5EJ2A

Crystal structure of carveol dehydrogenase from mycobacterium avium in complex with nad
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
277
structure length
277
Chain Sequence
b'TGRVAGKVAFISGAARGQGRSHAVRLAQEGADIIAIDICGPIENLAYPHSTPEDLAETADLVKDLDRRIVTAQVDVRDFEALKSAVDSGVEQLGRLDIIVANAGVGTDGRKLHKIRDNVWQDMIDINLTGVWHTVKAGVPHVLSGGRGGSIVLTSSVGGRKAYPNTGHYIAAKHGVIGLMRAFAVELGPHMIRVNAVLPTQVSTTMVMNDQTFRLFRPDLENPGPDDFAPISQMMHTLPVPWVDASDISNAVLFLASDESRYVTGVSLPVDAGSLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carveol dehydrogenase
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium
molecule tags Oxidoreductase
total genus 102
structure length 277
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.275: (+)-trans-carveol dehydrogenase.
pdb deposition date 2015-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ej2A00
1Y5RA 2Z1NA 2BGLA 3B1FA 4OSOA 1BXZA 5GZ1A 1KVRA 8ADHA 3DXFA 1KC1A 4BGIA 4PG5A 1ISIA 1QV6A 4J1SA 2VYVD 1N1EA 2B35A 5U9CA 3TRIA 1CJCA 3TOZA 1XHLA 5DT9A 3VC7A 5IDWA 1PL7A 1V9LA 2PV7A 4JN6B 2B5WA 1J5PA 1X14A 4IMRA 2GYYA 3BYZA 1T2EA 2X0IA 5TC4A 1PSDA 1RPNA 2OOSA 1QKIA 4XKJA 1I3LA 2LDBA 2QHXA 2YV3A 4I5FA 2X6TA 5I8ZA 5TS3A 3QVSA 3WGGA 1HF3A 1PQPA 2ZB7A 3DDNA 4NIMA 2RH8A 1HT0A 3CTMA 3VH3A 5I7VA 5L4SA 2DLDA 4D3DA 3I23A 1KBZA 3ADPA 3D5QA 5DBIA 4HXYA 1B14A 4XYMA 2AQ8A 1UXGA 3E8XA 2YQ5A 4IBOA 3GEDA 1ENOA 2X9VA 2G1UA 2CVZA 3Q3CA 4O6VA 5F1KA 5A02A 3FF4A 2YHUA 2AEJA 4MJLA 4BO1A 2GPTA 3I9JA 4OSPA 2G82A 4CMEA 2C7GA 3HNPA 1JAXA 2FPIA 3WNQA 1M6WA 4YRAA 2CF5A 3G17A 3GN2A 3IAHA 1PX0A 2BFOA 1H9BA 1JWAB 1PTJA 1PJCA 3C3XA 5B1YA 4BNHA 2HJSA 4XGNA 3RROA 3GAFA 3JYPA 1PJ2A 1WAMA 1LDNA 4U0JA 2BFAA 3HN2A 4FC6A 3EMKA 2CZCA 3WB9A 2BFPA 4CM1A 5JAZA 4WEQA 1C1DB 1H5QA 4DREA 6LDHA 3ZHXA 3LC2O 1PGJA 5F5LA 3KZVA 4QFCA 1ADFA 1DC6A 4MP8A 4PLFA 4GWGA 2IEDA 3W8EA 1B26A 1NR1A 4AVYA 2WE7A 1AXEA 5AXBA 4A0SA 5JYEA 1Y6JA 3MZ0A 1XA0A 2DUUA 2O2YA 1QLHA 4GSKA 3UF0A 1KEUA 4KTVE 5DN9A 1ZXBA 3B6ZA 2BELA 2P5UA 3OIGA 4GLOA 5A9RA 1PZFA 4PLPA 1PWXA 1LQUA 4CMJA 2C54A 1T2CA 5IDQA 1JA9A 4WOKA 4FSHA 3FHLA 1CF2O 1N1GA 2DVMA 4QSMA 5C3MA 2Y66A 1G6KA 3FRJA 1J49A 1CDOA 1I32A 1YL5A 1QYXA 5H82A 1U3UA 3QLJA 2GN4A 3QP9A 4RCVA 3AI3A 3MWDB 1NPYA 1UXHA 3KSDO 4D7AA 1TT5A 5L40A 3WQSB 1LSJA 5JDCC 2IDZA 5I7FA 3KYBA 4R9SA 1LDMA 1YVEI 1ISGA 4JGBA 2D0IA 2Y0EA 4IS3A 4ZRNA 1N9GB 4J2HA 1NHGA 3WSVA 1U2DA 4J6FA 2CVQA 4LCEA 2ZQYA 1F12A 3NDRA 1OOEA 2W2KA 4J0FA 3E5RA 2AE1A 2X22A 3R6DA 3WYCA 2O4CA 2X23A 2YHIB 1K6JA 4E6PA 1RJWA 1IHXA 4KMSA 5A04A 2GD1O 1PS8A 2GNAA 3NX4A 4GL4A 4X54A 1P0CA 2PD4A 1U5CA 2X9NA 5F5NA 1C0KA 2YDXA 3UCEA 1KIFA 3ZWWA 1TA4A 1ID1A 1TI7A 4JP2A 3GG2A 1WVGA 4DRYA 1EQ2A 1X15A 4R3WA 4BNXA 4J7XA 1RWBA 2B4TO 4J43A 1NPTO 1X0VA 1XU9A 1U3VA 4WCFC 3BMNA 1PL6A 3HG7A 4CMGA 3L9WA 3W1VA 4D3FA 2JD2A 1FDUA 4GPD1 4J3FA 3PJDA 3F1LA 1E3LA 3RUAA 1QYVA 1AN9A 1ZK2A 2NU7A 3D4NA 2JFGA 1QV7A 3TWOA 3KEQA 1E3EA 3ULKA 2Q4BA 3OIFA 1LNQA 2JD0A 2X1HA 3ZWOA 2VHYA 4MVJA 4LGVA 4QO8A 4MVJP 4FBGA 3TZ6A 1J4AA 3DBLB 3ZNQA 4B3IA 3ROKA 4DQVA 2EXXA 1T1SA 3U9LA 4E33A 1HDRA 1KEVA 4RPGA 5BSGA 4GLLA 3H2ZA 4MDHA 3RJ9A 4PZDA 2PY6A 3P5SA 2EGGA 5JDIC 3PRJA 3TQHA 1SB8A 1YGYA 1A7AA 4IPTA 1F14A 4IDFA 4ZHSA 2O3SA 3GPDG 4CUZA 3Q1LA 2X5OA 5KKCA 1HDYA 3I9OA 1HL3A 4B3JA 3O03A 3WXBA 3EY4A 2NACA 3TL2A 2C0CA 2QYSA 1FJHA 5MDHA 1R0KA 3RBZA 4E3ZA 4FB5A 3WGZA 1U2GA 2QQ5A 4CM4B 4RF4A 5TRTA 1UP6A 4EDFA 4WPGA 1ZK0A 2VQ3A 1DIBA 1H94A 2FR8A 2ZCVA 3RUCA 1M76A 5JAMA 2HQ1A 4IDEA 4BMVA 1PR9A 4NFSA 3F1KA 3ZV6A 5ENDA 2WMDA 1QORA 1IPFA 2YY7A 1WZIA 2GN8A 1GZ6A 1BMDA 1ZW1A 2HK7A 2PD3A 1X1TA 2VTEA 3GFBA 3Q2IA 1U3TA 4XA8A 5KVQA 1OMOA 4Z0TA 4CM8B 2GO1A 3AUUA 4MKXA 1H2BA 4MVJM 2CDAA 1B15A 1Z45A 2RHCA 1I24A 4J1NA 3DHEA 4LVCA 3VDQA 3AUTA 3DBHA 3OHSX 3BIOA 1UXIA 2CMDA 2VZ0A 4XR4A 1HE3A 1DIHA 5A5FA 4OAQA 1E3SA 3GVIA 1I36A 4IM7A 5TX7A 2VHWA 4RV9A 3JQAD 3WR5A 4BV8A 4R5HA 2D2IA 2BI7A 5FI3A 3S2GA 4ZRMA 1E3WA 2D59A 2QRLA 3FR8A 3W6UA 3NRCA 4BNKA 4KUEA 3ZW9A 4Y6PA 3T4XA 2ZTLA 1M66A 2HRZA 2Q46A 4UEOA 1XU7A 5L7YA 2J3HA 4FFRA 4N5NA 2ZIZA 1Y8RA 3RSHA 1DFGA 5CDTA 1HXHA 1JDJA 3KOUA 3HUDA 4YA6A 1A72A 1F0YA 4HX5A 1I10A 3I6IA 1F06A 1Z6ZA 4IUYA 3JD1A 4BHTA 4YYZA 1MG5A 1UZMA 3V8BA 4YT5A 1B3RA 4B3HA 2NLOA 4W7HA 4DPLA 1UP4A 4UVEA 1XELA 1KC3A 5JLAA 4GBJA 4DIOA 1NX6A 2FR1A 1HWYA 2IXAA 4FJ1A 2GRAA 3CMCO 2VUTA 2H6EA 2GZ2A 3DFZA 3O4RA 3QVXA 1N92A 1OC2A 1QLJA 3OQ1A 3S1LA 1BDBA 4ALIA 2DFDA 1SOVA 3L9XA 3ZV4A 2Y93A 4S1VA 3SXPA 5A9SA 1N8KA 4MVJE 4UEKA 1LLCA 1P31A 1DEHA 1GR0A 3NGXA 3QVOA 3SVTA 1Q7CA 3X2FA 1WW8A 1U7HA 3KO8A 2C2XA 2Y1OA 5K6AC 3UCXA 3RQSA 3LC1O 4MIYA 1ZUD1 4P38A 2C2YA 1DDOA 4ALMA 3KXDA 2BGMA 2J5RA 1LA2A 5L3ZA 2B37A 4OJNA 4MKZA 2R00A 2ZYGA 3K73O 2HMWA 2NUAA 5C7OO 3M6IA 3VZSA 4LSMA 4DIBA 3AW9A 5ENVA 4JP3A 3ZWAA 1GUYA 3JYQA 3RFTA 4TRNA 3RI3A 3SEFA 4XWYA 4NR0A 5CHEA 4ALLA 3ZU4A 1LC0A 4YJDA 3ENKA 1PQWA 3SC4A 4NHEA 3JSAA 1M6HA 4RPJA 3GVXA 1HE5A 4E21A 2H1SA 1C0PA 4IIVA 4O1MA 4CR8A 1CIVA 1ISJA 1LRKA 4PVCA 4WGGA 3JYLA 1QR6A 2TMDA 1EDOA 2C7VA 3OJOA 1B3BA 3VPGA 1HKUA 1ZEJA 3R1IA 3DOJA 4L9RA 1ISMA 5I9NA 4XIJA 4MOWA 4OQYA 