 4DGSA 4W4TA 2IZ1A 3KUXA 5HS6A 4EEXA 4CLXA 2CFCA 2QZZA 4EI2A 4CM6A 2BFOA 2GZ2A 3NV9A 3ST7A 3BTVA 2XXJA 1HE2A 1SC6A 5TNXA 1I3NA 4IS3A 2X0JA 1JW9B 4IUYA 4YAJA 1DO8A 3KEOA 1TXGA 1ISHA 2ZQYA 1N1EA 1P1KA 4GQAA 4HADA 4R41A 1CEQA 3BXXA 2O2SA 4R9SA 2ZB4A 1Y6JA 3NTOA 3OJOA 1QG6A 1BVRA 1TB4A 4W99A 2HSDA 3ZHZA 1RWBA 2CVOA 4I08A 2C5AA 5L4SA 5KIAA 3OETA 1PS0A 4J1SA 4I9HA 3RI3A 4BMVA 3DOOA 5B4UA 1E1NA 1YXMA 2EKLA 4EGFA 3CEAA 3HN2A 3I23A 4S3MA 4BQPA 1AUPA 2VT2A 4OOFA 5G0TA 5IZ4A 1A27A 2FZWA 3OJ0A 4PLCA 5U9CA 3TSCA 3GR6A 3E6AA 4YAKA 1LDMA 3GEMA 1LXCA 1GR0A 3FWNA 1E7QA 4JJFA 2DC1A 5F1KA 3D5TA 3H7AA 1U2DA 1IB6A 1P1FA 2O3JA 5ER6A 3KSDO 3INRA 1HEUA 4TRJA 4ND3A 4Y98A 1EE2A 4IXTA 3WQRA 4E33A 1EK5A 3UW3A 4Q3DA 4M8SA 1O5IA 3DZGA 3LC2O 5F1OA 1UR5A 1I30A 1QXSA 2V7PA 4XIYA 1YB5A 4CQMB 1DOHA 2HK8A 3PFWO 4I5GA 4OKIA 4ZICA 8LDHA 2BF7A 1XLTA 1Y8RB 5T57A 5AVOA 3GEGA 1HE3A 4B7CA 4BKPA 2WE7A 4CV3A 4BO7A 4IS2A 1QYVA 3GPIA 5HWSA 1RM0A 4ND4A 3M6IA 2OP1A 3W1VA 1VI2A 1Y7TA 1R12A 4BNZA 2WSBA 3BIOA 4MJLA 1GL3A 2DUUA 5LC1A 3PYLA 4TQGA 3FNEA 4CM3A 4J0EA 2DTDA 1IHXA 2AXQA 3KEQA 3OA2A 1X7HA 3IKTA 2VRBA 5IXSA 1VPDA 2Q2QA 1QYDA 1YJQA 4DPMA 3F9IA 4LK3A 3NYWA 4Z9YA 3NGXA 3QP9A 3W6ZA 5G0UA 5IZCC 2BRUA 1VLLA 4CMHA 4ALLA 1UXIA 4CMIA 1PL6A 2VTEA 1B8UA 3R1IA 3WYBA 1J0XO 3I6QA 4JBGA 4PFJA 1PR9A 2W4QA 3B70A 4IBOA 4ZQEA 3BHMA 5I9LA 2HMUA 1ISMA 3W8EA 4P8RA 4RJTA 4XYBA 1TT5A 1IL0A 4BNWA 1V6AA 1C1DA 3DO5A 4B3IA 5DOZA 1WP4A 3JQ8A 3JQ9C 4R51A 2WEKA 2HMSA 3P19A 3GC6A 2NTJA 3DMTC 5B12A 2RHCA 1LDGA 4NNJA 3GDOA 4HFMA 3P5SA 1B2LA 1N2SA 2VYNA 4IJWA 2HMWA 3C85A 3PPIA 5CPFA 4BO8A 1XEAA 4FPXA 4OAQA 5F1PA 3ICCA 1DIBA 3AY3A 1HETA 1B7GO 1KVUA 4OQZA 1D3AA 2RBEA 4N7RA 4RF3A 2Q45A 4O5OA 3BHJA 1FDVA 2RCYA 5AXCA 2O3RA 3HDYA 2ZYAA 3AOEA 5HRUA 4XDZA 4D0SA 2QIOA 3FNHA 1JA9A 2Z5LA 4QX6A 2GRAA 1EVZA 1HDYA 3FF4A 3U4IA 2ZK7A 3GRPA 4PLVA 1BXKA 1HDZA 5TRTA 3MJ4A 6ADHA 3UVEA 4TKMA 3FSRA 1UUFA 1WAMA 3WFJA 2GYYA 3L6DA 1CDOA 3RUHA 4CM4B 1H6CA 3HADA 5L7TA 4CM8A 4RO0A 2VWHA 3TN7A 3GAFA 4C7KA 2Q1SA 1Q0LA 4UVGA 3OJFA 3TNLA 1KVQA 1I3LA 2GUGA 5JE8A 1BXZA 1NHGA 1XSEA 3LYLA 3T4XA 1J6UA 3NDRA 5JDCA 1ADCA 3PVZA 4ND2A 1LC3A 1ZIDA 2IRWA 3I3OA 5A02A 1N9GB 1ISGA 1YONA 3DR3A 2J3HA 2J5QA 4OKNA 1O94A 4CLHA 2Y0DA 4WE3A 2HQ1A 3WJ7A 4BNHA 1MB4A 3ZWXA 4INAA 3HWRA 1MG5A 3GNQA 1NAHA 3EHEA 3JQFC 1C1XB 1DBVO 1Y1PA 4N5NA 1LUAA 4ZD6A 3PIDA 5FYDA 4IM7A 4LSMA 4ZQFA 4KWIA 4II3A 3GT0A 2PKRA 4FFRA 3QWBA 4GAEA 1LJ8A 3BMCB 1MFZA 1E1MA 2UYYA 1Q0QA 2RH8A 2Y1CA 4K6FA 3WWZA 3ZU2A 4CQLB 2GLXA 3ROPA 3H3JA 3VOSA 1YBMA 4DYDA 5JDIA 1I5RA 2PR2A 3I83A 4IZIA 3IUSA 4IDBA 4E2YA 1RM5A 3EK2A 1YJ8A 2F1KA 3RQSA 4BV9A 1ZKMA 2B4TO 4IQ0A 1HRDA 4FJ0A 2EEZA 3UGKA 4OL9A 1I36A 1QYWA 5H83A 3WGOA 1PGNA 3E48A 4N18A 3PDUA 5DCYA 4EJMA 1ENOA 2J6IA 5JO0A 2P9EA 3GFGA 4HY3A 1BG6A 1X1TA 3QLJA 3WLEA 3K96A 3MEQA 4IY1A 1LLCA 1UXJA 1WMBA 1XWFA 4RVDA 1P77A 3D4OA 2PY6A 2O3UA 3F46A 4B4VA 1XG5A 3U4HA 3JQDA 4IDFA 2XOXA 3DXFA 1HZJA 4NU5A 1VJ1A 2Z95A 4CLEA 4DC0A 4AG3A 1A9ZA 1DIGA 5KOIA 3GQVA 2GDZA 4ZN6A 5I9MA 2P91A 4PRLA 1JLLA 1C3VA 2X4GA 3NDIA 1EFKA 3DZKA 3DL2A 3H5NA 3MJSA 1LLDA 2VYVA 4FIZA 2VRCD 5CG2A 2DM6A 2NLOA 1V9LA 2I9PA 3LT0A 3PEFA 5K0ZA 3KBOA 1IZ0A 3ROQA 2DTEA 3WFIA 2XF8A 2P4QA 3ASUA 3JYQA 4ALMA 1WNTA 1E7SA 4J16A 