5EJEA

Crystal structure of e. coli adenylate kinase g56c/t163c double mutant in complex with ap5a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDACKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEECVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ligand binding to an enzyme by a conformational selection pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ejeA00
4JLKA 3CF2A 4B48A 1OYYA 5DO9A 3SR0A 3CW2A 1VECA 2A5DA 3TGPA 2HLDA 1AK2A 4YDSA 2PCLA 1RRPA 2E1RA 4F4JA 1E69A 1WP9A 2ZRNA 3GJ6A 4M1WA 1Z06A 1HURA 2VP9A 4G5GA 4LPKA 1AS3A 1IXRC 4E22A 5DGXA 1WRBA 3QXSA 2ZJ8A 3PUZA 3K0CA 1YHNA 3W90A 1CJKC 3PQCA 5EUQB 5EP4A 1RC8A 4F38A 2JLVA 3R9WA 4XTRA 4A4DA 1G3RA 3LDAA 1KSJA 1P9RA 5DHAA 2F43A 3N2IA 1YU9A 2GJ8A 4KSBA 4BLOA 2CHQA 3RS3A 1ZIPA 1QG2A 4EPXA 1GG2A 4TN1A 1NLZA 1FP7A 4TTQA 3L8YA 1JR3D 4B3FX 2F55A 4P3YA 1NKTA 2VSXA 2CXXA 3LLMA 4RJLA 4Z8XA 4YXWD 2ZIAA 3L43A 3QF4B 5DNYB 5CJPA 4AKHA 3X1DA 2Q0HA 5DSZA 1UBGA 1U90A 2FGKA 2HJGA 3KUDA 3K0FA 2ZSBA 1TU4A 5BYJA 3KJGA 3RS5A 3QKSB 2VLIA 4BFZA 621PA 1GVNB 2VTKA 2WM9B 4UNSA 1W4BA 4TMXA 1KAOA 2Y8EA 1RIFA 4M1TA 2ZANA 1FQJA 2QTFA 3B5JA 3PEUA 4AWXA 5KO2A 2Q9CA 1LF0A 4JVNA 3GLHE 3IILA 2ZJBA 1YZNA 1H8ED 3B8HA 4NYMR 3BRWD 4R2HA 1KGDA 2AX4A 2CJWB 4TLDA 5FOWA 2O8CB 1KDPA 4D82A 1KO4A 8OHMA 1SQ5A 1SXJE 2MSCB 4HZUA 4URXR 1RZ3A 2EWWA 5E7MA 2VIIA 3BD9A 3EWSA 4WOPA 1OFUX 1XPRA 2QU8A 4Q1EA 4C0HA 1GOTA 4TT3A 5BN3A 5J4HA 3SJZA 2GZDA 2WJGA 4CEHB 4C0BA 3HDTA 3QXJA 4Q9JA 3OF5A 1MO5A 4X8MA 4B47A 3CH4B 2BWJA 1M2OB 4JMPA 4I1SA 4B3CA 4IOMA 3FFAA 3OE7A 2CLSA 1RKBA 4A2QA 5KPJA 3KQHA 1MT0A 4BLSA 2JLWA 4IFEA 3CF0A 4CGZA 3KJIA 2CK3D 3I4LA 2AHOA 1CKEA 1JJ7A 1E9AA 3A4NA 2G0TA 3FWYA 1E0SA 3LVQE 3HU3A 3LBNA 1U2RA 4JLOA 4MRNA 1CIPA 1CULC 4H1VA 2OLKA 3RLFA 4Q1AA 1ZBDA 2J1LA 4UNNA 1OLOA 1GUAA 2JAQA 5EP3A 2C2HA 3HYTA 3LW8A 5KNCA 2WICA 4D6PA 1U94A 2BM1A 2O8EB 5BN5A 1DAIA 2IYXA 4W5JA 3THYB 1C9KA 4A8JB 4YMUA 1U0HC 2EYQA 3R7WB 4MKHA 3KKMA 5J40A 1OH5A 1GP2A 4IDOA 4B74A 4ZV4A 1XCMA 1E1RD 1L2TA 1F3OA 3QNUA 1JB1A 1OYWA 1XXHE 2OILA 2HYDA 4BFTA 4MRRA 4EAQA 1KO5A 3U3JA 1W5TA 2JLYA 4QOSA 4Q00A 1QG4A 1G3QA 2ZJAA 2IYLD 1SXJC 5DN6A 4Q9HA 5JHGB 1K8RA 1ANKA 3TJZA 1A82A 2QENA 3SS8A 3U3RA 2F1JA 2OT3B 2EWVA 3QG5A 1VCNA 3LFUA 4B3XA 5BXQC 2QP3A 2IEYA 1F2TA 4DLXA 2X2FA 3CRMA 4DDVA 3AKYA 1KOFA 