1YB5A 2Z95A 3A06A 1WMAA 2AG8A 5CG1A 1EFKA 3R0IA 3H7AA 3UGKA 4J7UA 3PIDA 7MDHA 3TZKA 3MTJA 1DLJA 3GY0A 3PGXA 3WQQA 2W2KB 5H83A 4WUVA 4NFYA 4F45A 1Z74A 1DC3A 1NVMB 3F47A 1XDWA 2O7QA 2Y1FA 5EPOA 5THKA 3VKVA 4J90A 2GUGA 4L8VA 4BNIA 5IXSA 1LQTA 2PA3A 1IZ9A 2W2LD 3LQFA 3U49A 3WIEA 1PEDA 3KUXA 3O26A 3RC9A 3KTDA 3H9GA 5H81A 4PLTA 3LVFO 2Q1SA 4E0BA 5I7SA 3AJRA 1HYGA 4DC0A 1PWZA 2DM6A 3U4HA 4F6CA 1A4UA 3DMTC 5KNLA 3MJVA 1PJ3A 4ITUA 1PJBA 3BMNB 1HRDA 1NASA 1LDYA 5BSHA 1GQYA 1O94A 5IDXA 1EVIA 5L7TA 1X7GA 2VRCA 4Q3AA 2B5VA 2PKQP 2Q1UA 5TQVA 3KM0A 4MPDA 3TNLA 4E30A 1O89A 4A10A 4Y6SA 2YYYA 3B70A 2G76A 3Q6IA 5CP8A 3ZWYA 1OAAA 1DIGA 3L6EA 3HSKA 1KVTA 4BNVA 4NDNE 3JQDA 4AFNA 4JJGA 3WBFA 3RFXA 4W9NC 4E2XA 3DFUA 3INTA 4CM9A 3KEOA 3FWZA 3OEWA 2BD0A 2NADA 4RQTA 1ENZA 4KWIA 2Q2VA 2IZZA 4M1QA 1A9YA 1PZHA 3DBRA 4JJFA 4XYBA 3WWYA 3STHA 3RUHA 1HLDA 3ZWXA 5DNAA 4BL5A 4PN3A 2GERA 4Q3BA 1WXDA 4BQRA 4J7CA 2C82A 4NQZA 1NNUA 3NJ4A 3TJRA 2A94A 1WLYA 3PQDA 5K9ZA 1WWKA 3AFNA 1KYQA 1A5ZA 3AOEA 3E5MA 3GF4A 4TRJA 2GGSA 3ZGYA 3HDQA 2WM3A 4NNJA 2BMAA 2NQTA 3ZH2A 4LVUA 1Y9EA 2RHRA 1U8XX 1PZEA 3NYWA 3NV9A 5JYDA 3SLKA 2DU8A 3W4KA 5TLSA 1BG6A 4RDIA 4RF2A 5G0SA 3BMCA 3VZQA 3IUPA 1H2HA 3RASA 1AE1A 1Q7GA 3PYLA 4OH1A 3NDJA 4UVIA 5EESA 1HYHA 2Y1DA 4Z3DA 2G0TA 3WJAA 3DBHB 3GNTA 3IDSA 4YJHA 3WGOA 5COAA 4R9RA 4Z9YA 4IDBA 4PRKA 1WZEA 2Q2WA 2JCVA 3BAZA 3DHNA 3CH6A 3OJFA 4BO4A 1P1HA 2JD1A 3EHEA 3QVTA 2E37A 1VL8A 2VWGA 4D3SA 2ZQZA 3D3WA 2ZTVA 3JQFC 1UAGA 1ULSA 3PWZA 4HUJA 2YUTA 2AHRA 1UP7A 2YFHA 3FBTA 3RUIA 1BVRA 1E3WB 1WDKA 5TSDA 5ITVA 1GFSA 4UEJA 3MJCA 1GYRA 1YBVA 2QRKA 1D3AA 3RKUA 5B4TA 5JCJA 4RVUA 1MV8A 4AJLA 3MJEA 3HQ4O 1SCUA 2X4GA 4PG8A 1E5QA 4BNYA 4D45A 2H63A 2I6TA 1O5IA 1Y8RB 3QVWA 4QX6A 3VH2A 4M8SA 3GVCA 2DUWA 1E6UA 1JKFA 3IP1A 4OM8A 4P22A 1D1TA 5L95A 2PLAA 1D8AA 1K0UA 2HU2A 2WDZA 1YO6A 4E5KA 4FPXA 3RU7A 2VUUA 3AY6A 3GRKA 5I9MA 1E1NA 4CLDA 2ZKLA 4NZ9A 4IXTA 1NFRA 4CM7A 5A9TA 3LT4A 2E4AA 2EV9A 4Y8VA 1V35A 4JBIA 4PLHA 4EI2A 1PR3A 3X2EA 3VPXA 1ISFA 1YB1A 2CSUA 2SCUA 5ITWA 1DFHA 5A9SB 2CDBA 4ZQEA 3H9EO 1QG6A 1V6AA 1I2BA 1GV0A 4L4XA 4DPKA 2OUIA 1KOLA 3JQ7A 2UYYA 4BNTA 4W6ZA 1R15A 2I3AA 4I5EA 4N18A 3DAPA 3GAZA 2Z1MA 4IZIA 3K92A 3WFJA 4QEDA 3PLRA 5DP1A 2OGUA 1JKIA 3LLSA 4BO9A 3L4BC 2HCTA 4O59O 2HO5A 4UVDA 3D1LA 5C37A 4OXYA 4CL3A 3W6ZA 3SLGA 1ZFNA 4S3MA 1ZK3A 3UUWA 4J16A 4RVGA 5JO9A 2Q3EA 3WWZA 3PHIA 4CMCA 1HE4A 2C59A 4RGBA 3ITKA 2V65A 2LDXA 1NQAO 3RKRA 3RCBA 2Q49A 2VUSA 3EGOA 1K6IA 4J49A 4PLYA 4LW8A 5U4QA 2A4KA 2EW8A 3I9NA 4TRMA 1LUAA 3GLQA 3OSUA 3HB5X 3JQGA 4FQ8A 4BNWA 5KIAA 1UDCA 2F00A 1T2FA 3IIEA 3JYNA 3UHAA 1CQIA 5COQA 4TSKA 3GVHA 3H5NA 1O6ZA 1CRWG 2D5CA 1P74A 4RZHA 1Q0LA 2O3TA 2HLPA 5HS6A 2YQ4A 3AM3A 4UULA 5B12A 4NBTA 1OC4A 3D64A 2XOXA 3I3OA 3K30A 3DZIA 1EFLA 2E82A 3JQ8A 2UV8A 1MC5A 1DJQA 3HJAA 1GUZA 2GCGA 2VTDA 4WNIA 4BO5A 1I3KA 1DHRA 1BTOA 2EP7A 4TWRA 4TKMA 4GSLA 1R0SA 2VHZA 3ICCA 3DHYA 4FCCA 5JAIA 4OKNA 5JBIA 3CZRA 4ND4A 3G1UA 4NBVA 1Q2XA 2ET6A 1DFIA 4YWJA 3FSRA 1DSSG 1P3DA 3GC6A 4W82A 1KS9A 4FFOA 1NAHA 5AOVA 1LLQA 3QWIA 4P4LA 4CQMD 2AW5A 1LU9A 3ROPA 3QW2A 4CMHA 2W8ZA 4XQGA 4YJFA 4ZJUA 1DC4A 5JDIA 1U7TA 3R3JA 3RU9A 3IMFA 3PFFA 2H9IA 4CUJA 1MFZA 3GUCA 2EGHA 5KVVA 4KTTE 3LDHA 3HHPA 1GCOA 3DOOA 1PGQA 1KY4A 3JYOA 3PQEA 4FDAA 3I9LA 4XCVA 1D7OA 1ENYA 9LDBA 1P1KA 1K6XA 2GN9A 3H3JA 3PZBA 3VOSA 5CDGA 4F6LA 4YRBA 1EE2A 3AI2A 1BDMA 2D8AA 3QWAA 4I08A 3CSDA 2QW8A 1U4SA 3QJ5A 2X7HA 2Y1GA 5DBFA 4BNGA 1V3UA 4EEZA 3QIVA 5ICSA 4DLLA 3DBRB 3MJSA 2PNFA 3QA9A 1NWHA 2EEZA 1EBFA 1DLIA 3B1KA 3PJFA 3S55A 1HYEA 2PWZA 3BTVA 3EDMA 3OETA 1E1LA 4NJMA 4ND1A 5HA5A 1R4NA 1NP3A 3CEAA 3D7LA 2RAFA 1T1RA 2EW2A 1EE9A 3PEFA 3DMYA 2BI8A 1FF9A 4H7PA 4IINA 2X9GA 4B8ZA 1DIRA 3TFOA 2PD6A 5ILGA 4KDFA 3E82A 4QXMA 1YQXA 2NVBA 3OIDA 3BHMA 5LC1A 3BMCB 3OMLA 3E18A 1CWUA 2NV6A 5FI5A 1AHHA 1HDXA 2DTDA 2DTXA 4YJHB 5HM8A 1R37A 2Y0CA 2GDZA 2FY8A 5TIIA 1DOHA 4YT4A 3N58A 4EUFA 3O38A 1JTVA 3GGGA 4FW8A 4D42A 3D3WB 1O0SA 2A9FA 4BNFA 1JWBB 1RYEA 5A05A 4MO2A 1C14A 4INAA 3DQPA 5BSFA 3ADOA 1U9JA 4L4SA 4AJ1A 4OO3A 2Q2QA 1M67A 4A73A 2NNLD 3RUDA 4AJ2A 1GEEA 2EJVA 4LISA 4YT2A 5ADHA 5DBGA 1EVJA 2Z5LA 5ER6A 3QY9A 1ENPA 1E1MA 1E7WA 1BW9A 1LLDA 4BGUA 1PJTA 4OIMA 4YTEA 1GADO 3K96A 4AJKA 5EMHA 4DTIA 5IXYA 1AXGA 3CINA 4YQZA 3ZV5A 3GEMA 3NJ8A 3L4SO 1ADGA 4XRRA 4WASA 3K5PA 4AJHA 4XX0A 1E7QA 3AY7A 2OL4A 1TLTA 1YRLA 5K6AA 1NYTA 3INGA 2PR2A 1UDBA 5C7IO 4BGVA 4B7CA 3GG9A 1E7MA 1X1EA 1YBMA 3GZ4A 4CQLA 5JY1A 4RO0A 3IP3A 4RVFA 1XYGA 3I4CA 2HMVA 3GHHA 5JPIA 3TSCA 1HEUA 2VZ8A 3GFGA 3NT4A 1A9ZA 2JKVA 3JQ7B 3WLFA 3VPSA 1QYWA 1SBYA 1WPQA 1FDTA 4RORA 3UKOA 1Q1NA 2CY0A 2V7PA 3MCVA 4CPDA 5JNLA 2XPCA 4GWKA 3EK2A 3G3EA 4QUKA 4JK3A 4U6QA 4BGEA 1UZLA 1MXFA 3HADA 3LC7O 4I5GA 4YCAA 4AL4A 4CV1A 5AXAA 2AQKA 1IULA 5F1OA 3L6DA 2EF1A 4J9UE 5LCXA 3SBOA 4WE3A 3GGPA 2P4HX 3HFSA 2CDCA 3AUSA 3TDKA 3UICA 2Y68A 3BTUA 3M2TA 3BTOA 3F4LA 1MFPA 4Z0PA 4XZ3A 1Z73A 2RBEA 4BKQA 3GH3A 2FMUA 4R16A 4DVJA 5KJFA 3CZMA 3PYXA 3WX0A 3IJRA 1NQ5A 3KLPX 3WJ7A 3D4PA 4TKLA 3GVPA 4TROA 5IN5A 4E2WA 1NHWA 1RM3A 1VJ1A 2HAEA 3JQGB 2ZB8A 