4ALIA 3ANLA 2CD9A 5C7LO 1Y9EA 2NV6A 2O2YA 3EVNA 1T24A 4YT8A 1NQAO 2O50A 4XGIA 3WWYA 3E18A 1GV0A 1ENPA 1GYQA 4RQUA 2JD2A 1ZUD1 5HTOA 2WMDA 2TMDA 2BELA 1IOLA 4CM9A 1J49A 2V6BA 4FFMA 3G1TA 1PQUA 1GFSA 4WNCA 3VAZA 2AQIA 2QQ5A 4K28A 3ZGYA 4A73A 5U1PA 5KVCA 2B4RO 3A06A 3RUFA 4J2OA 1GZ6A 3AOGA 1O8CA 2O48X 3D3WA 4NQZA 2DPHA 3EZLA 2W2LD 2GN8A 4FDAA 4J90A 4PG7A 1E3IA 4BNGA 1V3UA 2UVDA 4E2ZA 1JN0A 2VWQA 2GGSA 3V8BA 5I8WA 1ZK2A 4FR5A 5BNTA 2B69A 2FPIA 4PG4A 4YEDA 5A4DA 3NUGA 1Q2XA 2X5OA 4PZCA 1D1TA 4PGFA 4RPLA 3L4SO 5JC1A 3KSZO 2W8ZA 3IMFA 1T2EA 1X13A 2C54A 3OIDA 2WD7B 4QXMA 3HB4X 2EKPA 4Q9NA 5ILGA 2B0JA 5B1YA 4O6VA 2LDXA 1YWGO 4NIMA 1HSOA 4NZ9A 2RAFA 1QLHA 3GRKA 2Y99A 4MIOA 1F06A 1EUZA 4WOKA 5A3VA 3QRWA 2E48A 2BFAA 2VQ3A 1WPQA 4FQ8A 2JD1A 2O23A 3ZWYA 3GVIA 4IQ8A 5KVVA 1RM4A 1LLUA 4YJGB 3BMNB 4D3SA 1PGJA 3VDRA 3D64A 1UXKA 3RBXA 1VE9A 2Q99A 3EAGA 3KV3O 1T2AA 3GNSA 1W0CA 4TWRA 5GZ3A 1GPDG 2P68A 2PKQO 3PGXA 3GMDA 4QTZA 4A0SA 2HDHA 5CEFA 1R16A 3DFZA 1JVBA 2DVMA 2Q50A 4XRGA 4YVFA 1ORRA 4ESOA 3WGQA 2YHIB 1GD1O 4EDFA 4ND1A 5KNLA 4CLOB 1DXYA 2POQX 3ZWNA 3WB9A 3ZU4A 3FPLA 5L51A 1B16A 4YT2A 2J8ZA 3CSDA 2PZKA 1O9BA 4WECA 2OL4A 4ZGWA 2G82A 2PV7A 2I3AA 5BSGA 2VYVD 4FOSA 4TSKA 2IXBA 2GERA 3TOZA 5KKCA 3GVHA 3AI2A 1HDOA 3F1KA 1RYDA 3GDGA 3HB5X 2X0RA 1YL6A 1SAYA 4Q3BA 4R4JA 5AXDA 3ETEA 3K92A 5BSHA 3WIDA 3C7AA 1E92A 4CUZA 1BW9B 1BVUA 1T2DA 2CUKA 3B1JA 3RKUA 1HL3A 4OQYA 1RM3A 4CM9D 3G49A 5FF9A 3I9LA 3GHYA 3TRIA 1EUCA 1A9YA 4XEHA 1PJ2A 1N92A 1VKOA 8ADHA 3H2ZA 4MKRA 2PZLA 5DF1A 5IF3A 3U49A 2YHIA 1ZK3A 3VPXA 4NFHA 4L74A 4WK6A 1X14A 5COBA 4BNFA 3L77A 4S1VA 5I7FA 1N7GA 4J2HA 3SXPA 4WNIA 4JROA 5G0SA 3V2HA 1W73A 5F3RA 4WCFC 2ZYDA 5IN5A 5DBIA 4R68A 1S7CA 4WUVA 1KYQA 1Z45A 3ONFA 5T8KC 2ZTMA 3SVTA 3OEWA 3HDQA 4BGVA 4X54A 1LQUA 4MDHA 3RROA 4DQUA 2O3TA 5G4LA 3RC9A 4XYGA 3Q0EA 5CPBA 3MZ0A 4ZQBA 4CQMA 4LSWA 3AW9A 4J4TA 3I6IA 2HKIA 1GQ2A 2OBNA 3FN4A 1LI4A 3U0BA 2BFPA 4EUFA 1K89A 2FY8A 4I5EA 3CIFA 3OP4A 1A72A 1GADO 1NWHA 4BNYA 4D3DA 1ADBA 3D0OA 3KYBA 1L7DA 1GCOA 1PGQA 2CZCA 2JHFA 2EW8A 3GUYA 4UUMA 5BNFA 4YQYA 4UVHA 4E5KA 1T1RA 3ZCXA 1ZEJA 5K6AA 3WTBA 1ZO8A 5IAAA 1NAIA 1B15A 2WYVA 3WG9A 2CVQA 4UREA 3M2PA 4E13A 2R00C 3WYEA 3AUTA 5JAQA 3JQ9A 3ZN2A 4E5YA 3QQPA 1JVSA 3FWZA 4AJIA 1E1LA 3HSKA 2PGDA 1DFIA 3D5QA 3ITKA 2HLPA 4MP8A 1OBFO 1BW9A 1F8GA 2BI7A 2GZ3A 3UKOA 5KVSA 2BGLA 1BSVA 4WKGA 5F5NA 4TROA 2GN9A 1GUYA 1PJLA 3K2BA 2HMTA 4MVJE 3AU8A 2GPTA 1UP4A 4BNLA 3GK3A 1WMAA 3F6YA 1YDEA 5G4KA 2EJWA 4CLOA 1E77A 3JQFA 2YUTA 3ZHXA 3K31A 1DLJA 1YO6A 4R9RA 4BS9A 3GVPA 4O1MA 4D7AA 4E3ZA 4RVSA 3EC7A 3KVOA 2NWQA 4H15A 5JCJA 4BGUA 1ULSA 1P44A 4BNXA 2RH4A 1YRLA 3L0DA 1NVGA 3DOJA 4DXHA 3IL2A 2AE2A 2HRZA 5THQA 4UVEA 1DIHA 4QUKA 1Q0HA 1DB3A 1UDAA 4R1NA 4NG5A 3VPGA 2CVZA 4L76A 4I9NA 4IDDA 4J9VA 4XD2A 5EMHA 1UDCA 2P2SA 3IKVA 3QE3A 4YYZA 2JHGA 1JWAB 2HO5A 2ZTUA 4LGVA 5C3MA 1NX6A 3GMSA 4J7CA 4FN4A 4IIUA 1E3WA 5JAIA 3AUUA 3I4CA 4URFA 1PR3A 2A4KA 2G0TA 3DBRA 3GN1A 2ZQZA 2C5EA 5MGBA 1GCUA 1UH5A 3TL3A 3DB2A 2DQ4A 3JYNA 1MA0A 2CNBA 1NQOA 1O0SA 3EVTA 4HXYA 4P4GA 3RFVA 7ADHA 3ETGA 4MP6A 3L4BC 2X86A 5COAA 2W98A 3W6UA 3DHNA 1N1GA 4DIFA 4DWVA 2UV8A 4PG5A 4E21A 4BO1A 2PTGA 4NH4A 5T6BA 1Z6ZA 3UCXA 2DUWA 4FCCA 2Q4EA 3O4RA 1IHYA 1E3EA 1ADFA 1GZ4A 2OMEA 4NJMB 5JY6A 2PNFA 4ITUA 4A2CA 4WLEA 2Y0EA 4MVJH 4U7WA 4F6CA 5HS4A 5EJ2A 3SJUA 2UUPA 4BVAA 5IJZA 3AUAA 3WOHA 1EDOA 4KUHA 3U09A 3Q11A 5ICSA 3H9EO 1Q1NA 4J4HA 4WASA 3WS7A 3B1KA 4GX0A 3V1UA 2ZATA 2EIHA 2JAHA 4LN1A 3DAGA 1EBUA 3IAHA 2R2GA 3KHUA 4L73A 3WSWA 4FFNA 3ZV4A 5L7WA 3U5TA 5I7EA 3DBLA 5TGDA 3KYCA 3F47A 4M1QA 4BKUA 2YZ7A 1ZEMA 5EERA 2PH3A 5JMPA 1DAPA 2GN4A 1YVEI 3CMCO