5ELXA 1S96A 2V4ZA 4V0NA 1ZNWA 1OFIA 4D0LB 1FW6A 4DJTA 2Q3FA 4RZXA 2F3TA 1E9EA 1VPLA 5G3ZA 1UBCA 2VP5A 4PC6A 3PUYA 2C95A 3EPLA 1JPNA 4BLQA 2OEPA 1SXJA 4HEJA 3EZ2A 1HE8B 3IIKA 4IEEA 4ITRC 3TQFA 2G6BA 3PENA 4DSOA 4PPQA 5FTLA 1QHXA 2ZE6A 1P2SA 2QTVB 2ZRKA 2HUPA 4FCWA 4DEYA 1OFHA 3AF2A 3R20A 1FP6A 2PLFA 1OV4A 3CLVA 3THXA 3O8BA 3MWLA 2W6IA 2R6FA 1NLFA 3L2OB 2QMUA 2J0UA 2YINC 1G21E 4F91B 1ZP6A 2BEKA 4URVR 5SZIA 2YOHA 2PMDA 3N5CA 3SBDA 2G3YA 3U7HB 3CH5A 1OSNA 3QVVA 1LVGA 1VIAA 1XPUA 3TAUA 4DLZA 1KK0A 4IVQA 1A7JA 1RJ9A 2IX3A 2W58A 3OIUA 1NRJB 2ZYTX 3ETLA 3NBZC 4JL5A 2BBSA 1V5WA 1FPMA 2KE5A 2RH5A 1NI3A 3ASZA 3NBXX 4KBFA 5K8IA 2ZROA 5FPSA 3EZ7A 3K70B 1RRGA 1CS4C 1CRPA 1TMKA 2JJ2D 2BMEA 2N1BA 4Q4HA 4IXNA 3BC1A 4G3XA 2QN6A 1F2UA 3IIJA 2XXAA 2PH1A 1NVVR 2N42A 3QQ5A 1XFAA 3AV0B 2NO1A 1TF2A 1YR8A 2D2FA 4AC9A 2Z6VA 4XVRA 3U7FB 1HYQA 5FUWA 2ORIA 1G64A 3CR7A 5JBQA 4XJXA 4TYQA 1X86B 4GBMA 5DIFA 3CKLA 4V03A 1OPXA 3HP1A 5KDOA 4NMMA 2Q9AA 1EWRA 1SKYE 1DOAA 2ZPTX 4LHVA 4EFNA 4EPVA 4E07A 5FPHA 3G0HA 4TMVA 4NZYA 4LV8B 2G0NA 1GIAA 4PAQA 1KNXA 1XX6A 2EFCB 4ZDIA 1WQ1R 4DDTA 3H4MA 3QKTA 3R7WA 1JQLB 2J87A 4XD7D 4EUNA 3QPUA 1QF9A 4ZDWA 1T5LA 2DFLA 2CHGA 1F6BA 2R65A 5C4GB 1DE0A 4Q7KA 1UAAA 3LX5A 3HJNA 1KMQA 2JJ2A 4ZIRB 1CJTC 3QBTA 5AUPB 4LJ9A 4OQLA 5FUYA 5F3WB 1CR4A 1YE8A 4LRWA 3UPUA 4RD1A 3OAAD 3E1SA 1AZTA 2AL7A 2QRNA 2QP4A 2RHDA 4OHVA 1J8YF 3P20A 4UJ3A 3A1SA 4ARZA 2WKQA 3EIQA 5G53C 3L0OA 4JSTA 1VDZA 2P67A 3QG1A 3SZRA 1VMAA 1S8FA 3AF1A 2D3WA 4F92B 2XITA 2YV5A 2QT0A 1D5CA 1G4AE 3UWKA 3LX8A 3T1QA 5FL7D 5HCIA 3B1ZA 3ICEA 1Z6TA 2PZGA 3QOFA 3VQTA 3T35A 3DZ8A 1G7CA 4TMZA 1M7BA 2B8TA 2TMKA 3ZVRA 1G1MA 4M1YA 1XEWX 2PBRA 5SZHB 1CJMA 2DY1A 4OQNA 1HUQA 4D0NA 1UF9A 2R8RA 2NGRA 2RCNA 1TQ2A 1VHTA 3OIVA 4OHWA 3VU9B 2FPKA 3UG7A 5HCNA 5C18A 3K53A 2EQBA 3LD9A 2P65A 3WNBA 2HT1A 1TUEA 1G6HA 1ZYUA 1ZC3A 3LO5A 5FPTA 2Q21A 3EXAA 4O3MA 2CVHA 2JDID 4UXJA 3PXGA 1E9RA 2GBLC 4LJ5A 1UBFA 3TE6A 4V0KA 1TADA 1XMVA 1D9ZA 1VYVA 4QBHA 1Q0UA 2EW1A 5BN4A 3QPVA 3HPQA 2VPPA 2ZRLA 3Q9LA 4S2EA 4TLEA 1MV5A 2NPIA 4PC7A 1IN8A 4PX9A 3FHOA 5G41A 1E2EA 4U02A 1QBKC 2ONKA 1EFRD 4LV6A 4LY6A 2ZS8A 2ZRGA 4IJMA 1VCOA 2IYWA 5CDFE 3GMTA 1TTTA 1NG1A 3CPEA 1JECA 3GQBA 3N2EA 4CVNA 3KQKA 1IN6A 2G77B 2XJ9A 4Q21A 1YJ5A 4B71A 3I8XA 4GL2A 4PAOA 4EKDA 1NY6A 2YC4C 2BCJQ 2A30A 4JVLA 