1P1FA 3B1JA 3MOGA 4MIEA 3Q9NA 1G1AA 5JE8A 2JCYA 4BMNA 5AQ1A 1XQ1A 2CFCA 3GA0A 1O9BA 1B8VA 4OQZA 4PRLA 4CMEC 5LDGA 1RM4A 4EJ6A 1P1RA 5FEUA 5GY7A 4ESOA 1MC4A 1E3JA 2B69A 3I9MA 1M2WA 2V6BA 2ZJ1A 3JQ8B 1CYDA 3INRA 3ZHZA 1J6UA 1NBOA 1YQGA 3DZKA 3AUAA 4UREA 1MGOA 1OBFO 1YL6A 2FOIA 2NM0A 1B8PA 4TVOA 3F4BA 4E5YA 5G0UA 4ZQFA 4JIGA 2Y1EA 2WYWA 5JMPA 2V6MA 2XAAA 3Q9UA 1YJ8A 1GDHA 3C8MA 4CM3A 4BKOA 3F3SA 1BRMA 4LMRA 3E9MA 2C5EA 2I66A 4TZTA 3WDSA 4QO7A 3M2PA 1F8GA 2JFFA 4OMUA 4NI5A 2OORA 2P9GA 4GH5A 1FDVA 2UDPA 2GLXA 4GQAA 3L0DA 1KEWA 3TF5A 4HNGA 3I5MA 5G2OA 4YJFB 4XB2A 4EJMA 2GZ3A 3VVBA 1JAYA 1DXYA 3KYCA 4W9NA 4IDCA 1LSUA 4HV4A 2VCYA 2OBYA 2Y67A 1PQUA 3W8DA 1FDWA 2DBQA 2J5QA 3RAJA 2WWRA 5L4NA 2JAPA 3S8MA 4RPKA 3HDHA 4DQXA 3HE3A 4UAGA 4BNNA 3BTSA 3IKTA 4PVDA 1R4MA 4Q3NA 3ABIA 1H6DA 4EYEA 1ISHA 2AXQA 3F46A 1SEVA 4JBHA 2ILTA 1LEHA 3C1AA 3RIHA 4C4OA 1WNTA 3OA0A 4YACA 4GVLA 4KOAA 3WLEA 2VYNA 4D46A 1EUDA 1EK5A 4KZPA 4PLGA 3E9QA 3G1TA 1QYCA 5DULA 5G4LA 3ANMA 4LCJA 4D0RA 3BXXA 2BF7A 3EVTA 4Z6KA 2DFVA 4IXWA 3WS7A 1EQUA 4AJNA 4DWVA 4Y9DA 4U0KA 3ZHYA 4NJMB 2VYVA 2OO5A 1Z82A 3BHIA 4Y6RA 1R4NB 3V2UA 4IQGA 3FBGA 1I5RA 1ZBQA 5DZSA 2P68A 3GOHA 2J3JA 4GX2A 3FTPA 3H3FA 4ALJA 5DF1A 2NVWA 4DYDA 1N5DA 4QQRA 2VHVA 1NM5A 2HMUA 1UZNA 2EKPA 1ZH8A 3FN4A 1B16A 1NTOA 1G0OA 4CLOA 4E32A 3JQFA 1JQBA 1I3MA 3DONA 4A7PA 4BMSA 5IZ4A 3PWKA 4YAJA 2Y99A 4Z9XA 4PG7A 5T57A 1NXQA 3I52A 2VWPA 1ZNQO 5IFLA 2A92A 3UFXA 4R41A 4GX5A 1VL6A 1DRWA 2FPGA 1JN0A 3NTOA 1FXSA 4FD3A 4HBGA 1EVZA 5FYDA 4KQWA 4ZQGA 5IJZA 4XYEA 5BNTA 1UDAA 4BB5A 5CPBA 4I8XA 4NU6A 4ALKA 1T24A 4IDGA 1CQJA 1YWGO 2IODA 2BRUA 5DCUA 4K26A 4CLHA 4RF3A 5KWEA 1MLDA 1IHYA 2AE2A 1SNYA 2GSDA 3GMDA 1JLLA 3BHJA 1BVUA 3DWFA 5AXDA 4XYLA 4O0LA 1IB6A 1BXGA 1R6DA 2AQIA 2FZEA 3I4FA 2B0JA 4I1IA 4IJVA 1KY5A 1DJNA 5B4VA 1NFQA 1SAYA 3K9QO 5COBA 4D79A 1QRRA 1BW9B 3U09A 2HRBA 2I99A 2O3QA 3T7EA 4DIFA 1H0KA 1E1KA 1NQTA 2EKLA 3DZBA 4URFA 1Y1PA 2W98A 1U3WA 3TL3A 1T4BA 3RVDA 2NU9A 4CM6A 4CV2A 1UAYA 3UVEA 4TQGA 1CETA 1PZGA 1D4FA 2W90A 3NAQA 2ZK7A 4D44A 4GX0A 4NG5A 1MP0A 4IDDA 4CQLB 1ZJZA 1ONPA 1HDGO 2X0NA 3VPFA 1PJQA 1A7KA 3ZU5A 1DIAA 4EUEA 3C24A 3UAGA 2BH9A 5GZ6A 3PYMA 1ZZEA 3PDUA 3DR3A 3GDGA 3TOXA 3V2HA 4ZU3A 2WTBA 2EHDA 2JJYA 4QFDA 1L7DA 3S2FA 3S2EA 4D43A 4BNUA 2CVOA 1LJ8A 5FF9A 1UR5A 5CDSA 1H6BA 3VAZA 3SJUA 4BOYA 1Q0QA 2EG9A 2FHSA 1U4OA 5EJ2A 1KVQA 3IJPA 4R69A 4XD2A 5MGBA 1QMGA 3WMWA 3JQ6A 4JROA 5AYVA 1LI4A 3HB4X 1K5HA 3PZRA 4BNJA 1EK6A 4I5DA 3AU9A 3ENNA 2P4QA 2ZB3A 5I9LA 1YOVA 2XXBA 2P5YA 3QHAA 4DA9A 3JQ9A 4DLAA 4ZGWA 4MIOA 1GUFA 1PJSA 1MXHA 5T5QA 1P1IA 4YVFA 3Q0EA 4XQ9A 3VZPA 4PG6A 3H9QA 1BWSA 3WGQA 2CUKA 5T8KA 3I83A 2OMEA 3N74A 1VJTA 4PLCA 4OKIA 2QRJA 4PFJA 3CUKA 2JL1A 3EYWA 2VRBA 2UUPA 3IKVA 4Q3CA 1SC6A 3PK0A 5L4LA 3DTTA 3GQVA 3DZFA 1PJ4A 4MP3A 1RM0A 4CJXA 4OXNA 4RPLA 4G2NA 1C0IA 4J2OA 1WDMA 2OHXA 1PGNA 4M49A 5T67A 1IZ0A 1UH5A 5HTOA 3H5AA 1C0LA 3K6JA 2O48X 5A1TA 1CEQA 3E6AA 4K6FA 3U0BA 2HJRA 5C5IA 2IZ1A 2ZCUA 3GNSA 3RC1A 3QQPA 3E1KA 4LSWA 5A03A 1GEGA 3MTGA 4II3A 3GRPA 1IOLA 3OJEA 3DO5A 4IIUA 3DZJA 1LX6A 4Q3DA 2VWHA 3GEGA 4EBFA 4E2ZA 3ZW8A 4MVJD 2R00C 4YEDA 4DYVA 3FCOA 4HFRA 4CLRA 4A2CA 2PKQO 4DC1A 3K31A 2YV2A 3ZDFA 4RDHA 1AGNA 4G65A 2DQ4A 5EL0A 1SO8A 2CNBA 1A4IA 1GQQA 4ZICA 1LDBA 1XSEA 3JTMA 4A26A 1ZSNA 1IE3A 3C85A 3KYCB 3MWEB 2IYOA 1LSSA 4CMAA 1G0NA 3EW7A 4YDRA 3C7AA 3KB6A 3OM9A 4IQ8A 3M1LA 3ITDA 2ZJ0A 1ZCJA 1PJLA 2NTVA 2X86A 2WD7A 4J4BA 1R4MB 4EITA 1PL8A 1YKFA 4OYRA 2IEBA 1TEHA 3ZNPA 4NBUA 3A28A 3CKYA 3GK3A 3E9NA 4CV3A 5BNFA 1PGOA 1IYZA 4ILKA 5K0ZA 2HDHA 3ZN2A 2QZZA 2DPHA 2E48A 1VKOA 1X7DA 4MVJH 1ARZA 4MINA 1EBUA 1N7GA 5DCYA 4EJ0A 2WE8A 1ZKMA 5IG2A 5CFZA 3WBBA 3ZV3A 3BMQA 4AJ4A 3LF2A 4ROSA 5KJ6A 3ZNNA 3JQAA 4FS3A 1RM5A 4NBRA 1I0ZA 2DBRA 2DTEA 1B0AA 2WEKA 1JVSA 1NWCA 5C7LO 4TZKA 5EERA 3A14A 3ORFA 4K9DA 1XLTA 1V3VA 2B4RO 2X8LA 1DHTA 4ND2A 2O3UA 3CIFA 4R1NA 5TJ9A 1Y7TA 2P2SA 4CLOB 1HDCA 3WG9A 2HMTA 2NTJA 4WLEA 3QWBA 3UXYA 5JDCA 3ZHBA 4PZCA 2Q1WA 1HSOA 4E2YA 5HRUA 4BKPA 4OGWA 4YAEA 3F5QA 2PH3A 5TGDA 4R01A 2PGDA 2E49A 4YQYA 3DOCA 2WSBA 1XIVA 3FNGA 3PLNA 3FPLA 2OBNA 2X58A 4YBZA 3QV1A 4OHUA 3OH8A 4AJPA 3T4EA 4CUKA 5CEJA 2NVUA 2E6UX 4QT0A 3BA1A 3BMOA 3KV3O 4A27A 5JS6A 3NUGA 3IOYA 4DGSA 1B2LA 3OBBA 3PIIA 2AEFA 3JQCA 4GI2A 4NMHA 4PG4A 5TT1A 1BXGB 4JLWA 1N2SA 1W4ZA 2Q99A 4WCFA 5EN4A 4WOJA 5CEEA 5B37A 5IZCC 1ZSVA 4WLVA 4J91A 1KERA 3H4VA 3F6YA 5JXWA 5T64A 2JHFA 3SJ7A 1AUPA 3AOEC 1HSZA 1H6CA 1I3NA 1L7EA 2AMFA 2ZATA 3D4OA 4Q39A 4CV0A 5AXCA 2RCYA 3JD2A 3DTYA 4EUHA 2NWQA 4GKBA 1P9LA 1YQDA 3HZZA 4K1LA 4N5LA 3ZWVA 4FIZA 5ER9A 1TB4A 3DZHA 5A3VA 3WTCA 1PS9A 1T4DA 1E77A 1JKJA 1XG5A 3KETA 2C5AA 1B7GO 4WLFA 5DCWA 1W73A 4CLXA 2P9CA 4DPMA 4M55A 4XQCA 1TVEA 3WGIA 1EUCA 1PIWA 1BSVA 4PLWA 1SZJG 4Q3EA 3GZNA 4OOEA 3ONDA 5A06A 3T7CA 1K89A 2YFQA 2GF2A 3GPIA 1SPXA 2J5KA 4E13A 4R1SA 3LT2A 5F1PA 1LTHR 5HWSA 5LDHA 3OJLA 3K2BA 3EZYA 5DDIP 4BNMA 3PWSA 5DOVA 3ETDA 1PS0A 4N7RA 4DL9A 5G0VA 1GZ3A 1ADBA 4MVJI 1LDGA 1LC3A 2YW9A 3DL2A 3PDJA 4FR5A 1LLUA 1YH3A 1YOVB 5IAAA 3B20A 4DQUA 3OFSA 2G17A 4HADA 4IS2A 2ZTUA 4F3YA 