chains in the Genus database with same CATH superfamily
2V7UA 1HI9A 4CF4A 4XPZA 2HJ9A 1WP9A 4QLOA 2IZ0A 2CLEB 2YDYA 1TLLA 1UAGA 4ZV9A 3LSYA 3OOJA 1WNFA 3LLUA 2W6IA 4QEKA 3U3JA 1TA4A 1SKYE 4E0BA 5BSFA 3AETB 4BX9A 4GE0A 4N4AA 1U0TA 4JLJA 1EFVB 1XDWA 5DCLA 3S2EA 5DHSA 3FB4A 5AJZA 2WPDA 4J0JA 4UHKA 1A8IA 1IDOA 1VKJA 2W22A 5C81A 3PLAE 2CHUA 4D43A 2FF7A 1GQYA 1CJVC 2X8AA 1UMBA 2H31A 5AM1A 1KFKB 1V2HE 4LXYA 3R3XA 4OHPA 4BIIA 4NBKA 2C2XA 1CEYA 3OTOB 1JLRA 2Z83A 3C16C 3VV2A 3QNUA 2QKYA 3IO3A 2V1XA 4GXTA 1H2BA 3O2JA 3WGZA 5KYYB 1BCSB 2BISA 2I3GA 4KDRA 5H81A 4Q37A 4TWAA 3EQZA 2WF8A 4TWZA 2B3TA 4EKYA 1C0EA 2IZ6A 2Z5VA 3CWZA 3GJ8A 3NB0A 2GEFA 2VF8A 3JD1A 4Q9JA 3KAPA 1FVOA 4P1ZA 1ZY2A 1T2CA 1XXHB 2QMOA 4DYHA 3NCHA 2A5YB 3OWHA 3VYUB 5CLJA 2FXVA 3B5JA 4FFBB 5EZYA 4DBVO 2Z9DA 1TLFA 1QHNA 3JS5A 1FPQA 2VZ9A 1S3FA 2C99A 1KOFA 3H9JA 3SR0A 5C8XA 5DPMA 3WB0A 2AX3A 3K4PA 2ORIA 1DJMA 3CNQS 1IUPA 1CEEA 4M1MA 4BO2A 1NQTA 1WDWB 2QJRA 3CX3A 1P1JA 3GLHA 4NBTA 2ZAIA 1N25A 1QO9A 3C7TA 4RA6A 3W1EA 3ZVRA 2EGHA 2QU8A 2OC4A 3P26A 5D85A 1WE2A 2CZQA 1ZESA 4IGKA 3U6KA 4RTNA 3LPNA 4I50F 2XA9A 4P54A 1ONPA 2JFZA 3KKQA 5FTJA 4JYAB 4JI3B 1WX1A 1WXGA 1V4NA 2GO7A 5JNRA 2H8GA 2ZI9A 4IHJF 1BXGA 4QA9A 5EUMA 4P83A 3WK9A 5JJ5A 1JJIA 4RYLA 2ZBUA 1TCUA 3BSSA 1F8UA 2FZVA 2Q41A 3NJ4A 1Z06A 1EQ2A 3JRNA 4G0QA 5FDFA 1NVMB 1QCZA 3OOSA 3HYRA 5BRJA 1RHMA 3IDZA 3F1LA 5FUVA 2BONA 2HTEA 4ZYYA 5A1TA 3FBWA 2NUTA 5IUJC 5K3EA 2F55A 4TXLA 2DLCX 3S44A 2XOEA 3LUGA 4RK1A 2P2GA 2VHVA 1JNXX 3OLZA 2G71A 2HGSA 3GCWA 3S6JA 1ECJA 2O0KA 3RLFA 3DOIA 4ARZA 3OUZA 1PZGA 1F4VA 5JLJA 1JL3A 1JTEA 1ZD8A 2KE5A 3JVIA 4DG9A 4RE5A 4ZVRA 4DVGA 4MVJA 2RBGA 2QTCA 4I81A 1PYDA 3T1YB 3ZGVA 3KETA 2DECA 3EJWA 2PZJA 2E5FA 4GYWA 2JK1A 2QQGA 2R8ZA 4HQ0A 4M0EA 1AOXA 4TLMB 3SX2A 3JU3A 2WKQA 1QGAA 1DJQA 5K3OA 5EEHA 3RR2A 2E55A 3OY2A 1Z2PX 3EGWA 3A4YA 1HZZA 1PQPA 3KZOA 4KEAA 4N3NA 3O84A 3N2EA 4GR9A 4QYMA 4Y2JA 3SBEA 1QGZA 2HWUA 4ZEWA 5FV4A 1V48A 4ENTA 2C3YA 3ETCA 5F9MA 3B6EA 2EG9A 3R3ZA 5FWYA 1BRTA 2P0EA 1E5LA 5EMMA 3I8XA 5K01A 4PYIA 4CQNA 1TTPB 1K0UA 3IVRA 3M81A 1A5TA 1C8BA 4O2BA 3FPJA 3IPCA 4QPDA 1ZOIA 4LXHA 4M9QA 2XXAB 2W48A 1NXTA 1USVA 1JKJA 1H22A 1JQ5A 4RV5A 1JLHA 4A82A 1PU2A 4X85A 2FWNA 1K2WA 1G6KA 2O6HA 4BN4A 3Q7PA 5MDHA 2NO4A 4R05A 2Q8NA 2FZKA 5J4KA 4S24A 2PKWA 5JNVA 4BLWA 2WJIA 1FYXA 3NT5A 5BUQA 3PEEA 3QY9A 2Q4RA 3BMOB 3DKIA 3CTPA 4FDMA 5JY1A 4A27A 3WK5A 5EY5B 4BQIA 1TJ5A 1JG2A 4B3HA 3K8OE 2JIRA 1G2PA 1MB9A 1VKHA 2I4OA 2NPIA 2VDJA 3DBLB 3DBRB 3R44A 4MARA 3W04A 3ZXYA 3JZFA 4G01B 3G13A 1IYZA 2PZGA 5JFTA 4JGGA 5EJ4A 3HXTA 4L8YA 4ENPA 1USUA 1RJWA 1YAJA 4Q3LA 1G7RA 4YAEA 2ASEA 5B2EA 3EC1A 1R9NA 2AR0A 4I6JA 4RK6A 3ZE8A 2MOKA 5EIAA 3MCVA 1F17A 3SEQA 2C4TA 1NR7A 3PX3A 5FWAA 1QKIA 3TTSA 1YQEA 2XCUA 2PWPA 1WDTA 2DBYA 4HQNA 4ZTBA 4DA9A 5EHZA 2UUOA 3QPVA 1JH8A 3WQHA 3HYLA 4K6MA 3GFVA 2P3QA 