3T61A 2X19A 5TDHA 4HAXA 1DAMA 1ZNXA 2NG1A 1N6HA 2EFDB 4LV5B 2XNDD 4QHTA 2BM0A 2YNMA 1E32A 2VHCA 1UM8A 2REXB 4W9MC 2OBNA 3H86A 3PUXA 3UK6A 2WJYA 1EFTA 4ERNA 3UIEA 3LBIA 2Z5FA 4RSGA 3QXCA 4PHHA 4QM6A 5FOXA 1M6NA 2JLRA 3AEZA 1KKMA 1W5SA 1Q44A 2DB3A 5IK2A 2AXNA 3ADBA 1KNQA 2O8FB 2I4IA 2GWHA 2IYSA 3GFPA 2YKGA 1T3LA 4AK9A 1EFRA 3AKEA 1EX7A 2OBLA 4KLNA 1KZGB 3EARA 1X8JA 4D4MA 3E2IA 1AIPA 3QXHA 4LJYA 5K8LA 4TYNA 4TSFD 3IDQA 2GAOA 5LB4A 1KJWA 4C9BA 2JLXA 1NKSA 3PUWA 4HLDA 2FFHA 3CR8A 4D26A 5JWHA 3FOZA 2GXQA 2MSEB 4IOLA 1CJUC 4LHWA 1HT1E 2CNWA 3K9LA 4C0LA 2CL0X 3QBVA 1CU1A 5IHPA 3RWOA 2XEXA 2WWYA 3IQWA 4NYIR 3MWJA 4HZUB 1XJ0A 1KJZA 1Z47A 2P3SA 1QHYA 3A1UA 2OFXA 3VR4A 3U60B 1TAGA 4LZZA 3ZZTA 2YOGA 3EC2A 1FX0B 3QKUA 2GCPA 2J3EA 5L3RA 4S35A 4PHGA 4ZI2A 5BWMA 5AJWA 4R7ZA 3ZLJA 2VHJA 4KFTA 1E2NA 2J0SA 1MO4A 4LYJA 4CT5A 1G291 2YYZA 3NIBA 4L9WA 4BFSA 5B64A 3AUXA 1MOZA 4HUQA 4Q66C 1QVRA 3AVOA 5JS7A 4JBYA 4A92A 1NVUQ 4XSHA 1SVMA 1YZQA 4Q1CA 2JA1A 4TMWA 1ETUA 2ATXA 3KJEA 3RS7A 5EUMA 5FOUA 1PVOA 3K9NA 1N3BA 4EPTA 3OE7D 1Z6XA 2OFOA 1GWNA 1XD8A 4HB4A 1FMLA 1E1RA 1UKZA 1DO0A 1VG9B 1ZCAA 3GLGB 2PJRA 4HATA 1W36D 5J5CA 1IJFA 1W4CA 1NBME 2GJKA 3WMGA 1ESMA 1MABA 3S1AA 5AUOB 3WRYC 1BH2A 3EG5A 1QDEA 4FMDF 4BE7B 5D3QA 4LHZA 3THOA 4RY2A 2NTYC 4DXAA 3C7KA 1UKYA 1VTKA 3U4QB 2XJ4A 4H9GA 1QHHA 3GCGA 4FMBB 1P2TA 4HB2A 1EX6A 3V9PA 1Z63A 4HLCA 2Z4RA 1ZM4A 1EESA 2JJ8A 4NE2A 1DELA 4NYIQ 2WTUA 2BVNA 2G1KA 3I92A 4JZKA 1E9BA 1QZXA 4TWZA 3R9IA 2WKRA 1ZCBA 2YWGA 4XTCS 1NJGA 4NU0A 4DCNA 2GEUA 1U98A 5JLJA 3BB1A 2F9MA 1ZNZA 3DM9B 1HY3A 4PPNA 2NO7A 2PEZA 3IEUA 4Z1MA 3O8CA 3RWMB 1JI0A 1YKSA 3AM1A 1IN4A 5TMPA 2JLZA 4AKEA 3OAAA 2PEYA 3ZVNA 3TMKA 1KI6B 3KXIA 1XJCA 2ZR7A 5AWFC 4BFVA 4QRHA 1OKKA 2PLRA 3NTUA 2W6ID 1JJVA 2P5TB 4KCGA 5CK4A 3DOEA 4ACBA 1MR3F 2QGZA 4LGMA 2VH5R 3QKRB 2ZJZA 2RGDA 1M34E 3FB4A 4B6FA 3BOSA 1Z22A 4RFVA 3AVUA 2WWWA 5FOTA 2QQEA 2P6NA 3GLGE 4TZ6A 4QBIA 4HSEA 4OK6A 4ZKEA 1Y3AA 1JR3A 4O2LA 2GVDC 4R98A 2CCKA 3VR5A 4LCBA 3IBYA 3THYA 2EU8A 2ZRJA 3Q85A 1M74A 1NMXA 4F4CA 2ECKA 3THWA 4DBLC 1E2FA 4KBGA 4M1SA 1I4TD 1OXTA 2VHUA 1KK3A 1XTRA 4NONA 2FSGA 2ZE7A 2WMNB 4ASUD 3A1TA 5B2ZA 2QBYA 4PZZA 4J0QA 3L0SA 5JHHB 1G4UR 5IF9A 4HI0E 1AKEA 1KJYA 2J7KA 3ZDQA 4OI4A 3WNDA 4Q7JB 1U0LA 4U5XA 1QRAA 2EYUA 1C1YA 4LYAA 1OXUA 4PZYA 4MKGA 3F3YA 