3O8QA 1LRLA 4XEHA 2J3KA 3C7CB 4JNKA 2AA3A 5G0WA 4DBZA 4ZVVA 3P19A 3R3SA 1ML3A 3ONEA 4YAGA 3H2SA 1XQ6A 3VTFA 4BO8A 2IYPA 3NT2A 1F17A 1FK8A 3Q2KA 3WOHA 3ZNOA 3OQ6A 5DOZA 2W2LA 1DAOA 3QWHA 5KJEA 5ICMA 4P4NA 2C20A 2JHGA 1KETA 7ADHA 4OOFA 2X0JA 4M54A 3M1AA 1P44A 3MJTA 1IY8A 3V1YA 3KYDA 4FN4A 1EVYA 2YZ7A 1E0DA 1YE3A 4E5PA 5L9AA 5KOIA 3NT5A 1JW9B 3CXRA 3WIDA 3RUFA 1I2CA 1P77A 2RIRA 2ZTMA 3HDYA 1V0JA 1S6YA 5BR7A 1YJQA 4GKVA 5L7WA 4CM5A 1A71A 4PGFA 5B4UA 5L45A 2AQHA 1H93A 2D4AA 4UVGA 4AJJA 2FZWA 1R0LA 2VRCD 3UOGA 1HLPA 2B4QA 2GASA 3IS3A 3H8VA 4J1TA 3PHLA 3FPCA 1NAIA 3PXXA 1YL7A 1ADCA 1E7SA 1R16A 5GMOA 4Q9NA 4CLRB 3GUYA 3N7UA 2HUNA 1Y81A 3QRWA 4QTZA 4R54A 1H9AA 1VSVA 2B36A 5TJHA 4B7XA 4CM9D 4IJUA 2HMSA 1I8TA 3ASUA 1ZK4A 2Q45A 1I2ZA 1JVBA 1K3TA 3LF1A 2XXJA 1W8DA 2JAHA 4WLNA 1GPJA 4WLUA 4NJOA 2DKNA 1JU9A 3HDJA 4M87A 3ZI0A 1U8FO 4PIVA 2V6FA 2PGJA 3W4JA 4LRTB 3KSUA 3JQBC 3TFQA 4I9HA 3ZWNA 3GMSA 2YV1A 1P1JA 4FOOA 4TVBA 3ZWBA 4R4JA 3H5RA 5KJCA 2NU6A 3S2IA 1IPEA 2WD7B 4FJ2A 4U8GA 3VH4A 2YDYA 2RH4A 1I33A 1TT7A 5EIOA 3QE3A 3WYBA 3U5TA 9LDTA 4UUNA 5KCZA 1ONOA 3A1NA 3DBVO 5KVCA 1ZO8A 1W6UA 3LYLA 3RBVA 2DBVO 3WTBA 3SX2A 4P4GA 1K2WA 1ZIDA 1UXKA 5IF3A 1ZVMA 4XB1A 2I3GA 4IJKA 1U5AA 2PFGA 1NR7A 3ZZNA 1XEAA 5KKAA 1HTBA 4XJTA 4EEXA 1BXKA 1XCBA 1DRUA 2FP4A 3BMQB 3JQAB 3FWNA 2IRWA 3WSWA 3PVZA 1LSOA 2O3JA 1CERA 1GD1O 3D5TA 1N7HA 1X7HA 5U1PA 3F5SA 2PGLA 4A03A 2AG5A 1D1SA 1FDSA 3C1TA 2VZ9A 4ND3A 5HBRA 1Y8QA 5FFFA 3F9IA 1PU2A 2PK3A 4D41A 3IL2A 1BHSA 3GHYA 4L75A 4R5MA 5JCJD 4U6SA 1QP8A 4R1TA 3AU8A 2QYTA 1ZJYA 5L51A 4RZIA 3OJ0A 4JXKA 2Q1TA 3P2OA 4Z0HO 2EKQA 2NU8A 4CL8A 4TRRA 4BO2A 1HDOA 4NPCA 1BGVA 4AJIA 1Q7BA 4IDAA 4H3VA 3DC2A 3VVCA 4DLBA 3JV7A 3PFWO 3AI1A 1GTMA 1Y9AA 3ICPA 3PQFA 4YB8A 4BB6A 4ALNA 3LT1A 3UN1A 2HKIA 1DAPA 4LN1A 3WGYA 1EZ4A 3LSYA 2NVUB 4BV9A 4IGEA 3EC7A 3BMOB 1YDEA 1MUUA 4IJWA 3GR6A 3FD8A 1R12A 4O63O 4E5MA 3OICA 3WFIA 3DMTA 4LRSB 4H16A 3AOGA 4XQEA 3LLVA 4WCFB 1GYPA 1Y5MA 3OF2A 2JFHA 4L76A 4M86A 4U5QA 3WGTA 4NK4A 4R1UA 1DBVO 2PH5A 3OP4A 1VSUA 3VDRA 4P8RA 2PTGA 4BO3A 3LZ6A 1LBEA 2X0RA 1NVTA 3V1TC 1W0CA 5I7EA 2HK8A 4B4UA 4TMFA 4LK3A 4CR6A 5JSFA 2YJZA 3K2EA 3ZU2A 2A35A 1E6EA 2R2GA 3NTQA 1VM6A 3GT0A 3WGHA 4RJTA 1GQ2A 1P0FA 1QYDA 3IUSA 4GVXA 5JC8A 2EP5A 4E5NA 2FRDA 3ON5A 4GX1A 5JAQA 1YB4A 4DUPA 4HFJA 2EJWA 1EDZA 1HZZA 5TT0A 3RBXA 2GR9A 3MOIA 3ZWMA 3G49A 3WYEA 1QXSA 4BUCA 4BIIA 4CR7A 4WECA 2Q50A 3HFGA 4DBVO 3CMMA 3GZNB 4E31A 1UXJA 4F46A 5G0TA 3PP8A 4K28A 1EUZA 1DC5A 3KSZO 3RFVA 3VZRA 2DBZA 3GDFA 1E92A 1ZXLA 4JBGA 3EAGA 2GN6A 2XF8A 2HK9A 4RVHA 2B83A 5BSEA 2DAPA 4NFHA 5G4KA 4B79A 3HN7A 4CMIA 2AEMA 1GZ4A 4C7KA 5CDYA 4W99A 4ZA2A 3UH1A 4YJGA 2R6JA 3U4CA 4B8WA 1EMDA 5TNXA 4BNLA 1HDZA 3K8ZA 4XDZA 2EIHA 3ZWCA 3NGLA 3U62A 1GCUA 4BO0A 3O8QB 1XWFA 1VJ0A 1KEPA 3D0OA 4XJSA 3DAFA 4BS9A 4EZBA 4NU5A 2DPGA 3NKLA 3G79A 2EERA 1NFFA 1MA0A 4KDEA 4UUMA 3AY3A 3ST7A 1GYQA 3V1UA 4BNZA 5FWNA 2BGKA 3FNEA 1PGPA 3H6KA 1UJMA 4KP7A 1Z75A 3LU1A 4MVJG 3ETGA 3KYDB 4WCDA 1IL0A 3DZGA 2ZB4A 2VNAA 1GY8A 4Z3KA 3JD0A 4BKUA 3UCFA 4CQMA 5CDUA 1R66A 1UUFA 3ASVA 1C1XA 4YR9A 4XIYA 1HETA 4N5MA 2O7SA 3W4IA 4RQUA 4O5OA 1NQOA 1T2DA 2J3IA 2QG4A 2P9EA 4RL6A 2HSDA 4E12A 4BVAA 3H9JA 5JO0A 1HE2A 3GGOA 4RVDA 4B4VA 1E7RA 4ZQBA 2Y1CA 3JD3A 2P91A 4GAEA 4II2A 4NK5A 2POQX 3L07A 4GGOA 4KUHA 3TZCA 3V5NA 4B4WA 4PLZA 3NDIA 3RC2A 2PKRA 3DAGA 4GMFA 1RKXA 3LT0A 4I9UA 4LMPA 3A9WA 4Y67A 2G5CA 2OP0A 3AM5A 1KVSA 2Y05A 3NEPX 5AVOA 5GZ3A 5JW6A 4J4HA 3ANLA 4JX8A 4YT8A 1E6WA 2VOEA 3CE6A 3L6OO 3NTRA 3U4DA 1ZSYA 1VL0A 1TT5B 4FGSA 4IZHA 3P7MA 2VWQA 4BQPA 2O23A 1O95A 3TZHA 6ADHA 1SMKA 4FJ0A 4MVJF 2BKAA 5I8WA 1MB4A 4HNHA 4AJOA 2TMGA 1TXGA 2PZKA 2EWMA 5THQA 1VE9A 3DEYX 3ZWPA 2VOJA 4K6CA 3L4BA 1C3VA 4RPHA 3GN1A 4FFPA 3RJ5A 2VN8A 1X0XA 2QZ9A 1GU7A 1WP4A 3OQBA 1B8UA 1E3IA 8LDHA 5IN4A 3RUEA 4BO6A 4G5HA 4PLVA 2O2SA 4FGWA 5DP2A 1I01A 5JFOA 3IC5A 2IXBA 3WMXA 4HKTA 2WD8A 4JCOA 1H6AA 4FC7A 2QIOA 5TF4A 1I30A 4OL9A 3TZQA 4FFLA 3G0OA 3WNVA 3C7DB 4A5OA 3D3EA 3OEYA 3FI9A 4AJEA 2F1KA 3RC7A 3PPIA 2FWMX 4ZD6A 4L73A 4WK6A 3KHUA 2DC1A 3RWBA 1YDWA 3MJ4A 1F8FA 1U28A 2CD9A 4W7IA 3VTZA 1KVUA 4WJZA 3I6QA 4YAKA 1T25A 3KBOA 3SC6A 1ORRA 3EUWA 1Y8QB 3MEQA 4PCVA 4I9NA 4UUOA 1OI7A 4KQXA 1LDEA 1M75A 4CODB 1P45A 4R51A 2X5KO 3RD5A 4CLEA 4BKRA 3VH1A 1VKNA 4ZN6A 4HY3A 4AG3A 3ROQA 2BLLA 3TPCA 3OA2A 4J0EA 1Q0HA 1S7CA 2VT3A 4R3NA 3ZCXA 1T2AA 1IUKA 3AWDA 2BFMA 1Z7BA 3C1OA 4HFMA 4HP8A 5A5EA 3PTZA 4WKGA 3KRTA 1RYDA 3PGJA 4HWKA 5HS4A 1C1DA 4L0QA 5IZCA 2FSSA 2DT5A 4M89A 4BO7A 5A3JA 1GAEO 2IZ0A 5CG2A 3ROMA 3AFMA 1V3TA 4FFMA 1XKQA 3FNHA 2VNSA 5KJ1A 3HWRA 4H15A 2ZYDA 3E48A 5KVSA 4YAIA 5JCXA 1ZMOA 5KTKA 3L77A 1A27A 3U4IA 4QECA 3OECA 4WNCA 1ZEMA 2W4QA 4OXKA 4JJIA 4XYGA 2I67A 1V8BA 4B4OA 1O8CA 4IGFA 3PHJA 2Y0DA 2UAGA 3FNFA 5T6BA 5EINA 1J0XO 1SEPA 4GMGA 4EW6A 1XR3A 4ONEA 3GNQA 2OXIA 1SB9A 1P33A 1SOWA 1Z7EA 4G81A 4E4YA 5EQFA 2BHLA 3TN7A 4YPOA 5JY6A 4B7UA 2O50A 1E5LA 4ND5A 2WJPA 1GV1A 2NSDA 3ZU3A 3KVOA 3GDOA 5BNIA 4IY1A 3PI7A 2VT2A 1OFGA 4N54A 2H5LA 5A4DA 3QSGA 5J23A 2D1YA 3DB2A 2V6GA 2J6IA 3PJEA 4DMLA 4NH4A 4J9VA 5ILOA 