3PCTA 4IIGA 4DUPA 1Y6RA 3OIWA 3VU0A 4LY3A 2AHOA 1OIXA 2P9QA 5EJGA 3KFXA 3PTZA 3F4KA 2UAGA 3ZIUA 4ZAYA 3T1OA 1HKUA 3BC1A 2AKEA 4O25A 3TSYA 5KVAA 2V6JA 1S8OA 1XNJA 3RIEA 1BCRA 4G41A 4RCYA 1XDZA 5BT8A 4JWKA 1Y6QA 1P1RA 1W5AA 4PAWA 2E4WA 1WM1A 1TTQB 5CBKA 1BXRB 2IH4A 1XCOA 2VZEA 3PEWA 3PIIA 1VMIA 4ZVMA 4BO6A 1P61B 4XFJA 2A1TR 3IBYA 4QAJA 4TMVA 2ZTVA 3WAKA 5MN5A 2BH2A 5KWSA 4UQOA 1DJNA 4BMSA 1UP6A 1HT3A 1MO2A 1VLVA 3B3FA 2DKNA 1II9A 3DL4A 3QBEA 1SBCA 1E2NA 4F11A 3ULKA 1VMKA 3EZ9A 2PSJA 4MUMA 4WKBA 5F52A 1OB5A 2XZTA 3BA1A 3K1JA 4D4HA 4JSYA 3UH1A 2B1JA 1JQBA 2HIMA 3BL6A 1QOZA 3WVNA 5KVCA 3C3MA 1V71A 3OZIA 2CCKA 4IO1A 4JXXA 1JTFA 1UXHA 3TIIA 3UNXA 3ZYCA 2OXFA 2PSFA 4LJYA 5B5SA 4B09A 2BI8A 3EGXA 3DVAB 2IS6A 2WAXA 1L8AA 4I5FA 1W96A 5J23A 4Z0HO 4CDMA 4KN5A 3FVVA 1I94B 2ZJ0A 5HEKA 3UGJA 4RTSA 2VK4A 4OQDA 3SYRA 3IAXA 4BEBA 3RVSA 4OXXA 4CR7A 4O4JB 4F45A 1V1MA 3L4JA 4X6UA 1RW4A 2Q28A 4KN6A 4A5OA 4JVNA 4BLVA 1QFXA 3AEKA 4G1UC 4RY9A 5KQPA 4IP0A 421PA 1EPUA 1K2VN 2OLKA 3F98A 4U2KA 3QPUA 1R5NA 1FTSA 4KFSA 2HK9A 2KPOA 2OZVA 4FCWA 4MVXA 4CZ2A 4K88A 4D3YA 4HVAA 3WISA 4FS8A 1FTGA 4M8NE 3ZWAA 1FQWA 4EUEA 4YJKA 5CX1B 2QJTA 4GW3A 1S7GA 2RG7A 1S8NA 2XECA 5JAPA 5MFPA 3EULA 2HF2A 4OP1A 1DV2A 3OPYA 4QEZA 4IFBA 2A59A 5EG5A 2LCQA 2WSLA 3D8RA 1X1QA 3TQCA 5J5VA 3ZD8A 4EABA 5DB4A 2FSGA 2QRPA 4UBNA 4D4IA 2OXTA 2ERCA 4TTPA 2IDZA 1H66A 4YRJA 4B4DA 3THWA 4G0UA 2XAAA 2HQBA 4H7PA 4L78A 3RKSA 3EBOA 3GJ6A 1DKLA 3ZY4A 4CM1A 4GMFA 1E1KA 1B14A 4M6WA 2OYSA 1IM5A 2YS7A 4FEGA 1A77A 4WI1A 4CKBB 1C3EA 2F3PA 2Q3FA 4G5HA 4ZAGA 1N33B 4B4OA 3BJIC 4YRRA 3WO0A 3ZNNA 1R6AA 1C9YA 2X1MA 4CWAA 3DHVA 4N5MA 1BFKA 1GQSA 1O6FA 3GVCA 1FFYA 3OCXA 5JS6A 4KQEA 4K03A 1UM8A 3QU4A 3WNBA 2G0NA 4NBVA 2UKDA 4R7TA 5B1HA 4DNQA 3RIHA 3WIUA 1BWSA 1YJBA 1LNSA 1GVHA 1SUEA 2ZBPA 3IUPA 3BICA 4TUYB 4WKCA 1KDVA 5IN4A 3GPLA 4AXBA 5JSZB 1Z07A 3RPEA 1NW8A 2AJCA 4MB0A 4I4TF 5A05A 3BREA 1F2TA 2FPKA 1TYZA 3GFQA 2O5RA 5JD5A 1ZU5A 4IZHA 4LYJA 2FP3A 3FBGA 1W581 3CXRA 3MNFA 5DGTA 2JVKA 4ZIRB 2D3TA 2FWJA 2VHQA 2OPHA 5JJIA 2UZ1B 5FWXA 4IINA 2A0KA 3ELDA 1H9BA 5A03A 1GLNA 5INTA 5AKXA 1PHPA 1ARZA 3ENWA 5COQA 4M76B 3SR3A 3TGLA 3CSSA 1Z0AA 1OB2A 4BPBA 1YNSA 5HCNA 1N1MA 3KTFA 1N2ZA 5TSDA 3TTVA 3LDGA 5JD4A 5JS7A 4A36A 2LWIA 1VL6A 2ES4A 3AESB 3GNTA 3SHVA 3X0DA 4Z6KA 3E4DA 4ZODA 4AS3A 1MCZA 3ON5A 2C9MA 5K7SA 2PZAA 4DLBA 3K8YA 1U7WA 5EQTA 3VKUA 2PRJA 3F5MA 4TTAA 3HR8A 2VNHA 1N8SA 4ZANA 1EJ0A 1GZ3A 1TA0A 1TDJA 1WDLA 2EKBA 2FFAA 3KUUA 1CR2A 3TJRA 4MMZB 4AW9A 3K73O 3PUHA 1U8YA 3I1JA 1KFBB 1B1AA 2PRZA 2BKVA 3JWEA 1JB1A 4XJVA 1PZHA 4ZAZA 3W0LB 5KTMA 2I76A 1QH0A 4L9AA 4L4ZA 3C1TA 4YUVA 1MFPA 4GZMA 5EMLA 1NPDA 1ODFA 3ZLBA 1BH2A 1M2OA 5FBWB 3VZQA 3BAFA 2HA3A 3AWIA 1I7PA 2OFWA 5DNDA 3UMVA 3ZK8A 4PIMA 2ACEA 4LF7B 1RQNA 2Q9UA 2QOEA 2V98A 3ZDXB 3G7UA 1GZ5A 2BR5A 2R47A 3GFFA 3R5FA 3JQ6A 2QQ0A 3T54A 3EQ2A 5CXXA 4EL0A 1BX1A 2GPAA 3QKUA 1YA6A 4DPLA 1YU6A 4Y6SA 1NVWQ 1XQYA 3PGKA 1OT3A 3UMJA 3GUUA 1I9CA 3RRJA 2DEUA 1PR2A 1QK4A 3OTWA 4MI3A 2EP5A 2IUYA 2OENG 3IOYA 3P45A 1G5TA 2ZROA 1XJWA 2AJDA 1EXNA 3W2FA 2XXAA 4F2PA 2GZSA 3BSFA 4XUDA 2DJ5A 2F1HA 1VBFA 5DI3B 4YXWA 4F46A 4LBYA 4LZPA 3AM3A 2KYRA 4MINA 4Q9KA 4ZHQA 1N77A 2NVBA 1X7ZB 2QLTA 3FCAA 3RRFA 1BKYA 5GOZA 4XUGB 3GARA 4XQ9A 