1F2UB 3AVQA 2HDNB 2FWRA 3VX4A 4PPFA 4LBWA 1Q21A 5AJVB 2X2EA 2IC5A 5CLQA 2RGXA 3B1WA 4MGKR 2ZI4A 4TYWA 1UDWA 2WMOB 1QHGA 2OHFA 2ZSAA 4RZUA 3K9GA 4LK2A 1JXMA 3CZPA 2DCUA 4HB0A 3A4LA 3I8SA 3ZJYA 4MYCA 5KSPA 3JVVA 1NN0A 5B57C 4KFUA 3TAHA 4Z54A 2CE7A 2ZRBA 3KKNA 3AKCA 5GJVC 3BB3A 4PSAA 2RMKA 1NP6A 1OH8A 2B8WA 3M1IA 4R9UC 3FKSD 4B76A 1G8HA 4BFUA 3ZZUA 2RGNC 3SN6A 3M4YA 4I1UA 1GKIA 2ZR9A 1OIWA 2OCPA 1XF9A 2PX0A 3T34A 1AM4D 1YRBA 2CCGA 3TSOA 3DDCA 5CK5A 4GOKA 3QEJA 1IONA 2BHRA 1EGAA 5JJKA 2VQSA 1E2HA 5FBRB 1LTQA 1CLUA 1R6BX 4GP6A 1OF1A 2VO1A 2V55B 1XNJA 3I73A 1BO6A 2CEAA 4HLUA 5AJXA 1DG3A 3X1WA 4XD7A 1KI3A 2DFTA 2VYFA 1TX4B 2XTNA 4LJ8A 1RJ9B 5FL7A 2QMOA 1E79D 1WBBA 1B23P 1E9CA 4FMCB 2GHIA 1HE1C 1GRRA 3PEVA 1KK1A 1Z5ZA 5FBQB 2W6JA 3LNCA 1GSIA 4PC2A 3GP8A 1G18A 1AGRA 3DMDA 2RAPA 3RVBA 4TMKA 1X6VA 1FL9A 1SVLA 2ZU6A 3KKPA 1U8AA 1G9XA 4Q4HB 1WF3A 3HYRA 4OL0A 2VP0A 3FKSA 4NDZA 4Q19A 2DBYA 4A6XA 1DPFA 1E2JA 2FFBA 3RC8A 2OG2A 4N1AA 2QPTA 4Q7MB 5E7JA 4TTPA 1G5PA 2KJQA 2XTMA 2GVZC 4TTRA 3V4FA 3VR1A 1P4SA 3EAQA 2V1UA 1UEIA 1FNMA 2WWXA 2QMEA 1VG0B 3ZIAA 4TL8A 1X3SA 4F4IA 3AQ4A 1TF5A 3IHLA 3K8YA 3KB2A 3SFVA 3KUCA 3B60A 1Q1ZA 2OXRA 3X1YA 2AFHE 3IKJA 1G3IA 1ODFA 3CX6A 3FMPB 5DISB 3BGWA 2ZJ2A 4KFRA 4PR0A 3MCAA 3NH9A 2EFEB 3GEEA 4BLPA 4A8JC 1HQCA 2OCYC 3PG5A 4TQ9A 2O8BA 3SC3A 4TLAA 3AVXA 2WWIA 3DHWC 3THWB 2NMVA 4QBGB 4GZMA 1RPZA 1GM5A 4BEJA 3MAAC 1AQUA 1CTQA 3K09C 1VG8A 4JJKA 1BYIA 3B7GA 2IUTA 1JR3E 4QG7A 3KFXA 1D6JA 2JGNA 3DL0A 1JBKA 1SZPA 2OAP1 4M9ZA 2BBTA 2ZAMA 4ILEA 4CEJA 2XB4A 3KKOA 1G8PA 1A5TA 1KTVA 1Z6AA 1M8PA 1XB2A 5FPKA 2QNRA 4KXFB 2JIZA 4JYCA 5JCPA 2CLCX 1A4RA 3FPAA 3NWJA 3L0IB 4EFMA 4M21A 4ZCIA 2MMGA 4CZ2A 3VKWA 2IS1A 2ZI3A 2YWFA 1YR7A 4NL4H 5KSZA 4DSUA 3ZGXA 2IXGA 1RRCA 2DYKA 2HT6A 2ATVA 3NC0C 1DG1G 5L3SB 5FL3A 5H70A 4ON9A 4A82A 2YC2C 4C7OA 2ASEA 1JALA 1KO1A 3I32A 1N5JA 2BEJA 2J0QA 3RS4A 2FE4A 4BEBA 4A0FA 3WBJA 2NOAA 5E95A 3RDPA 1PUIA 2FJUA 3SU8A 1OKKD 2QAJA 1LFDB 2ZRCA 3H2YA 5FH9A 4P0TA 1RFLA 4FIDA 4G01B 5SZKB 4CDGA 3VR3A 2W2XA 1NVVQ 2I3BA 5HZKA 3L0PA 3ZVLA 2OUKA 2XZPA 4EJSC 4EQ6A 1JNYA 2YJTD 2VP2A 1OHHA 2C77A 3HPRA 4Q4LA 2D2EA 2WJHA 2ERYA 5DLQC 821PA 1LY1A 4TSFA 1A2BA 2ZS9A 2IHBA 1ZJ6A 2DPXA 3CNNA 4JL8A 1HA3A 4B32A 1SVIA 3UANA 1Q3TA 3DVLA 1XBTA 4N3NA 4JS0A 1S9HA 2YVUA 3T1OA 4JLJA 1SKYB 3FFBA 