2I5PO 3IQDB 1X13A 2FR0A 1N9GA 4DMMA 4GGPA 4WEOA 1LXCA 4WLOA 4RLHA 3EVNA 2PZLA 2X5JO 4J4TA 4XRGA 1GL3A 1AHIA 2PZJA 1FMCA 2I9PA 2WYUA 1DB3A 3E03A 5F21A 1DO8A 2FPPA 4J1QA 1EEHA 2GZ1A 2YHIA 3U3XA 2CF6A 2D5AA 4D0SA 3QWFA 1DRVA 3BZUA 4KWHA 3O9ZA 4W4TA 2PZMA 5G4KB 3WICA 4CMIB 4R68A 3FTNA 3COSA 3Q11A 3ONFA 4YJGB 2I65A 1VI2A 3AM4A 4HFNA 4IMPA 4DXHA 1YONA 1WDLA 3A4VA 3AK4A 2OZPA 4KUGA 4ID9A 3KLMX 3VPHA 5JC1A 3ETEA 2OP1A 1VRWA 4XR9A 4L4RA 5BQFA 2QX7A 3EZLA 3H9UA 3LK7A 5L53A 4YRDA 4XDYA 1WMBA 2JCXA 4YXFA 3DBLA 1L1FA 4RF5A 2FSVA 2C07A 4PZEA 1E7YA 3VKUA 4XGKA 3WQRA 2UUOA 2ZYAA 3JQEA 1YS4A 3V2GA 2OFPA 2Q4EA 5CEFA 1VPDA 4CMBA 1ZMTA 4UVHA 4CQMB 3I1JA 2WYVA 1MX3A 3PHGA 1C1XB 4RVSA 1DPGA 1OZAA 2NQ8A 4UUPA 4IQ0A 1VC2A 2J8ZA 1T26A 2O3RA 2UVDA 2FN7A 4XGIA 5CAEA 4Y98A 4ZQHA 2C29D 4CM4A 5BT9A 5EQDA 3PJGA 1GPDG 5ES3A 5CPFA 2D3TA 4NBWA 4L74A 2I76A 1ULUA 2O4UX 3CPSA 5F3RA 1YBAA 4AICA 4MKRA 5JMWA 3PHHA 1LRJA 4JQCA 1HZJA 4MP6A 1NVGA 3W8FA 4FFNA 2NTNA 3H65A 4U7WA 3I9KA 1U1IA 1ZK1A 3JQBA 4EGFA 1QSGA 3JQ9C 3UW3A 1MG0A 1ONNA 3JD4A 3VHRA 4CM8A 3JCZA 1VLLA 2IE0A 1NPDA 3P2YA 4FOSA 5T8KC 3ANNA 5IDYA 1YXMA 4RLSA 3FR7A 2VYND 4Z9FA 4C7JA 2VHXA 1XGKA 4CMKA
chains in the Genus database with same CATH superfamily
2XA1A 2WUFA 4BMYA 5GWXA 4CEJB 3B1FA 4OSOA 5AIAA 5GZ1A 5I4KA 5AR1A 2Q6LA 3DXFA 1PHRA 2WVHA 3U7JA 5LOVF 4U7PB 1PN3A 3COZA 3KJNA 4L1KA 4J1SA 3O3MB 2WAAA 1ZI9A 4KMMA 1NDHA 3T3HA 1MD9A 2I62A 2R4UA 3N5KA 4GIBA 3TEFA 3VC7A 1PL7A 1V9LA 1J24A 1KAGA 2A1TS 2X2FA 4NU8X 3TUIC 3VMFA 1J5PA 1ZM3A 4IMRA 1JZTA 3SYTA 2Y0PA 5TC4A 1HE1C 2B21A 5ALRA 2OLKA 2BFBA 5CLHA 1US8B 3KUDA 1UMBB 1XVUA 5LQRA 5DYYA 2AJCA 4N8SA 4NIMA 1HT0A 3I5YA 1R0WA 3GRYA 1XN4A 2DLDA 5A4JA 2ACEA 3WJ2A 4FNAA 1F1JA 2O54A 3I23A 3SN6A 3RSLA 2Y9PB 4X97A 4TXNA 5T41A 3IR6A 1U0LA 2Z4RA 3M70A 1UXGA 1AMOA 2X9VA 3R40A 4O6VA 5F1KA 3UT5B 1WW2A 3AIKA 4AJ9A 1FY2A 1N9ZA 4C0WA 4G4SP 5IVDA 4B87A 5AHOA 5E7JA 1ZD8A 4EFKA 3K1TA 4G0VA 2C7GA 3MINA 1G21E 4EPYA 3TEMA 3F7MA 1VIMA 5LQAA 3M3HA 1L6RA 1U0OC 3PSAA 3WNQA 1UK8A 1EBBA 4WFQA 2GK7A 1OV6A 2CF5A 4P4SB 2F9FA 3JW8A 2BFOA 2QPOA 1JWAB 1LK7A 1PJCA 4EJFA 4R71A 3DPIA 1UPUA 3H5IA 5B1YA 1YB2A 2FWAA 3OJXA 4GG1A 3JAWA 1H4QA 4K9PA 4W6QA 4XGNA 2X3FA 1ACJA 1LQ2A 4MRPA 1Y1RA 3LUFA 2YMQA 2IEZA 4U0JA 4FC6A 4V02A 2C9BA 4OHPA 2BFPA 1IBCA 4TPKA 4WEQA 3WB9A 5JQGF 1JE0A 1D6SA 1H5QA 3D43A 6LDHA 2JLUA 1YTUA 1YB7A 1R00A 3FETA 4UMFA 1ADFA 3G2OA 4IRXA 4PLFA 4EFNA 5HOEA 4GWGA 2ZGVA 1RXCA 4C78A 4HLQB 4MB0A 5J9FA 3DOUA 2MSLA 1B26A 5AW7A 1Y3FE 2O05A 3UXMA 3R9WA 5E9AA 3A04A 2A67A 5HKAA 5B53A 1KEUA 1W44A 3RTEA 1Z26A 1ZXBA 3B6ZA 5F2NA 2P5UA 4LXHA 5JMOA 1NSTA 4MCAA 1PWXA 4CMJA 5C1IA 1T2CA 5IDQA 3O73A 4QPZA 4WOKA 1TADA 4XFKA 1MJNA 2DWOA 1BMFD 2YN0A 3QU2A 4ZCLA 4AQDA 5HCUA 8OHMA 4FYIA 2WI8A 3BGIA 5C3MA 3W90A 2BFDB 2Q3LA 1G6KA 3LDUA 1A9QA 4JC8A 1J49A 5I4IA 1CR4A 1HEYA 1L3BA 1XLTC 3IVCA 1NLYA 3X1XA 5CITA 4B75A 1M2JA 1RAFA 1QO9A 5EZYA 4JAVC 3AHEA 3V55A 2GN4A 3I2IA 4EGCB 1ESZA 4ISBA 4KVZA 4X71A 2QP9X 1UXHA 3KSDO 3JZMA 4UE2A 1TT5A 4D7AA 1MW9X 3WQSB 4EKIA 5B1DA 5JDCC 3VR6D 2NP7A 3F6PA 2WM2A 2F6RA 2E4WA 1LDMA 2Q3MA 1CJTC 2YH2A 2HB6A 2QAJA 3K1JA 1PYGA 3EBOA 4G5QA 4IS3A 4ZRNA 3D0RA 4PPQA 2I1WA 4JUAA 5E9WA 1M2VB 2TECE 3P94A 3DOEA 5IJ9A 3ABSB 5EXSA 3TQIA 4LCEA 4J6FA 2NZJA 1F12A 3KYIB 1OOEA 3KT8A 4HN4B 2GCPA 1FJXA 3E5RA 1SZCA 2CL0X 3P71T 2ZZKA 1XNHA 2C5HA 2Y1WA 3R9KA 3WBKA 1KO5A 2FPPB 1JFTA 3CLRC 3HKDA 4HBZA 4EY8A 1IHXA 1P4SA 2PMKA 2GD1O 1PS8A 5A04A 1TTTA 2J08A 2PD4A 1M2OB 1U5CA 5EAIA 2C2OA 3NXSA 1CSEE 3D4IA 3H1PA 4Y1RB 1VPEA 1RQGA 4Q93A 4IJQA 2NUPB 4N3GA 1L5FA 4KN8A 1T9DA 4LZZA 2XRFA 4DRYA 2HF2A 4ZCIA 1EQ2A 3FA2A 3UOAB 4Z4GA 1RRMA 3RNOA 3GLVA 1SBQA 3IEKA 3PD1A 1NPTO 4J43A 4YMTA 1J23A 1PL6A 3BMNA 4FHEA 3SDSA 3G2HA 3W1VA 1QGED 2JD2A 4BBZA 1FDUA 4GPD1 3SK0A 4UNRA 3PJDA 1C1YA 3A05A 1QYVA 1AN9A 1D0SA 4ACBA 3CJRA 1H4TA 3JZIA 4Y7CA 1T5IA 3D4NA 1RRPA 1QTNA 3T8YA 4HDNA 3TQOA 2I4LA 1E3EA 1PW5A 4ML3A 1N2CE 4Q1VA 1B00A 3ZWOA 3LTNC 2XE6A 4MUMA 2OILA 1J4AA 1RXEA 2PYDA 4YIHA 5K8IA 5B1EA 1T1SA 4PPGA 1HDRA 4Q7KA 5FFNA 5BSGA 4PM4A 2BFCA 3RDPA 3DYVA 5H3CA 1EFHA 3EXHC 2EGGA 3P5SA 4JQOA 2IHNA 1ZA2A 1XTUA 3W5HA 2YMPA 5DHQA 2C2KA 1M7GA 1A7AA 2H4FA 4JC5A 4IDFA 4ZHSA 1GG5A 1GKYA 1ZNWA 2O3SA 3QYPA 4PINA 3UJNA 1EWQA 1N2EA 3LWNA 1EESA 3I9OA 3HEBA 3O03A 3WXBA 4YWHA 3TL2A 1HT3A 2QXTA 3T7KA 4RYDA 3B7GA 1MB3A 3MD0A 1Y48E 5K0NA 3W8NA 2VO1A 4FQ7A 1U2GA 3MBIA 4JC0A 4RF4A 3DJYA 1KEEA 5TRTA 3USES 1UP6A 4EDFA 2I78A 4WPGA 3TAXA 1ZK0A 2QX9A 5AJUA 5F7ZA 2J0SA 3ANYB 2FR8A 3PA8A 3C5CA 4RPCA 1M76A 5HF5A 4IDEA 4WWHA 5TMDA 1I94B 1B74A 1PR9A 3LCMA 4NFSA 1RC1A 3F1KA 2J9GA 5G1PA 1PJZA 3U0VA 1QORA 1JR3A 4B4KA 4TSFA 3H13A 2IYEA 4QYMA 4JYPA 2QUBA 3MGGA 1BMDA 3DL0A 2Q41A 4JP5A 4Y2YA 1TM3E 1ST3A 5K03A 1CULC 1E96A 2VTEA 2Q28A 3NOOA 3Q2IA 4MUAA 4AG5A 5KVQA 1ESNA 5FPTA 4UHFA 5TB5A 4MA4A 4RMGA 4CT4B 1GGJA 2P77A 4UU7A 5BMOA 1B15A 6YASA 2WPDA 1S89A 1KZ7B 1OPXA 1EB8A 2IL1A 5IW8A 2RHCA 4B81A 5L3SA 3DUFA 4J1NA 3ZHOA 1LF5A 1W8IA 1RYNA 4C7XA 5CB6A 1JFFB 3DBHA 3HPRA 2JZOA 5EWMA 1CF9A 5EIWA 1HE3A 3CEJA 4XFDA 1XKTA 1QIKA 4UBIA 