3LGSA 4HFNA 3NAQA 3WLQA 2JJ1D 4BO9A 2TECE 4BVBA 2W6ZA 2GILA 5BSMA 4DQVA 4EJSA 5KWJA 4DDKA 4JT8A 3C0KA 5FBQB 1X9GA 1XAJA 2VHEA 4N65A 4OUDA 4POAA 4JI6B 4LRYA 5C1BA 5DM2A 4R2LA 2CLFB 1UMCA 2XD4A 4YP5A 1EDBA 2GZ1A 2YQ5A 4JP2A 5HKBA 2O7SA 1QO7A 4G36A 3UKJA 3H0CA 3TLXA 1YVUA 3OT1B 5GY7A 3Q5GA 4JCOA 2IOQA 1JFRA 3I28A 2Z04A 5IKXA 3NHAA 4IHAA 2OCAA 3NG1A 1AMOA 1VLHA 3NDBB 3PENA 3EVAA 3ZWBA 3T5PA 4R9VA 1Z38A 4HYEA 2YWRA 4FTWA 5EKSA 4Y6LA 4DLVA 3ZDCA 4ZRNA 1TJ4A 2BM8A 1QQBA 2XB9A 4DQXA 3KL2A 3WB2A 4XARA 3QVVA 3UCEA 1X1DA 1GKKA 1Y37A 3S99A 1C14A 1U0EA 4GLLA 1X2EA 1XXHA 3WLOA 5CDYA 4TUYF 2NTVA 4LZZA 3D3QA 5AI6A 4QM6A 2ATVA 3AU9A 1KWKA 1O7JA 1PEKE 4PFKA 1FP1D 1AXGA 1G8SA 3BB1A 3GT7A 4LRUA 4UAJA 5HZGA 2PLNA 3DZBA 5CH8A 1U2ZA 4KQHA 1KEVA 4XYMA 2JFPA 3OCUA 4XB1A 3TNJA 3TZ6A 1UC8A 3BF7A 3ZV5A 4QUAA 5DULA 4B3RB 1F20A 4OSEA 4E51A 4GMHA 4IWNA 2QVXX 4D4LA 3O8CA 1GNSA 4OQQA 4ZMRA 4IUCS 4GDFA 2O3SA 1U94A 1UPFA 3IGFA 3JQ7B 3FTFA 3O91A 2BEKA 2WU1A 5GJVC 5HQTA 2VF4X 4Q3OA 5ESXA 1I2DA 1GLVA 4O8CA 2BSQA 2X19A 4IF4A 5JSFA 4KQWA 2AI2A 1ENZA 2W8BA 5DGCA 1WXWA 1D1SA 1RCFA 1VTKA 4PSDA 1PS8A 4I8XA 4TV9F 4JOQA 5A5GA 2HHJA 1QFZA 2J9GA 2P27A 3WXMA 4D9EA 2GN0A 3R5KA 1DWPA 4YA6A 3A2LA 1TF5A 1U8FO 5IBQA 1NGSA 1YVRA 1Y3AA 3FW1A 3GFBA 4D81A 3P2YA 1QP0A 4WGGA 2BGWA 5HF5A 3LCJA 3DOFA 4RJIA 4DKXA 1O96B 1QPGA 1BRMA 2G1AA 2Y0PA 4DY4A 3GPDG 1A69A 1XWWA 3A9UA 1CZLA 4UZFA 2FEKA 2VPQA 3DTTA 3BPSA 3H8VA 3RWOA 1TMGE 1E1CB 3HACA 2HGZA 2WYIA 3AEYA 3CEJA 5CX4A 3RHZA 4JH0A 5EIHA 1G291 1WR8A 1YNOA 2WG1A 4JI7B 3D6MA 5AJTA 2X0FA 1TM4E 1UXOA 1ZMRA 2PMCA 4I4LA 4XVCA 1MH1A 2G9VA 1AN0A 5F12A 3DMFA 1V7CA 3VKWA 3W2EA 1OPXA 4M3NA 3LRXA 1AKNA 2QX7A 4X1IA 2VK2A 3DNMA 1SB8A 5JNUA 2VBCA 5KNBH 2IBSA 1SVOA 4U39A 4H1TA 1BMQA 4TZ6A 1JEEA 2XZDA 3B3AA 1QORA 2C4NA 2HA0A 3KOUA 1HTTA 3IC5A 3L7CA 2AFHB 1J2UA 4ZCLA 1TADA 4ZAXA 1H6BA 2IH2A 1NW7A 1JMYA 1B00A 1U0GA 4CNBA 4DA0A 1GP2A 2C98A 3B5EA 3QUBA 4B43A 1ZNZA 5TF4A 4YRMA 2H2HA 3DMGA 4HYQA 3F4LA 2AR7A 2I80A 3P9KA 4OHFA 3PUVA 5EQDA 2Q5HA 4CTJA 1QX3A 4GNKA 4FCVA 3K2EA 3JQGB 3LY7A 1V35A 3IUEA 4PONA 3WL7A 3GPBA 1DMSA 1MX3A 4QDTA 5JQWA 5JZSA 4RADA 4X7BA 5A4MS 2D62A 2DFNA 2IEDA 2WTAA 4YJHA 2Q5IA 1U8CB 1U0OC 3T15A 4A2QA 5KZMB 1CSEE 3CLRD 2Z3ZA 1D03A 1Z5WA 2JZCA 3HYNA 3NZEA 3R24A 4K9QA 1PK7A 5LL6P 3CY6A 3TAUA 5EP3A 2IIVA 2NPOA 3AF4A 5B6JA 4UMEA 1D9ZA 1Z7EA 3OFVA 5L3VA 1XZLA 3KEGA 4RQTA 1EFTA 3AHCA 4ALJA 5A6VA 1I7SB 4QSHA 2XWJI 4L5BA 1GRNA 3QVSA 3OICA 4NNPA 4RHUA 4RPGA 1GAXA 4CR8A 4Z7NB 1R0RE 2P1DA 4XDGA 4M21A 1Y1TA 4X1KA 1E6WA 3EFBA 1IEQA 4YS6A 1NP3A 3FGOA 5AJYA 1FUEA 2XDQB 3RTGA 2FLWA 3TINA 2H7XA 1C8VB 5ARCA 5WRFA 1CETA 1F51E 2ZRMA 4W1QA 2B2NA 2JJ2A 4PX2A 2VG8A 1UFOA 3BDAA 3PEUA 1NVVQ 1YK0A 1ZAKA 4G8DA 4MVCA 4RVCA 2X0EA 4F12A 3RBAA 2IUTA 2XRMA 5TQ2A 4RAOA 2ZDHA 2CJPA 5HOEA 2BH9A 4JLAA 4YC7A 1XDDA 2B8TA 1M6WA 1X80A 1NIJA 1L5YA 4TQAA 1XJ0A 3K53A 1CS0B 4E30A 5JBNA 4RIIA 4WOBA 1RVV1 1V25A 4OJTA 2DZDA 4E4YA 1OKKD 3B2NA 3EDCA 2IYYA 2WTBA 2GBGA 3MMZA 3PC8C 5I4IA 2I62A 2PKXA 3MJEA 1ZCBA 4O2AF 5JMPA 1W4ZA 3TWOA 4CL0A 2F17A 3LXMA 1W4CA 2ZYHA 4M0DA 1F5NA 2QRLA 4M38A 1AE1A 1P75A 4QD3A 1SUDA 3UXYA 4W9NC 3V2UA 1BX3A 3Q85A 3DXZA 3KELA 3JQ8B 1PYOA 4UEKA 3E2IA 4XLLA 1NNI1 1E5TA 4M22A 3DPUA 4RGYA 3JV7A 4WK4B 