1E94E 1ZINA 4KYUA 3AVWA 5K8TA 3SOPA 1W2GA 2F1HA 3ZS9A 2PL3A 3RABA 1WB9A 4N0EA 3LLUA 2J0UB 2D06A 1TEXA 2ZREA 4ASUA 2VEDA 1P72A 1R5NA 1N2CE 3Q72A 5AJZA 4FCTA 5GJBA 2HXYA 1XEFA 3BWDD 2OE2A 2QG6A 4RKFA 5KYKA 4KLZA 2LKDA 5CM9C 2RGEA 2BMJA 1SVOA 4JLVA 5FUXA 3A58B 4WVFA 1GNQA 2CDNA 3NH6A 1ZM9A 2H1LA 1P5ZB 1EFUA 1SHZA 1JAHA 1Z07A 2IYRA 1YZUA 1K5GA 4POAA 1XXHB 1D8TA 3NEJA 4MRSA 4BASA 5TVKA 1R0XA 1NY5A 3B13B 2VSFA 2Z0MA 1H8HA 3AP3A 2B92A 3S1AB 1UPTA 3RAPR 5FBWB 2XZLA 1W4RA 3LVRE 3EIHA 1BKDR 5FTKA 4MQBA 3TUJC 1BOFA 1R10A 2JCSA 1VYUA 3NKVA 4AY2A 2QL6A 2IYQA 4XWKA 1KDTA 2IK8A 3TIFA 1GDDA 2WSMA 2X77A 2R6CA 1N0VC 4K81B 1DO2A 3W3AA 1BMFD 5P21A 4HAWA 3QIAA 4LBZA 1YRAA 2BJWA 1KZ7B 1W0KD 4I4LA 2ODWA 4MUBA 4LPSA 3WYGA 2ZS7A 4IVPA 2E9SA 1E3MA 4ZO4A 2YHSA 4PSVA 1XCPA 3NDPA 1LNZA 3ICQB 1LF5A 4MKFA 1LB1B 3NBYC 3T5GA 5D3MB 1P2UA 3EWAA 1HEIA 4Q9KA 4JT4A 1Z0FA 2GAAA 4Q4AA 4TYPA 1P60A 4X8OA 4XVQA 3GLFA 1G3MA 1W7AA 4IDQA 2B7BA 3GLHA 4QL3A 4M1OA 1E2QA 2IYUA 1G8YA 3DZDA 3MWKA 4LBYA 3MGCA 2HCBA 2GEVA 1G17A 3QKRA 4M4SA 1EK0A 2ZXUA 3F8TA 4Q01A 4IHQA 1WBDA 2J7PD 2RGCA 3AKDA 2WAXA 1CBUA 3IO5A 1ELOA 1G7SA 3Q7QA 5BW8A 4QJ3A 4OJQA 4YLGA 3CWQA 1S1CA 4DT1B 1OXXK 3GJ5A 3BJIC 3SNHA 1E2LA 3D7MA 1VKJA 4W5HA 2F7SA 2R9VA 1OH7A 2A9KA 1P6XA 3TVTA 2OBMA 1XZQA 2WPDA 4WXRA 1AS2A 4Q48A 1PLKA 2QPOA 2ZYWX 5TARA 4B35A 3B9PA 2W00A 4BPBA 3CRW1 5JCZA 1P2VA 4NCKA 1H65A 4DLTA 4FMCF 4PQFA 2AWNA 2R6GA 2BOVA 3B82A 3BS4A 1GAJA 1E0AA 1KSFX 1RYHA 2V54A 4G1UC 5M04A 3R8CA 3TW4A 2FEMA 4RD6A 2IF0A 2IBMA 3SDZA 1CR1A 221PA 2CNWD 5HKKA 1E2GA 1WE2A 4DLUA 3O47A 1JAIA 4NCIA 3GJ7A 4YC7A 2GESA 4FINA 3UWOA 4D4KA 4MUAA 1T5IA 4DCVA 1TL7C 4M9QA 5G40A 2JIZD 4PQYA 4CEHA 2VP4A 4NH0A 1N6KA 4G5QA 1JEEA 5H1YA 4A1FA 1J7KA 2QAGA 5KHOC 4LX0A 2FPMA 2QZ4A 1W46A 5CYOA 1T8TA 3RRZA 2J41A 3T1TA 1LS1A 3VR6A 4Z8YA 2HV8A 1R0YA 3SHFA 2ZJ5A 1DEKA 1NIJA 3MRSA 4C0KA 3TW8B 4DWJA 5JZVA 3DM5A 4WW0A 2ZRPA 2P6UA 5ANRB 4A2WA 3K70C 2IWHA 3W6OA 3WHLA 2BKUA 3VNUA 4RCYA 3NVAA 2CCJA 1MO6A 1L4YA 3SI7A 1Z0IA 4LSGA 5JJIA 3SHWA 3KQLA 4NYJR 2O8CA 5EP1A 1IN7A 1AQYA 4DSTA 4YMTA 2WBLC 2ZSEA 3BAFA 2J9RA 3C15C 1XDBA 5FTMA 2FSIA 2W0SA 1TUIA 2GZHA 4W5WA 5JECA 1OXSC 5FOVA 1G20E 5LDDC 1O3YA 2BV3A 2QE7D 2WHXA 2XGJA 2O8EA 2F6RA 4U00A 4M1MA 5CIQA 1COWD 3CBQA 4TL6A 5KDLA 4JVMA 3T12A 2G9NA 4A8JA 4DCTA 5FBVB 3OEHD 