4C89A 3MS2A 2ZT8A 3BE5A 4L0MA 1TMYA 5CX1B 2ZSIA 3NWPA 4O33A 4E5DA 3HKBB 3JQAD 4BV8A 4N0QA 1O3YA 2D2IA 1M34B 2BI7A 3NVAA 1E3WA 5HFNA 2JI7A 1PR0A 3H4MA 3P2EA 3ZW9A 2OD2A 4YRSA 1BCSA 4Y6PA 5H16A 3T4XA 3FOFC 1M66A 1QBGA 3LUJA 4PYKA 4TV9A 5BWOA 5C8XA 4UEOA 4FMBB 2XAUA 4HX9A 4ENSA 2IOFK 3PKIA 2Y92A 4N6NA 2H9AA 5IMBA 3UK0A 2ZIZA 1Y8RA 1V7QA 1W2GA 5K3BA 3FB4A 3JATA 4MUGA 3T9CA 1FFEA 3UUGA 1JDJA 3W3AH 4B3CA 4F1JA 1RLIA 2OBMA 5CCBA 4BB0A 3ECCA 1LI7A 2C92A 2OXCA 2XMQA 4HX5A 4N65A 3C6MA 1KQGA 1Z5GA 2XWQA 4IVNA 1KWKA 1NMYA 3STXA 2MT9A 3BSYA 4BHTA 5A4FS 1X74A 4QBTA 4B3HA 1SVNA 2NLOA 1OQAA 4W7HA 1ZOPA 4HTFA 4RTNA 4F3RA 1XELA 2VRNA 2Z98A 1PQ4A 4YUWA 3QKUA 4NONA 4BEVA 3I6BA 3HKCA 3UHFA 4DIOA 1PFQA 2G6BA 1F7VA 3I1YA 3AR5A 2IYRA 1Y8CA 2GN1A 4IF6A 1EXVA 4WXPA 5H9VA 1OC2A 4JHXA 1BDBA 4WFKA 4MZDA 3FXAA 3F71A 3ZV4A 1D9XA 2QMUA 4INZA 5A9SA 1N8KA 1TUIA 2VBIA 1N6NA 3ZE8A 3TTSA 1W47A 1SVLA 1DEHA 1GR0A 1I1NA 1E58A 3ZJ5A 5H5JA 3B36A 1Y80A 1S0UA 3HPQA 3KLNA 4KN6A 3PEEA 1P3Y1 1WEKA 1U7HA 3KO8A 2C4WA 2C2XA 1MAUA 1XL1A 4MV9A 1Q95A 4RY8A 4E1BA 5JSZB 2WU0A 2HWKA 5ITSA 1ZUD1 2G9QA 1A4XA 3IIJA 1COWD 3SY8A 4V0OA 4ALMA 4G1MB 3RT7A 1VE1A 3U4QA 2AR7A 3AGPA 1P7YA 2QZPA 5L3ZA 1H8EA 1OBCA 4OJNA 4NY1A 3EC1A 1WOMA 3ZY2A 5GTDA 3G6WA 4CG2A 2J09A 1X7ZA 2ZYGA 3ZWDA 1Z6XA 4M8KA 4XX1A 5C7OO 1UBCA 2Y71A 5AK0A 4QBHA 1KYWA 3UJAA 3IMCA 3I39X 3ZWAA 1GUYA 2JFZA 3RFTA 1CDEA 3V1NA 2UZAA 1IHDA 2C5FA 4XWYA 1EHCA 4DBLC 3ZU4A 2XMSA 1LF0A 4YJDA 3UJ3X 1RYYA 1TJ4A 4IUDS 1GTG1 3P27A 3QNUA 4PZYA 3OPXA 1RLTA 2VIIA 1T9GS 3SC4A 3SZLA 3C2QA 4W5TA 3JSAA 3MN1A 1E8NA 4ZAWA 4EKDA 4C6TB 1VCIA 2A30A 2AVNA 3I0NA 1H1LB 1T1JA 2AW3A 1TKBA 5HJ2A 5AKLA 1CIVA 1TM2A 1TCUA 3IIIA 1T8YA 2HGSA 3A26A 3OE7D 3Q3VA 4WGGA 1QHFA 3L8YA 3JYLA 1CY1A 4BJ5A 2I33A 1UM9B 3SS8A 2C2WA 1GDTA 1OIWA 5HZGA 1HKUA 1JYSA 1YVRA 5FR2A 1LPOA 1V3QE 1YS7A 3DOJA 1YK0A 3MTBA 4L9RA 5I5GA 2YXLA 1Y3DE 3QIAA 4XIJA 1NJ6A 5FPQA 4LMAA 3KJQA 5TDHA 1ZH4A 1Z39A 2R1TA 2UYQA 3UM9A 4JDUA 4QE3A 3A06A 1Q84A 1QGDA 2JBAB 5BQOA 3OE5A 2HV8A 2JGDA 1EFKA 3R0IA 4CTJA 3H7AA 1ZVJA 2P27A 2EQ5A 1PDVA 2B1JA 1EFRD 3EBLA 4J7UA 4PAOA 4TSRA 1CHNA 4IOJA 4N76A 2CNWD 4NHOA 3MTJA 3QVJA 1DLJA 2DR3A 2JIQA 3TZKA 3TCXB 2LD4A 4M76B 2W2KB 2N0SA 4R9VA 4BTLA 2Q3JA 1XCMA 3P2JA 3F47A 1DC3A 2NUTA 5EPOA 4XWOA 1T0HB 1V5IA 4EB8A 2ZUFA 1Z0DA 2GUGA 4L8VA 4DDMA 2PA3A 4LYEA 2QRPA 2HPZA 1Z4QA 3KUXA 3GUHA 1YBHA 5FPPA 4ENQA 1XRJA 4PLTA 4HWSA 1DAIA 1P19A 3TLJA 3O8NA 3R3UA 1OWLA 2JLSA 4E0BA 4Q82A 5I7SA 1ZUHA 3IAFA 3QU5A 1L5HA 1A4UA 1U0SY 1C3LA 3DMTC 3JY6A 3MJVA 3IPAA 4MH0R 2XB9A 2A9PA 5FO0A 5IJ0A 4ITUA 3FH0A 1EX9A 2QW1A 4B2IA 6PFKA 4O5AA 3WYGA 2C1XA 1II9A 5DEOA 3RYFA 3JXEA 2HFKA 4XVRA 4KR6A 2CLLB 1TTQB 3IP7A 4NRDA 4P31A 1FRNA 1VL5A 2VRCA 4N49A 5IDXA 2B5VA 5L7TA 4IHKA 1SXJA 1WB5A 2IPMA 4HUTA 2PBFA 2D5BA 4MPDA 3HMQA 1ZM2A 1QDEA 4HH4A 4OYYA 4RAQA 3UJDA 4E30A 5JTTA 4X0EA 3B70A 5M2QA 3C3AA 5AM2A 2JVIA 5CTAA 3DP7A 5EIBD 3L2OB 3LKVA 4AF7A 2DBYA 2XF2A 1HMPA 1UKVY 4NDNE 4AZ0B 2XZTA 5LOVA 1E61A 3IHLA 4PONA 4LNHA 2ZUCA 4G0NA 4NX2A 4AURA 1GNQA 3P9YA 3W2FA 3WGJA 4S05A 3AIIA 3HJHA 4JX9A 2OG1A 4WACA 2J59A 1J8YF 4X93A 5JQGA 5FP0A 3STYA 4W9NC 4E2XA 2RD2A 1R9JA 3BXEA 4AWAA 3GJ6A 3FWZA 3OEWA 1T9GR 3BL5A 4WTOA 4D1YA 5IT5A 2NADA 4RQTA 1JHDA 1T36B 3CRNA 2OECA 2CHEA 2JCBA 2IZZA 4BMZA 2O7NA 1E9CA 3DBRA 2C03A 3KOOA 4IGAA 4XYBA 1N6HA 4YO7A 1HLDA 5EY5B 3ZWXA 4EKNB 1UOEA 2RAPA 4P7KA 1VHWA 3GYGA 1XV5A 3O75A 4H9GA 5EJGA 2OVBA 3D3QA 1J7JA 1E5VA 1KDOA 4WSOA 1WXDA 4FMDB 4TWAA 4ZC1A 1JDVA 1VE6A 4J7CA 5K8TA 3ETNA 3F2VA 3RRMA 4EPWA 1Z5WA 2YFKA 3FNRA 1J2UA 4R81A 4TWBA 5K9ZA 1W59A 2I4TA 1A5ZA 3AOEA 1OH5A 2I7TA 1GKKA 1EP3B 4FGJA 3LW8A 1JT2A 1Y1QA 2BMAA 4KO1S 1L1QA 1QPGA 2ZSKA 3O3NB 3QY0A 2IYVA 3NYWA 3NV9A 1XJ5A 4EG8A 4ZCPA 4KWTA 2IPAB 3T3PB 2VPWA 1BWRA 1G5HA 1U3DA 1ZGJA 1L4EA 3LHKA 2PS0A 3CWZA 1QK3A 2M1XA 5G0SA 3MM4A 3QFSA 3VZQA 5JANA 3OY2A 4WZAA 5K0TA 3MGCA 3ZQ4A 4AUKA 3G85A 3ISVA 3NDJA 5EESA 2AC2A 2Y1DA 5D6NA 4Z3DA 3GNTA 3IDSA 3JWIA 3I04M 4GDMA 4QG7A 2ZUTA 3WGOA 4R9RA 2WJJA 2A0XA 1JQLB 2P9TA 1WZEA 1A97A 4Z4CA 4AF6A 1DQSA 1H8HD 3AKEA 4IQFA 1TUGA 2JD1A 1TCBA 1C50A 2VWGA 4D3SA 3Q1KA 3SFVA 2ZIEA 3D3WA 1UAGA 4HUJA 3U9TA 3NIDB 2VEOA 1OHHA 1UP7A 1QAMA 3FFAA 4TZ0A 1T5BA 1WVIA 1B0UA 3COYA 4AQ7A 2GO7A 2H4HA 1Y1SA 4JL6A 2HHJA 1MV8A 2F3PA 3F6SA 5A0FA 2RARA 3MJEA 4AJLA 4BVLA 4KQFA 5KYNA 2ZZMA 2X4GA 2VAXA 2ZBPA 3FRHA 4BFTA 2ODAA 3ACCA 4UDXX 4BNYA 1NATA 4CN8A 3QMVA 4TV8F 4XB6B 3PNOA 4P98A 3VH2A 3AZOA 4DR4B 2OD9A 3KQOA 1LVHA 4V0RA 4X6XA 4UCXA 3BQMB 4OM8A 1K63A 3IDOA 4JGGA 5LZ7A 1R3UA 5L95A 3H4IA 1M2OA 2W58A 1K0UA 3TX2A 2HU2A 2BRUC 2H08A 2WDZA 5DVZA 1YO6A 4UHDA 1V39A 2M98A 4FPXA 1DEKA 2QTWB 4YX9A 4P4UA 1OH6A 5KS2A 4GOXA 2XTZA 1E1NA 2JKZA 4M36A 5DISB 4JODA 4R8MA 1T8RA 5J43A 3BX1A 4Y2GA 4CM7A 2QQ0A 3CZCA 3LT4A 4G5XA 2EV9A 3QVGA 2O07A 4Y8VA 3FOBA 1KFEB 2OSBA 1DZIA 3HYTA 3VVLA 5JPDA 2WQ7A 2WTEA 4FI3F 3KKKA 3X2EA 4EIWA 3VPXA 1SD5A 1KO8A 1SXJE 3G2QA 1YB1A 1U94A 1UBKS 1DFHA 3VOBA 3VR2A 4CKCA 4LI0A 3FYHA 4DW8A 5FBZA 4MYUA 3H9EO 3IJ5A 1QG6A 1STOA 5D5QA 2CVPA 1CUUA 2UYYA 4BNTA 3OKPA 1R15A 2I3AA 2C4KA 