3W4IA 1AC5A 1C81A 1GZ7A 1H1LB 3HJUA 1MHPA 4XWAA 4LF9B 4CUJA 3M82A 1QIIA 1PSZA 1S9HA 2YJNA 4WK0B 1VZ3A 1ISFA 4X71A 1AGRA 3ESBA 5HGJA 1F3OA 2JLYA 4FW9A 1LW6E 2X4IA 2WOJA 1OLSA 2OAP1 3PD7A 2BDTA 3MT9A 4J76A 4Y1FA 5D86A 4NPHA 5DEOA 4ZHQB 3HHEA 4MZXA 4FBMA 3LQ2A 1TJYA 2BPOA 3IP9A 5I3ZA 1G8MA 4JR1A 3AXTA 3PQ2A 2P6OA 4RZIA 3W8NA 2YWCA 4LRSB 4ER7A 5CAEA 5JTTA 4MHSA 3DOCA 1PJBA 1IN6A 1G2QA 6LDHA 5KNDH 3WSVA 3CB4A 4Y1GA 1G6HA 3QX9A 1QO0A 1G3IA 4H3HB 4HDSB 1JHYA 4EFKA 4MTCA 3USES 1TFRA 1YZTA 2VH5R 4NCIA 4D9FA 2Q5LA 2IPLA 4FMCF 4RORA 2IYSA 1EFRD 3EVEA 4PSVA 1IBLB 1O94D 2HPVA 3IOCA 4DUZB 3I2JA 4OI0A 4N8EA 2H06A 1EXDA 1LF5A 3CRRA 1UT5A 1DBPA 3C6MA 4JP1A 2JIZD 1DT3A 3AIKA 3D3KA 4BB9A 4BWVA 3WRYA 1NP7A 1ATIA 3PJFA 3B1WA 3TLZA 2HX1A 2OD7A 3ZZUA 4BWYA 4DMFA 2XUPA 1A9XA 2P9HA 3MBOA 1TEZA 2HUPA 1R0BA 4X45A 1TO6A 1YJ5A 4ZCRA 1GL9B 2Y1KA 4NU6A 3M3DA 4NXNB 4C7OB 4K1LA 4OEHA 1Q44A 1M2KA 2I6TA 5F4BA 3SLGA 4PHHA 5JW6A 3FHLA 1JBQA 5K3AA 1GXSB 2EBHX 3KB6A 3CCFA 5REQA 4YP0A 1ORWA 3FZQA 5FOSA 2A94A 1KYWA 3CF4A 2P3SA 4QT4A 2CL7X 3MAGA 4AFNA 3DO8A 2A35A 3JX9A 3EXEB 1C9NA 1M1UA 4TKVA 5F3WB 5DDIP 5L7YA 3O21A 1WVGA 4C78A 4ZGWA 3H5LA 4ZA2A 1QR6A 2I6FA 4BY9E 3TAXA 4I99A 3FDXA 4JYMA 3MAAC 4AP9A 2H1CA 2VPIA 3TG8A 1TCBA 1M72A 1GEEA 4AVYA 5LU9A 1SRQA 3PLNA 2MMGA 4JBNA 3RRXA 3VXKA 3ZBQA 3MFQA 4OQXA 3UW1A 5IMBA 2B37A 4PHGA 8ATCA 1KHTA 1EJ2A 2C4WA 2VOJA 3FWKA 1L3CA 2W2LA 4IVRA 3L40A 1XVLA 1N4AA 3RUCA 5K20A 2VDNB 1Q12A 1Y63A 3DE4X 3CRMA 3SEFA 4G5OA 3MJVA 2H0QA 1P72A 1LB1B 3JD0A 4QGBA 3NFYA 4UU8A 5JCOA 4C43A 3F5DA 2Z56A 2J4DA 3OF3A 1U7DA 2J9XB 4OLBA 1STOA 2GWRA 4U7GA 5HJEA 2FMUA 1XVTA 3AIMA 3D4NA 5C8ZA 3I01A 4BX3A 4AKHA 5TIIA 4PYKA 4HYYA 1LSSA 1XX6A 1E8DA 5C18A 4UTVA 1MOQA 2J9FB 2F4VB 5L3SA 3ZHBA 4HGYA 2AA3A 3T7JA 1LNQA 1NONA 2QR5A 2WABA 2WSSD 2L0XA 2XPCA 3GZNB 4Y9DA 5IWAB 2GF2A 1D6NA 5E9AA 1BS2A 1SK9A 2Z1NA 5FR2A 2H5JA 4ND5A 4EI7A 5I51A 2O8DB 1FXUA 4MW9A 3AJRA 2Z4TA 2KMLA 4WKNA 1AKEA 1YB4A 1VGRA 3LOPA 3ASVA 5FR1A 821PA 2WAOA 2MR6A 1E96A 1QYCA 3L6OO 3P20A 4M1YA 4UNRA 2WB2A 4RLSA 1XF9A 3FTNA 1ZD5A 4NBRA 3W79A 3URKA 4QM7A 1NJSA 3C3DA 1H6DA 4NR0A 4C4ZA 2A9QA 6AT1A 4XYLA 3V3KA 3QHQA 4ICIA 4GLOA 3DDSA 13PKA 1OFHA 2C2GA 3GGDA 5IJ9A 3V8MA 1XCLA 3MMPA 1W0JD 5AUOB 4JENA 1FVXA 1NP6A 2D4HA 5BOVA 2HN9A 4HH1A 1ZNQO 5YASA 3FE2A 4V0KA 3C4QA 3STTA 4NDZA 3UA4A 1SU6A 2W83A 4B34A 1ISRA 2C82A 3SYTA 5FP0A 1ZC3A 1AKMA 3BTUA 1AKYA 4O4IB 1TUIA 3CUVA 1G7CA 1CE8A 3FNRA 1B6SA 1DCTA 2FI1A 3FUWA 3T95A 2QAGC 3I6BA 1XZMA 2HRBA 2PSDA 3G9QA 5DSXA 5K8UA 4Z4GA 3EGCA 2FK7A 4QDZA 3AG6A 5KKAA 1ZFNA 2PMEA 1P91A 1E8NA 3NHYA 3RS9A 3VSDA 4EO4A 2R6HA 4ESEA 1RHRA 1WW8A 2VCHA 3N74A 4PSKA 2FR8A 2PGOA 4MGIR 3VPFA 4GF5A 2DH5A 4QOGA 3ZE7A 2ZI4A 2UUBB 3K0FB 3HMQA 1FFGA 2CBXA 3EARA 1LA2A 2AXPA 2PK3A 4G9BA 4P08A 4OMCA 3G2JA 1IIBA 1MRSA 4RJKA 4HB2A 1SVWA 4RXTA 2X9VA 3IV7A 3O8LA 4BUCA 1RQ2A 2H2GA 1MVNA 3U1BA 1GDHA 1HDRA 2G6TA 1R4MB 1I7DA 2HV8A 3D0KA 1FBTA 3FOBA 5IRCD 1XP8A 1GCIA 1C7QA 5FV7A 3E5MA 2FSSA 3DFUA 4BXOA 4DJFC 1LDYA 3I05A 1S3IA 4R40A 2GAOA 2JGKA 1OZAA 2MYTA 4GI2A 3CRZA 1E4YA 4ZPJA 2PUAA 3GDFA 4HNHA 1MVOA 4EA8A 2E49A 3R3WA 1DCMA 3ZU3A 2YIDA 3O1IC 1QCDA 5TQ2B 2MTBA 1HX7A 2X5KO 1T2FA 1U8EA 4A0RA 1JMKC 4D1YA 4JXZA 4MV6A 1QGOA 4FI3C 1BMTA 2JJ8A 4R9NA 