5A5GA 4QNRA 4ESVA 4JIMA 4AYTA 1KI4A 2O5VA 2WWGA 1OHHD 1Z0JA 3CWZA 4PC3A 3M0EA 4YMVA 2W2TA 3JZMA 2F1IA 2FN4A 2JJ1D 2XOKD 5F2EA 5D3MA 3H1TA 2JATA 1E79A 2Q3HA 4JBXA 1MO3A 2MMCA 1E4YA 5B30A 4CYMA 4JJZA 3EA0A 2JEOA 1T0HB 1NVXQ 1F48A 1KDOA 2W6JD 4HLUC 3NXSA 3GFTA 3H0KA 1DARA 4B43A 4BUJA 2ZU0C 2HLDD 5JEDA 4ZDKA 3FDIA 2FNAA 1PZNA 1N6PA 5FR2A 1TPZA 4H1UA 4BLTA 2R6DA 4KAXA 1R2QA 4LC1A 1UJ2A 1XTJA 1IJEA 5IRCD 3I1FA 4AD8A 2QTHA 1NMZA 3QENA 1N6RA 3I3SR 3TH5A 3W9YA 1OB5A 5CLLA 1CRQA 1ZUNB 1R8SA 4FXPA 3T1VA 3KKQA 4OK5A 3OEHA 2J0VA 1NN3A 3SJBA 1X1RA 4OK3A 4Z51A 1KO7A 2PT5A 4US2R 3BH6A 1GTVA 2XX3A 2BDTA 4KVGA 2O0KA 4Y0AA 1OFTA 4PZLA 2BC9A 1KSGA 1N5KA 5B58C 3NDBB 1TNDA 3B78A 3ONWA 4OQMA 1U8ZA 4KI0A 4OYHA 2JLQA 4PAMA 5DI3B 2WZQA 5JS8A 3PEYA 5E7IA 2QT1A 4L4UA 2EFGA 1YZKA 3P4YA 4JLAA 4K46A 4RD4A 2OCAA 1W47A 3GJ4A 1I2MA 1PLLA 3P27A 4RZ3A 4TQUS 2FPLA 4MDFA 2D7CA 2AWOA 2WSSD 3PR1A 2WJVA 3QF4A 2ZRHA 4XVUA 4C0JA 1BMFA 3ZVMA 2H16A 4D81A 1FTSA 3AGPA 2GEDA 4NCJA 3D3QA 1N6LA 1ZVQA 1GFIA 4A0HA 3ZYCA 4JL6A 5TY0A 2ZUBA 1Z29A 4L16A 4R2IA 2IHYA 2A7QA 2J59A 3E5HA 3EPJA 2W2VA 1EFHA 3BE4A 1YR6A 2ZRDA 2L0XA 4Q5IA 1E2PA 1ZM2A 2VHTA 4FMDB 4R71A 2BJVA 5AUQA 1FUKA 1GL7A 2UZ3A 2V8OA 1KAGA 2NPFA 3MMPA 3KXLA 2I1VB 4YMWA 5E4FA 3FMIA 2WIBA 3Q3JB 3P4XA 1GKYA 1L7VC 4LUCA 5H68A 3D8BA 4LJ4A 4B3BA 4GZLA 4HDQB 3TRFA 3WXMA 2QY9A 4B2IA 3ADKA 5CJ2A 2IYTA 1VCIA 3FMOB 3PVSA 4XIGS 1KI6A 5KSOA 2YZ2A 4RFSB 1XJQA 3GEHA 5FPYA 2YOFA 1T4GA 1J70A 5CB6A 3CRVA 2PZEA 4PQRA 2Q9BA 1N5IA 4OKSA 1Q22A 4RCZA 1IBRA 3RSOA 5KU1A 4DVGA 1YR9A 2F9LA 3RC3A 3UMRA 5F9FA 2FH5B 1ZM3A 5C1BA 5K8UA 3KTAB 2H5EA 2WIAA 4P4TA 3EX7C 1X1SA 2AR7A 4CEJB 2FZ4A 1KK2A 2G83A 3VR2A 1L4UA 4ZPXA 4C7OB 1E0KA 1VIYA 2FX3A 2PCJA 2QPAA 3AH8A 4L5BA 1HTWA 1OT3A 3OESA 2P5SA 3P26A 2HF9A 3C5HA 4V0MA 2AD1A 1E9SA 3Q7PA 4JKIA 1FQKA 4WA7A 4NP6A 3WP0A 1SVKA 1E1QD 3NG1A 2P6RA 1WXQA 1MRSA 3VNVA 4IEIA 4UQOA 1OJLA 4OI1A 3KQUA 3OEEA 4CEIA 2IW3A 3OHMA 1E98A 1NSFA 1U0JA 5L3SA 4BZPA 1YVDA 1PV4A 2BMFA 4MYHA 3U44A 5HE8A 2O52A 3CONA 4URWR 1Q3HA 2JDIA 3W6PA 4WZBE 2AN9A 4B34A 3A1VA 5CYPA 3PIRA 2A78A 2ZVPX 4KYIB 1IY1A 5L3VA 4XWAA 1KKLA 1L8QA 1N0UA 2ZJOA 4HAVA 4XOIA 3TR5A 5FTJA 5KOYA 1TQ4A 5DYIA 2OLJA 1OE0A 2RGGA 4RD0A 2OXCA 3QVUA 2O8FA 2GBLA 2C9YA 3UKDA 2ZI7A 1CEEA 1GRQA 3J81k 2ZSDA 3EASA 4Q18A 5AK0A 2IUUA 2GETA 2ZI6A 