2Q9UA 2XDQA 4IOLA 1LNZA 3DAPA 1P60A 2FJ0A 4YFVA 3D8SA 2XODA 3V1MA 3PLRA 2O8DA 1XZCA 3AUKA 2OGUA 3N6XA 4RJJA 3URKA 2R8OA 2R65A 4BO9A 5LYJF 3L4BC 4G09A 1K4YA 2I2CA 1CRZA 2HCTA 2Z58A 3EZXA 3LCUA 3SC2A 3OBIA 3VUFA 4MKHA 2J9FA 4O4LF 3NHKA 4DUGA 3D1LA 5K0BA 3A4LA 3NO4A 5E9JA 5KDOA 3W6ZA 4L16A 1ZFNA 3SLGA 2W9XA 1ZK3A 3BFPA 3GT7A 3UUWA 2I2XB 1XAJA 4LGMA 5AVRA 2WTMA 3P9SA 5GQSA 3PE6A 2PUCA 2GXUA 4EHAA 3ND5A 4RGBA 2WABA 4MB2A 5F33A 2BTEA 2FWPA 3VVMA 2LDXA 3MELA 5KYWA 2Q49A 3BGDA 1QG0A 3C3WA 4BQSA 1NF8A 4P86A 1LH0A 1RP7A 3BUSA 3CG0A 1K6IA 4PLYA 5JATA 4LW8A 8AT1A 4HB2A 1KSHA 4TN5A 1INLA 1IG0A 3CIOA 3GLQA 3PRKE 3EJ6A 5F3DA 3WHKA 4A6PA 1BFKA 4DMUB 4FXOA 4OXRA 1QFYA 4U2DA 2Q29A 4XFJA 4R7ZA 4D80A 3FUUA 3HCAA 3GVHA 4HGPA 3H5NA 1O6ZA 4RESA 3I30X 1H2YA 2D5CA 4GZMA 2O3TA 1DS6A 2CSXA 4P82A 3TIXB 4UPEA 4FHGA 2VDRB 3ZYZA 1RD4A 1TLLA 4TXHA 3FSJX 1LFDB 2PLNA 3TIIA 1BAPA 2EJBA 1SCNE 1OC4A 2JZNA 1ZWKA 2FWNA 4X7PA 4UMVA 3TZEA 3DZIA 3HM9A 4R1MA 4LRXA 4TUYF 1TF7A 2UV8A 4TYWA 1ZC4A 2QTVA 1DJQA 3GO4A 2Q0QA 3ZWQA 1GUZA 2VTDA 5ALUA 4ESHA 2IOQA 4IIJF 1PCXA 2EP7A 4TWRA 4KX5A 1JLMA 2BHRA 2B34A 5FLEX 5FWYA 3ICCA 4V0ME 3MRXA 5DLQC 1NVAA 2ZIXA 3QEKA 4ZP1A 3MWYW 4FCCA 1QVWA 2FGJA 2YNMC 4OKNA 2R1VB 5FNVB 4ND4A 3G1UA 5JBIA 4KB5A 4NBVA 3THWA 2ET6A 1EAYA 4H4DA 3P4UA 2YIJA 5FUBA 2EL9A 1DMRA 1P3DA 4FDLA 4G4JA 5KOHB 2GARA 1Q17A 2B3DA 2QXUA 3NVMB 1TVMA 3DVRX 2HCRA 3K1AB 2E5LB 2NZVG 2F9MA 3KVVA 1EI9A 1UBEA 3QELA 5G3YA 4TYYA 4L51A 2FK8A 3JQQA 1P6XA 1Z18A 1O0BA 3R3JA 2GB4A 3RU9A 1R8QA 3IMFA 3EGDB 2YC2C 4I4TF 2H5JA 2H9IA 4JI5B 1V1RA 4E51A 5KVVA 2EGHA 3L7NA 4MAMA 5KMGB 1IRIA 4KTTE 3WAJA 3DOOA 4BUZA 4C3VA 3PQEA 4PPFA 1YZVA 2DWPA 4XVUA 4Y9UA 1ENYA 1JV2B 1JHOA 1CY8A 1P1KA 1K6XA 3O83A 3H3JA 4AYXA 1QUFA 3RF7A 3V46A 5CDGA 3CURA 4WRRA 4IFEA 4OVKA 4YRBA 1HY3A 3HA2A 4X45A 3VV2A 4ETWA 4RGVA 3NIWA 1JDUA 2D8AA 2AMYA 2GKOA 4ZYWA 1CE8A 2QW8A 2GM9A 1SCKA 1A9OA 1BIFA 2OENG 2X7HA 3H2HA 4G5YA 3VXKA 2VF7A 5LQJA 1YVUA 1L5WA 3G9QA 3Q10A 4QHSA 4DCMA 3B8HA 3KZOA 4PFQA 3VR3D 4UM9D 4AUMA 4DLLA 5ICSA 3MJSA 1QIEA 1AQLA 1KP9A 1F20A 2W2NA 1MJ5A 2EEZA 5J5CA 3EA0A 3R23A 2JJ2A 3GBSA 3HWSA 4FB4A 3B1KA 1FRVA 3SEAA 4MEJA 3H9BA 1K9SA 4CDMA 3EDMA 3OETA 3LWZA 1UFOA 4HMQA 3T3EA 4R2XA 1NONA 2WHYA 3E9DA 1CUWA 4H18A 5LNK1 2HTFA 1EE9A 4FCWA 1T9BA 4C04A 3H05A 4JB0A 1OU0A 4RBNA 3K6SA 2JFQA 3SSMA 2GDJA 4TL8A 3G68A 4KU4A 4CIDA 3K9BA 4IV8A 4XIIA 4D82A 4KDFA 5LP6C 1YS1X 4OSEA 1Z8FA 5E8RA 1OB5A 4HGQA 1W0JA 1Z6TA 5LC1A 4O2AB 4NZPA 5FI5A 4MLPA 4Z1OA 1G5RA 4L22A 3AL2A 1N2IA 1RU3A 3TNFA 4U7GA 3OO0A 4DQ0A 4YJHB 4PHTA 4EZIA 2E4UA 3C43A 5FWAA 1AKTA 3IAAA 2FSVC 2F43B 2LW7A 4PV7A 4CTOA 2Z5FA 2GJ8A 2HPHA 2CMHA 1DOHA 2IHJA 2Q6TA 1J2EA 2XMRA 2HU8A 2ZANA 1E1RD 3EEIA 3G5LA 3N58A 2NZXA 4NP6A 6NULA 5JEDA 1IZ8A 4Z49A 1O0SA 2A9FA 4BNFA 3ZIDA 2AFIA 1KO1A 1RYEA 4NMMA 4INAA 3ASYA 2PZEA 3DQPA 1IC6A 3A3YA 4RHFA 3UYLA 3ADOA 4Q7EA 4PGAA 1EEXB 1U2ZA 4DANA 1U9JA 2Z8XA 3TGPA 4IH9A 5C7YA 3N2KB 1NSFA 2NNLD 3C6ZA 4LISA 4AJ2A 5J2TB 1KHTA 1GAJA 5DBGA 1EVJA 1Z6GA 1M34E 5EP4A 5AJTA 2HI0A 2PX0A 4JYAB 2QVCA 4Q3KA 1UKYA 1IZ7A 2JARA 1DJOA 1IXYA 3S1SA 3B82A 1E7WA 3Q6MA 2F90A 2B8EA 3HY4A 1MT3A 4OIMA 1NBMA 4YTEA 4AJKA 4F11A 1AURA 1D5WA 2QT9A 2VAVA 3RC3A 4RDCA 4DTIA 3AF6A 1NF9A 1C4OA 1VKRA 3T1VA 3AEZA 1E79D 3L4SO 5A6VA 2RHWA 4XRRA 1AMUA 2PGXA 3QX3A 1TLTA 1XJQA 2F1OA 2VP0A 1I7LA 3INGA 1E0KA 2JAXA 2PR2A 4LJ6A 1E7MA 2D06A 2Z2YA 1X1EA 5F12A 4RO0A 3IP3A 2HMVA 2KMLA 3GHHA 3I01M 3KFVA 2D1SA 5DZSA 4Y2SA 4DNXA 1HOXA 2VZ8A 2PWAA 2R8XA 4L5YA 2ODBA 3HL4A 1Q0TA 3B85A 2KM1A 4RIGA 3H5VA 4GZ5A 3OI7A 5BPFA 1SBYA 4C9BA 4LV5B 3VR6H 1CQWA 2W42A 2GESA 3UKOA 1OBOA 2PAAA 1ZCAA 2V7PA 4M7OA 5KPDA 1O0CA 3MCVA 2X5XA 4CPDA 3EK2A 3TRKA 4LV8B 4JVOA 1EGMB 4JK3A 1PFYA 4QUKA 5AM0A 1Z2PX 1PG5A 1MGPA 1T5TA 1ANKA 1J42A 1MXFA 1TZ2A 1UZLA 3LC7O 2O6HA 4I5GA 4YCAA 5TY0A 4HPJB 1V7PC 1XBTA 2GAFA 4UHBA 2GN2A 1C9DB 3L6DA 4IVPA 4LOLA 2CD7A 2DX7A 3SBOA 2IP4A 4GI3A 5F64A 2P4HX 3TDKA 4GW3A 3UICA 4G1VA 3QLUC 3BTUA 5CM9C 3M2TA 3BDIA 1GILA 1L7AA 1XXHB 4Z0PA 1XZBA 4MUEA 1Z73A 3EVGA 1P2UA 2IPXA 2RBEA 4POAA 2XNSA 2WJWA 3GH3A 4X8HA 2ZT6A 4KR7A 3QJGA 4JYCA 3AVTA 1GP2A 5LMCA 1E9SA 4LZWA 4HDSA 2ZPUA 3GVPA 3E27A 3QSYA 1DJMA 2HNAA 3K4PA 2QRUA 1K27A 4A5SA 4LBYA 1RM3A 1K7CA 3JQGB 5LZ9A 4TLCA 3G2JA 3LPNA 3PRHA 4MIEA 1P1FA 1S7GA 1UWVA 2C96A 4UBKA 1DWUA 1V5GA 4ZGGA 2JCYA 2GZRA 1EM8B 1CNEA 1V37A 3IVMA 4DMGA 2ON6A 3DGFC 3RG8A 2CFCA 4NCAA 4MUKA 1Z0UA 2FW8A 1L7RA 1HFKA 2AS0A 1P1RA 4L5CA 1TZKA 4DWWA 2GJ9A 2VPQA 2PMEA 3R6WA 4FGKA 4F8EA 1Z63A 3LUKA 5B2FA 3BFJA 1SUWA 2HOQA 1GKUB 1PYOA 5BV7A 3WA7A 2ASVA 2Q4OA 2ZJ1A 5K4HA 5E4JA 2TMYA 4L8GA 2SKCA 4M98A 2XVXA 1YQGA 1U9ZA 1XJWA 2HLHA 3HO8A 2PMWB 3L0OA 1Q22A 1R0CA 2FOIA 4PRZA 2JEZA 2WLSA 3OY7A 1B8PA 1EP9A 1FFDA 3DMPA 4FVTA 4K9LA 1N5RA 4LE2A 5E0KB 4EGQA 3O3OB 4H59A 4M0PA 5TVKA 4E5YA 5G0UA 4ZQFA 4JIGA 1KAQA 1USIA 3RTAA 3PITA 2ECOA 4G1UC 1GDHA 3A9TA 2ZBQA 3C8MA 4RD2A 4ZEOA 4OX9Y 4X3OA 1E32A 1CY4A 4LMRA 2I66A 2QXYA 4PAWA 3WDSA 2J0QA 1F8GA 4GU5A 4FIDA 2PSJA 2X4IA 2PRKA 3R5JA 1OVMA 1WXFA 3AJ9A 2P9GA 4NI5A 1RHUA 4ZAGA 4RIHA 1JHRA 1VPTA 3QQ5A 