4Y2QA 3VU9B 2FWBA 6YASA 4GEKA 1X1AA 3SZLA 2NZ8A 2GPSA 1HDCA 3BVPA 3F6BX 4H31A 1HK7A 2JVIA 4ROTA 1P7WA 3DLHA 4IXWA 4RPJA 2Q6OA 5CIWA 2F8LA 1Q7RA 4MB6A 2XOKD 5AW2A 3RJMA 2XA1A 4JI4B 4OGGA 2W2MA 1NBHA 1XLVA 1B3BA 3PJGA 3WGHA 1KO4A 4EGQA 1N0VC 1TVEA 3WR5A 2Q07A 1RRPA 1EX6A 1XFDA 1IEWA 1Z0SA 4KBFA 4PZ9A 5ALDA 1USIA 4DAEA 3BMQA 5J1TB 4F3TA 1ZCZA 5JALA 2IEYA 5FUWA 1OC4A 3DMYA 1Z16A 3QPCA 5AHRA 5EZYF 4CL3A 1HNWB 4HO1X 2J0SA 1QAOA 4G0NA 3FR7A 4RD2A 1BFUA 4OMFG 2YYZA 4BGDA 2BEUB 4JYPA 4DCUA 2ZSJA 5DCUA 3GLFE 1QRAA 4AROA 2ZITA 1SMKA 4HN9A 3PP8A 3I0NA 1L5VA 2UXCB 5TS3A 3IDSA 3A0RB 3ZHTA 4XZ3A 1E9SA 5JD3A 3VBEA 3WDSA 1BHJA 2NO7A 4BFYA 4ZJUA 1WB9A 1WCV1 5HTKA 1J4AA 1WWKA 5DIFA 3N8NA 2OXEA 3RS7A 3O3NB 4II7A 4LJ9A 1QHYA 4NJEB 3VKGA 4LDQA 2X8BA 2REBA 5BR7A 4NDNE 2DFKB 1PZFA 3D6AA 4DR4B 3KB2A 1H94A 1TCCA 2GH1A 2O1WA 2Q0SA 1DC6A 1XD9A 2HQSA 2FEAA 1Q7GA 3GUZA 3V4ZA 2E3JA 2GTHA 3N6VA 1K98A 4ZV4A 4K9SA 3DCNA 4E94A 5BW6B 3R9XB 1G21E 2ZE8A 3QVGA 4RESA 2EFHB 2H4WA 4H3VA 3TEMA 1ND6A 1OAKA 1DEHA 2AG6A 3R40A 3FMFA 4Q4JA 4FHCA 4E88A 1L7RA 3LP5A 4Z49A 3HFGA 3BMXA 2HT6A 4JLSA 3AEUA 5IT5A 3HO8A 3OJXA 1RP7A 1AKWA 1QVAA 4X20B 1ZRSA 1U3CA 2AVDA 2XJ9A 4JITA 3VFDA 4BN5A 3PWKA 3Q7SA 5IANA 1MIOA 4F4UA 2X6QA 2QL5A 2JEZA 1YS6A 3DWEX 3Q8WA 1JR3D 3OECA 4TL7A 4TN1A 3OFND 5DO9A 1GU0A 4MJ3A 4ZXFA 4RV9A 4Z9AA 5HYVA 4E1VA 3P4UA 1V45E 2P9JA 4NL4H 5E8RA 1YL7A 1OKKA 3TI7A 2PE5A 2CNWA 3TW8A 4IIJB 2CLCX 3KQTA 2N1BA 4IIVA 4IIFA 2QJOA 4HH0A 2VS1A 3LKBA 4KSBA 3GJ4A 2PA0A 2AEFA 3ZBUA 2WZDA 1MB0A 3I72A 1VA5A 1LFAA 1L7MA 2OQIA 1K92A 2QM0A 3HR4A 5IK2D 2I6SA 3ABIA 1R4AA 4LYEA 3TTYA 2OESA 3LG2A 2J6CA 4J0HA 3EYWA 4JP8A 4O08A 2XZLA 1VOTA 4AN0A 3MCAA 1VHJA 4RKYA 3N2IA 3U7JA 5K3FA 3IUBA 1JIVA 1JQDA 2EZ8A 4IHQA 4JQCA 4YJ3B 1YHZA 1D0SA 1MX9A 3EIHA 3IHKA 4G0YA 1GNVA 3K0BA 3SC4A 2DKOA 5BW8A 1GZHB 5IEJA 2ZRBA 1FSFA 2OFOA 2FPSA 4BO4A 4LRTB 1V8BA 2F3SA 3W5JA 3WQQA 4FZRA 5A3JA 3S2GA 3SE0A 5JEDA 1XQVA 1YBVA 3T35A 1BDHA 2I8CA 3E81A 3CN9A 1UKAA 2OMKA 1P4AA 2FTKE 3B9PA 2J3DA 4QDKA 3OU6A 3PC4A 1YJAA 5DYIA 2H1WA 4E2XA 1CR6A 1F14A 1I32A 1ORDA 3VC2A 1MR3F 3CONA 3KE9A 4YP6A 4C1NA 2F1OA 4NCAA 3OEHD 3FHJA 1U0LA 3HBNA 4WVFA 4I55F 2OLJA 2H1LA 2X77A 4UEOA 4JQZA 1VGVA 2C20A 1JZTA 1TIPA 4FGKA 3O1LA 5LDGA 3JVDA 4DVJA 4N0QA 1V7PC 4QYIB 5TPWA 3NWPA 1DEOA 1PLJA 2AHRA 4UUNA 1E61A 1PW5A 3UC5A 2UU9B 1HR0B 2K6GA 4DAOA 1GTMA 1E69A 2WFMA 3F3KA 5AP9A 1JIUA 2GJKA 3MPUA 5F35A 5KQRA 2ZWOA 4CXMA 3CZAA 4OU4A 4Z3DA 1QTQA 1GG8A 3QI7A 3LKZA 3K32A 4K0RA 3D1VA 2G7MC 4BLUA 1PT9A 2X0IA 1G41A 2Q29A 1MF7A 1U80A 2QZPA 2HAEA 3I9MA 2W00A 1S01A 3ZE2B 2H57A 5BR1A 1A9SA 4QUJA 3M89A 3CVWA 3AERB 4EZIA 1DINA 2ONCA 3Q15C 4D0RA 4EUHA 4PYNA 1YR9A 1Z6PA 1TM7E 2I66A 4PLPA 4BKRA 2AGVA 2IDKA 3QOYA 4Z9XA 3SU8A 2WJ6A 3ER6A 1N6LA 4OIFA 4OM7A 1Z2CA 3FD8A 1HG0A 1JHZA 3PD0A 3C3XA 1A3CA 5CAEB 4JEHA 3H2YA 4YWHA 2ECKA 2PDAA 1CUCA 2I4MA 4CKZA 1GYPA 5LNK6 4RD4A 2II6A 2PX8A 4WACA 1OLSB 4CT5A 1YQUA 2W90A 1YH3A 2CV0A 4XR9A 1W8DA 1HY3A 2ZR8A 2ZJAA 1M0EA 3E1GA 1XIVA 4YASA 3JD3A 3KXDA 4A7PA 1LY1A 2I7VA 3HUEA 4EW3A 1ZIYA 2FPMA 2I1QA 2VSFA 3AR5A 4XB6B 1RI2A 4A2WA 1E2DA 2GD2A 3ZTYA 2BMFA 2PBLA 2ZFUA 1A7UA 1JA0A 2I78A 3B1FA 3JZIA 3OX3A 1W29A 1QV7A 4PFSA 3KQLA 4IDCA 4LHVA 1JKJB 1MEJA 4NJMA 4OOEA 5EL0A 