1NN5A 3L82B 3TQCA 3U5ZB 4DB4A 3LW7A 4IKEA 3DO6A 1G5RA 4AIIA 4IFBA 4A0GA 1E1QA 2GXSA 1R8QA 1SXJD 2ZUCA 4GOJA 1XRJA 3ADDA 3O8RA 1XD2A 4DUGA 4EJSB 2D4HA 4PC1A 2HF8A 5AUNB 4GPTA 4ZI3A 2VHQA 1ZD9A 5EE0A 1O87A 4FWTA 1J90A 2C04A 2ZI9A 4KODA 4PTLA 3N70A 5KPDA 4LHXA 3CPHA 2YWEA 1NIPA 4QBFA 1MRNA 5LD2B 4PFSA 4HAZA 5FUVA 5DI9A 4G5SA 1DAHA 4OI2A 1RW4A 3THXB 2R44A 2NZJA 4MA4A 3RRYA 1E96A 5J4YA 1NNEA 1G7RA 3KB1A 1S9DA 5L3QA 721PA 3LH5A 4KV9A 4V02A 1UKEA 2WJJA 3A6PC 2IS4A 1DAEA 1PUJA 1Z8FA 2IEZA 3NHBA 1J2JA 3U61B 1R0ZA 3FYHA 2IUSA 3LQQA 2VF7A 3E70C 3BFKA 3BB4A 3V4RA 1NMYA 4TQAA 1N6OA 2A2ZA 4X8LA 4A0RA 5JSZA 2R2AA 3WP1B 4OHXA 3Q8XB 1W49A 1D2NA 2PX3A 2QROA 1Z08A 2FGJA 1XTKA 5A0FA 1D2EA 2QAGB 1XD9A 5GVRA 1JEDA 3I62A 1SXJB 1AA9A 2KBFA 4JYBA 2KI5A 1DADA 4HAUA 2OESA 4GSYA 4B2LA 3AVTA 1P9WA 5FTNA 4DZZA 2XXAB 1KI8A 1M7GA 1W1WA 5BYKA 2ZM5A 1XEXA 1QHSA 5TB5A 5FOSA 2FDCA 3P1JA 2RGAA 1GRNA 2FG5A 2G1JA 1P61B 2WJIA 2Z83A 3B85A 3CPJB 3MUFA 3U3KA 5HPYB 1XEWY 4D4LA 4JVSB 5JWOA 2VSOA 2RKOA 4GNKA 2VP6A 3QSYA 3RYTC 1CR0A 1K6MA 1EXMA 2EFHB 1S3GA 4E03A 1HT2E 5TV2A 5J4KA 5KUTA 3BH0A 1RYFA 1N6NA 1US8A 2GRJA 3EZ9A 4EPRA 4Q4AB 2XNSA 3CO5A 2ZEJA 1WCV1 2GK7A 3LV8A 3QXXA 2WSSA 2V1XA 1KMHA 1NSTA 4OQXA 1G41A 5EXXA 2VA8A 2RB4A 2OZEA 1FX0A 1U9IA 1GL6A 3WRXC 2J5XA 2GK6A 2ZITA 2KBEA 1CR2A 4JT2A 2C78A 4OQFA 4MKIA 4BFXA 2ZETA 4B73A 2FA9A 4IOKA 2FU5C 5EE3A 3NEYA 5SZJA 4HB3A 2YWHA 4HUQB 4ZDJA 2GTPA 1YZLA 3CX8A 4UXIA 4WXPA 5F98A 1F60A 2OSBA 4M53A 2C99A 2FOLA 3HU1A 2O8DB 1G5TA 1VHLA 2OCBA 4NYMQ 2PMKA 4AYXA 4DT1A 5C4MA 4WBSA 2ANBA 3TLXA 1LW7A 3IIMA 2ODEA 5EXSA 2IYZA 3GEIA 1DTSA 4M2LA 2D62A 2XSZA 4NPHA 3K70D 5BQ5A 3MG9A 2IA5A 1ZNYA 4LJAA 4IDHA 1MABB 4B2PA 3TSZA 2QEQA 4P4SB 4PSKA 4ACAA 5FI1B 2O0JA 4JBWA 5EXPA 4C3ZA 1JR6A 3ECCA 1E9DA 4X8HA 3CNOA 2OFWA 2RHMA 2GJSA 3JZAA 2XAUA 4O25A 2C96A 2DWPA 1E2MA 1WA5A 4WZ6A 3CNLA 5JMTA 4AKGA 2QBYB 2A5GA 1GZSA 1G8GA 4B6EA 4LOAA 4DKXA 5LB2A 5JRZA 3FHCB 3TSWA 4DHEA 3WMFA 1QVAA 4W7SA 1D9XA 2AKYA 4OJKA 4DRZA 4ARZB 3Q5EA 3EZ6A 2VRWA 3V00A 5CM8B 2ZE8A 121PA 1UFQA 5IT5A 2WWHA 3CIOA 1JQJC 4FD2A 4HAYA 3PFIA 3GD7A 2C8VA 1CP2A 4LYHA 2Q3MA 4M1KA 1WMSA 1X8LA 2GCOA 2ORWA 3LQRA 3IPXA 1KI1A 3C16C 3VHLB 4CT4B 1GITA 1E2KA 3B1VA 1NLYA 3IPYA 4U7DA 3OEED 1T8UA 1NVWQ 4NHOA 3VFDA 3EC1A 5EP2A 2ZTSA 2OM2A 2FMXA 3WNCA 1QHHB 1ZU4A 