4KQGA 3TNYA 1MB9A 3IP9A 4Z7QB 2E18A 4HNGA 3WWOA 4J1TC 4AO8A 1GRRA 4CCAA 4YJFB 1N9KA 3VVBA 1DXYA 4W9NA 2X15A 3W9SA 3F9CA 1LSUA 1T4GA 3PFGA 3E9EA 3RK4A 2OXEA 2OBYA 2Y67A 2CL6X 4HB0A 2DQKA 5K8LA 4KFSA 1BYIA 2WWRA 4FNOA 3L18A 3DT6A 3VJMA 3BRWD 4TWZA 1K88A 2AK2A 5IJAA 4FKBA 3S8MA 4BU1A 4DQXA 2O0HA 3UG6A 1SVOA 2CFTA 3IKTA 1H2ZA 3M9WA 2OR3A 4MKGA 2DH6A 2AXEA 1Z08A 3FJ1A 3QE4A 2AXQA 4EYEA 5GVRA 1PVOA 1E89A 1SEVA 4QYWA 3U19A 2ILTA 2O20A 2P0AA 3E35A 5LUBA 3LOUA 2B2CA 4C4OA 4UXJA 1YKGA 4R1LA 3T35A 4ZANA 2VNHA 5DWDA 1GGNA 2WV7A 1U2DC 4AO6A 4D46A 1DRJA 2Q5JA 1WO8A 1EK5A 1SK8A 4MWCA 1AU9A 3E9QA 4TV8A 3WKCA 2QLMA 5GJCA 3CVWA 5ALWA 3MS7A 3S29A 3U3ZA 4D0RA 3AY0A 5T3YA 1WHTA 3WS7A 1EQUA 2FPXA 4N3NA 5CVEA 5FCDA 4AJNA 1KDPA 3ZHYA 3TLBA 2BVNA 3RRZA 1J8MF 1Z82A 4RGQA 4Y7DA 1FP7A 3I9V1 4IQGA 2VP2A 1EFDN 1I5RA 1EG7A 1ODFA 1XZFA 1T91A 1ZBQA 2FKAA 2IYTA 2NO6A 2Q4TA 2QQGA 3ND8A 4L95C 4GX2A 3FTPA 4K8RB 4Z3OA 3BJIC 3BS4A 3H3FA 1H22A 1H23A 1FYVA 2VHVA 5LJIA 3A2LA 1UZNA 3E15A 2HT6A 1K7XB 1AF4A 1DBIA 2DGDA 2YHBA 2C94A 1QFJA 3DCIA 4MUJA 4MHTA 3DONA 3FVQA 4I55F 4QJ5A 2XYGA 1N57A 2QZ4A 3ZI4A 5LLDA 1FQOA 1Z0SA 3R3HA 2WUGA 4YAJA 5BMVB 2A1UA 5BQ3A 4TZ6A 4N7MA 3TD6A 4PG7A 5T57A 4BU0A 2VWPA 1ZNQO 4L15A 4WQMA 2QBYB 2E7ZA 4R41A 4QVGA 4QUHA 5TVGA 3DMNA 2FPGA 3GU3A 1PNTA 3ZS9A 3AUJB 2VI5A 3LGXA 3M33A 5FHRA 4LQDA 2JFVA 1SUPA 5LQKA 1G2IA 1V7CA 3CZ4A 5CCEA 3L0YA 2GLUA 4KQWA 1VSQA 4ZQGA 1H0HA 3IE2A 5K8VA 5LYJA 1HL7A 5CPBA 5EXDA 4NU6A 1FOEB 1ECBA 2KJQA 5BNZA 1T24A 1CQJA 1NT2A 3C15C 1X8JA 1VHDA 2BRUA 2C9YA 1G1MA 1P5FA 5DCUA 1AIPA 1U7DA 4RF3A 5KYVA 4CLHA 3I76A 1CZKA 4CKBA 2P1DA 3K94A 4C5BA 2GSDA 2HIAA 2JBWA 1MN6A 3BHJA 3PC3A 3R7WA 4WVLA 1KI8A 1BXGA 2QTRA 2FZEA 3G8DA 4WDRA 1WZNA 1G8HA 1Z8HA 3BWVA 2B0JA 3DV2A 4IJVA 1JHYA 1I2AA 4S1NA 5DNCA 2CV2A 3RSFA 3CW2A 4X92A 5G02A 3T54A 4Q48A 5JISA 1AKVA 3Q7SA 3ESDA 1BW9B 4FQ5A 2HHLA 5GOTA 4INJA 2ECPA 3E8MA 2FA9A 1KJYA 2OCBA 3K9HA 5CYFA 3DZBA 3UT6A 2R96A 2BR4A 4LF6B 1ZGZA 2F1JA 2G9ZA 2GS9A 3MAGA 4M1ZA 3TSWA 3GW8A 1A5AB 5IULC 4BXOA 1Q6ZA 3GMTA 3BDAA 1NTRA 4TQGA 4BVHA 3KKZA 1T8SA 2YWEA 1UZUA 3ORSA 4HDMA 1LY1A 1D4FA 5AKYA 1WTCA 2C97A 1QYIA 1VKZA 5AFSA 1SOMA 4CQLB 4Z4IA 3HU3A 4UBNA 3C97A 4F6RA 5IANA 1VOTA 1PJQA 1S2LA 1VZ3A 5LB2A 3OCYA 1V7ZA 5AKZA 4TUYA 3A0UA 5GZ6A 2BYTA 3V2HA 5FJIA 4K6OA 1X19A 2V4ZA 1S01A 1YZKA 2O2ZA 4K6KA 1XZMA 4IIJA 2NPOA 4QFDA 3SWWA 3KHSA 3NWBA 1AX9A 5AM4A 2CVOA 2GWHA 5KNDA 3I04A 3PBKA 1XZAA 4D97A 1UR5A 3GAAA 5CDSA 3KPJA 3VAZA 5K3CA 1U9IA 1Q0QA 1NW9B 1GKIA 3IJPA 3CCBA 3HYCA 1QMGA 2XHEA 4I2VA 2OHGA 2VDWB 1RC8A 1QPBA 2IHTA 3HB4X 1FUUA 4OXIA 4R9NA 3PZRA 2X0FA 4BNJA 5FOXA 2ZBDA 4C6SA 4J7AA 2ZB3A 1YOVA 2G04A 5KAMA 3TNJA 3UKJA 2H31A 4GE0A 2B20A 1P4JA 3PFNA 5MFZA 1YJAA 1RBZA 2CJXA 4NESA 1TX4B 2Z04A 1GUFA 5T5QA 4XQ9A 4ZU1X 1UMCA 3DLCA 3EUFA 5IVIA 3IESA 3I83A 4B2YA 3RRYA 5LZ2A 1MOZA 2IYFA 4I4TA 4K6HA 1C3EA 4OKIA 4PFJA 1IZZA 3AL3A 1XJ0A 4K81B 5HHTA 2HJVA 1V4NA 3QUAA 4LNUB 3E61A 5DI9A 4IKEA 2J7PD 4U2EA 2YZNA 1DCMA 4Q3CA 3IV7A 1SC6A 2EAUA 3PK0A 3QUCA 2BKLA 2X41A 3DTTA 3GQVA 2JFBA 1KAMA 1W85B 1QFZA 4N01A 4X44A 2YVQA 1RBMA 1E20A 4MMYB 3UTCA 1RM0A 5J4KA 2QVZX 3MHTA 1I13A 4RPLA 2BFNA 4ZXFA 4FKMA 4J2OA 1XTZA 3NWOA 1XTJA 2ODWA 2H52A 1PGNA 1SC1A 3W5UA 3RODA 3E3AA 1CQZA 2W2QA 3EZ7A 2H0AA 5AQEA 4DLXA 1W75A 2YNMA 4EG1A 3KSBC 3HJFA 2YWBA 2O48X 1S3SA 1CEQA 1QOQB 3VX4A 2D0OB 4FMCF 4CCYB 3SZOA 2I6FA 2IZ1A 2ZCUA 3EASA 3ONVA 4JELA 3RJMA 4QT4A 4ZI7F 1GTSA 3IURA 3MRTA 1Q7TA 2XCOA 2PIAA 2GAOA 2RB5A 3GRPA 3LUBA 4B44A 1P0IA 3OJEA 3D8BA 4PGGA 3U3RA 1LX6A 2IUSA 4XW2A 2VWHA 4CVNA 5B3AA 1AKEA 4E2ZA 1AB6A 4YEDA 2VAWA 1PVDA 4IJ6A 3DKIA 5FUVA 4OHBA 2O8NA 5CFQA 4G0UA 3FCOA 4P1ZA 4DV6B 1JT9A 1XLWA 3SDBA 3VU9A 4A2CA 2CHQA 3TTWA 3EPLA 2VQFB 2XUQA 4KXFB 2IS4A 1WEHA 2C2GA 1SG9A 4ARZB 2O57A 1R5OA 2X5NA 3GBVA 5CLQA 3C8ZA 3CKKA 1UOOA 3C39A 3EJWA 4L2IB 1J0AA 2CDRA 4FYHA 4JU8A 1XSEA 4IP0A 5D5HA 3T7JA 4DIUA 1CCWA 3BWXA 3PCTA 3SX4A 5C35A 1MA3A 2IIVA 1XD2B 5AKKA 3AEKB 1NNI1 3FYCA 3L49A 4YDRA 1PX2A 4ZQIA 3O2JA 1BGXT 3OM9A 5K0EA 3M1LA 3IBFA 1QU2A 1B76A 5AW6A 2CUZA 1N8TA 1SWVA 1Y8AA 4MSUA 2XYHA 1PJLA 2X86A 3D1JA 1KPHA 1TW2A 2ADMA 3OCZA 4CZ2A 3EXAA 3F6BX 3GLIB 1PT6A 1TEHA 2IEBA 2MCFA 3TSOA 5M04A 5HCIA 4YDHB 4GM0A 1PGOA 1PFUA 3NXKA 3EAQA 2UUAB 1PLLA 4MCJA 2PT7A 5MFPA 1X7DA 3FDZB 2RBGA 4L50A 1Z2NX 2BGNA 3W0LB 1V41E 4MINA 5KTRA 1EUYA 1E62A 2ZRBA 1PR4A 1T6NA 2QU8A 4XSHA 3VNQA 4EJ0A 5C1DA 4HS4A 3BORA 2COKA 5KNBD 4ARIA 4P0TA 5IG2A 1A04A 3SLRA 5CFZA 2XSZD 1GCIA 4E5SA 3BMQA 4MWOA 4R8RA 2FRXA 4NBRA 1K8QA 5F3WB 3PVSA 2DBRA 3LCRA 4JJ4A 2NZWA 2A7XA 4YECA 4M99A 3P0RA 4N82A 4OHZA 4EQ6A 4IGIA 5IP5A 3UJPA 5FD8A 5DM1A 3CNEA 4NJEA 5ARDA 5JZMA 1MTOA 5HKOA 3LX6A 4ND2A 1GFZA 4AI6A 4CKXA 2O3UA 4RFSB 3VGPA 1Y7TA 2P2SA 4X90A 4JLNA 4CLOB 2HMTA 4WLEA 3BULA 1FLNA 3JZDA 3CZ9A 4DM7A 1G64A 1K8ZB 1D4ZA 2F9LA 2BFEA 3G59A 3MC1A 1B8OA 4PZCA 2R5WA 2Z57A 4X00A 5T4FA 1KAHA 3SR4A 3QKSB 4ZYLA 1MRNA 1U28C 3B8EA 5HRUA 4BV3A 1F48A 2Z8YM 4YAEA 3UFXB 4CXMA 4Q18A 5L3RA 5DGIA 2GM4A 2PH3A 1BOFA 3WADA 2W48A 2PGDA 2ISCA 3M6VA 2P6NA 4RY0A 4RIIA 4WH0A 1AM4D 2E49A 3KOMA