5FTWA 2JAXA 1U0FA 3UTCA 1M34B 1I0LA 5K8IA 2PLWA 2QUBA 4K87A 1MZPA 3T7AA 1XVUA 1GGVA 2A86A 4LX0A 2COKA 2Z43A 2UUAB 1KZHA 5CXQA 1YOVA 4A10A 5GMOA 5KJCA 3HCOA 5BN3B 2V3CC 4PE5B 4C4RA 4CL2A 4TRMA 5B2ZA 1CDEA 1KPGA 2ZJBA 4BP3A 2O0MA 1ZM9A 4MUBA 4C76A 1RRMA 4EG1A 2VWGA 1DIAA 4R1LA 3T7KA 3K71B 4MUYA 5FBKA 4MDEA 4R1UA 4GI5A 2ZVQX 4NBWA 2Z2YA 5H59A 3I37X 3WRYC 1RYNA 1JDSA 3QVTA 2H8KA 2PCLA 1I2MA 5LZ7A 4AX8A 5CDHA 3ET5A 2Q5OA 2HTFA 1L4EA 3BGVA 4PRYA 1KVTA 1WEKA 4IV8A 2G70A 4P3KA 3SIWA 1DG9A 2WHXA 3CIOA 3E0QA 1VB3A 3BDVA 3COPA 3EUWA 3VHXA 1VL8A 5I7AA 2O2DA 3PQ6A 3WLRA 3H2HA 3GGGA 3OEHA 2CMGA 2AJLI 3M1IA 4LJKA 3BBPA 1PV1A 2AFRA 1SHZA 3JW8A 3RE1A 2L18A 1XU7A 1DV1A 1AG9A 4KW7A 2WFZA 4UVDA 4CIVA 4EW6A 5CNKA 3IHTA 3I2IA 3KD2A 2P3LA 3RHFA 5LN1A 4O2BB 5F4ZA 1SXGA 4ZRDA 2ZEJA 5IT9A 2OZLA 4OFXA 3F6SA 1DX6A 3EWSA 2JCGA 3PFKA 4U0JA 4YDRA 3VPDA 4AZ0A 2EF1A 4FYPA 3THOA 3QU9A 5EXDA 1RYBA 3LIIA 3TRHA 4C7JA 4TVOA 2D13A 2ENUA 1ISIA 2P9BA 3PU6A 3QLUA 2NXJA 3HJBA 5JQGF 3C6YA 3UFBA 5HA5A 4MLCA 5CYOA 2JCXA 3DHWC 1D07A 3TECE 3A1UA 1ZGBA 1KI1A 1VKNA 3OCVA 4IEEA 2WLTA 1SN7A 4M7WA 3F74A 3F7OA 3S55A 2NSDA 2X8WA 3CC8A 1THGA 2YMQA 4B3FX 1VG9B 1W0KD 1A7AA 4KJXA 4OMUA 4R54A 1YR6A 2HY7A 1U1IA 3KP1A 4Y1RB 5F7OA 5C8YB 3MTJA 1U7UA 1AUXA 1SWWA 3FA2A 1UOOA 3MWJA 4H6PA 3ILVA 1DKNA 2GHIA 4D98A 4EHIA 5A06A 2FDXA 1AGPA 4IJVA 4LBWA 3BZWA 2XWQA 1HF3A 5CJJA 4OXNA 1UMDB 4GKBA 5JHGB 2FW1A 5HE8A 1RPTA 2CN1A 3SX4A 4OQ4A 1U8AA 4RK7A 4KMOA 3L0PA 4KQXA 3T0GA 3W1WA 5SY6A 3B78A 1NBMA 2J5RA 3IV6A 3KM0A 1X74A 4E5DA 3GT4A 1UBFA 3O82A 3OG9A 4MWZA 3UFXB 3ZLTA 1UBGA 3LQ1A 3LSTA 4K9PA 1JGTA 4O02B 3OBBA 3NFRA 2JW5A 5K2OA 1Y3BE 1MAHA 3A9RA 2R0QC 1XQ1A 1XZ8A 1SU8A 3Q7RA 1SG0A 2CUZA 1XMQB 4OMDA 1LDNA 4JC4A 6REQA 1NHWA 1P4JA 2P9TA 3CYFA 5TJ9A 3U4AA 3K72B 1RT9A 5EUQB 2H4FA 3WHIA 5FUQA 4FMCB 1JBKA 4LCBA 2MSDB 1B0AA 3TZQA 1I3MA 2Y6UA 2YYYA 3NVDA 4QJ3A 1O97D 1P3Y1 5FULA 3SQMA 4UNNA 2YV3A 1HQYE 3K0KA 3NBKA 5CM8B 2G9QA 1RTKA 4QTTB 1HE5A 3FCYA 2O7QA 3A27A 4WW0A 1EX7A 3N6XA 1ZCJA 5KQGA 4YPFA 5KYGA 2PUFA 2XZPA 1JHOA 1VP3A 1NYQA 4BJHB 1EFPA 1EB8A 1ORHA 2JASA 1CLEA 2ZAGA 2N3ZA 1BN6A 2WSYB 1YU9A 4TTVA 1F2DA 4YAOA 2F3RA 3RC1A 4M0PA 4YB8A 2CY0A 2NT4A 4KO2S 2C3MA 1TF7A 3S1LA 1E2UA 1E2GA 2YY5A 4JZYA 4Q02A 4MOWA 4ZT2A 1UBMS 4UBKA 4YAWA 2M6SA 4OGLA 1CCWA 1CUGA 4G8JA 4HR7A 4JX8A 1A8UA 5HKKD 3A26A 2ZJYA 3CE6A 2YIVX 3EUAA 4NK5A 3JVVA 4B8WA 4DM3A 2O54A 2SKCA 3AR4A 2IHKA 2JFFA 5F23A 2C2YA 4I1OA 5I45A 2PHZA 1MXHA 3EA5A 3TLYA 2OT3B 4G07A 5KAMA 4C3UA 1VJCA 4RE6A 3MCUA 4DA4A 2AMVA 1RJEA 1SVSA 3O4FA 1XZCA 3H3FA 4IFIA 4KTTE 4N8DA 3JD2A 5J2UB 3U7EB 4B3JA 2GK4A 3ORYA 3QENA 2VWPA 4M1EA 2D0OB 2VAPA 4TVBA 4CMEA 1QCCA 1MC4A 1CQZA 3MUFA 3OTQA 3SQOA 1BWRA 1M2VA 1CJCA 1ONOA 3KHKA 5AKGA 4Q7JB 3AB8A 2ZUBA 4QOEA 2B4QA 2IXFA 3H4VA 3UK1A 3UQYS 3ZCSA 1LDBA 3L5OA 1BN7A 5KSOA 3F73A 4CV0A 2P11A 3W2TA 4WESA 4R0MA 4XD7D 2YASA 3I58A 1R00A 3CBQA 1BQ4A 3DDCA 1U5BA 3Q7TA 4ZDJA 5G40A 1UMCB 3SSNA 3JASB 2VHTA 3TMAA 5LUAA 3H8JA 3IQGX 3RC7A 3VMFA 1Q1GA 4S12A 1IOZA 1VE1A 1QHXA 4MUEA 5A5FA 4NBNA 4Q18A 3AM1A 2X23A 2H9IA 3LBAA 1D2EA 2YR0A 3NTQA 2X40A 2JHCA 5JSKA 3WGNA 4YUAA 2OSVA 4DLYA 4OYHA 2ZB8A 1FL9A 3IRVA 1JDTA 4Y18A 1TU4A 2DFDA 1K8XB 3DD5A 4GLJA 3HGTA 3K9WA 2VPXA 4RA9A 1SXPA 4ER6A 5K99