5HZHA 4RZ2A 1W0JD 1AJEA 1ZD1A 1KHTA 3K9HA 2VL7A 2WWFA 3A4MA 3QF7A 4IDNA 3RHFA 3TUIC 1R4AA 4NCHA 1U81A 4K8OA 3MJHA 2UKDA 2FSFA 1B0UA 4D2IA 4WIAA 5TXGA 3BIFA 4Q1BA 5IK2D 1Z2AA 1MKYA 3GLIE 2DHRA 1XTSA 1KY2A 3ZD7A 3ND9A 4QGAA 3P32A 4BWYA 3U3MA 2QM8A 2CJWA 5DE3A 2EVWX 1S1MA 3EPHA 4MH0R 3IQXA 1OH6A 1XMSA 3OFND 3B1YA 5G3YA 3IHWA 4Q1FA 3U6BA 1Z2CA 2WPDD 1SHKA 1BIFA 4P33A 4DCSA 1MH1A 2QM7A 3C14C 1IY2A 421PA 4URYR 3QI2A 3VMFA 4AG6A 2Z43A 4YONB 4PXAA 4EIWA 4BZXA 4Z1MD 1LV7A 3KTAA 1DVRA 1XTIA 4KO8A 4JLBA 5EE1A 3TKLA 3O8DA 2GF0A 5GADl 2J7PA 4PPGA 5GVSA 3GJ8A 2QORA 2GKSA 4QFMA 2ZVQX 1GNPA 2B7CA 4A36A 4ZCMA 2XZOA 4OHYA 4EPWA 4DIDA 5HKKD 4B3GA 4EFLA 3A8TA 4E09A 1Z0KA 5KDDA 3U7GA 3C4JA 5JFGA 4Q4JA 2H18A 4DLSA 2GILA 2C5LA 2KSQA 2GXUA 3CZQA 3KDSE 4Q02A 1Z3IX 3ZS8A 1M7HA 2AD5A 2B21A 2C98A 1N25A 1Z0AA 5C46F 1G16A 2Q6TA 1ZRHA 4QXAA 3RNLA 3BORA 3OFNA 1KO8A 3RRNA 4AURA 4LI0A 4QGGA 3B2EA 2GJAA 4NBSA 1E4VA 2BKEA 4C30A 2KB0A 4V0ME 1NF3A 2JLSA 2VF8A 2XTZA 4TT3D 1JPJA 2GZAA 4QGFA 2CMKA 2IT1A 5DI3A 2IF2A 2ZRMA 4II7A 1KI9A 1XU4A 2AK2A 1OW3B 2X8AA 2AFIE 3REGA 3RS2A 2A5JA 3DMNA 1S3SA 4RD3A 5EZ5A 5DH9A 2FZLA 5H8WA 4OI0A 3QPWA 2FV8A 1VG1A 4DB2A 3T06B 4GMXA 3OZXA 4UJ5A 3TBKA 2NO9A 4A9AA 4A15A 3TNFA 2ZJYA 1P73A 1IQPA 4TL7A 3ZIAD 4EJSA 4CEIB 3R9XA 2OV2A 3ADCA 4MYUA 4FWIB 3VAAA 4DCUA 2QP9X 2IYYA 1P9NA 4PANA 4PHFA 2IL1A 4BFWA 4D0GA 3DKVA 2NIPA 4US0R 3UMSA 3UMFA 2CL6X 4BRWA 3GLIA 1W36C 4US1R 4NTZA 5AR1A 1CJVC 1SULA 4TLBA 1OB2A 5FBLB 2KWIA 3K0SA 4WZAE 2ZAOA 2REOA 5IDVA 1CXZA 1ZC4A 2WOJA 4TYYA 1AS0A 4I81A 3LWNA 3FTQA 4MGZR 4QKQA 5J4VA 2D7DA 4DUGD 3SBEA 4BRUA 1W44A 4B3DA 1W2HA 2AXPA 2BBOA 4I99A 3WHKA 4BGDA 2B6HA 3KZ1E 1G19A 3DPUA 3MSXA 4M22A 3W5IA 4DDUA 3LRPA 5A4JA 3BERA 4E5UA 2QRZA 2SHKA 1N6IA 1E9FA 2AKAB 3GLGA 3GJ0A 1ESNA 1IN5A 5LPNA 3EPKA 1ZW6A 2R62A 1M1YE 1GL9B 3CUEF 1TQDA 3SFZA 3MLEA 3C41J 1ZIOA 1ZMXA 2O0HA 1X8KA 2K5UA 4CRWB 1R5OA 4JLPA 4EPYA 2BCGY 2XSZD 2ZRIA 1II0A 5FR1A 3WMEA 3BFXA 4CIDA 3QEOA 4OBEA 1IHUA 4HZIA 4MITA 2GF9A 4LBVA 2H8KA 4D80A 3T5DA 4KU4A 1EG7A 4DLYA 2GXAA 2LWIA 5LD2C 4LHYA 3JVUA 4RD2A 4UNPA 1P62B 3X2SA 4CF7A 3K09A 3EA5A 4GMDA 4GFDA 4YDHB 1G6OA 4YMSA 2A5YB 4GDFA 3TK1A 2ZI5A 1ZM7A 1E0JA 5L3QB 1PLJA 4URZR 2P2LA 3CM0A 4GT1A 2FSHA 4P32A 1F5NA 3WYAA 4UNRA 3AP2A 2UVQA 3NHAA 2ZUDA 3HR7A 5FI0B 3U44B 3KFVA 4QGHA 3LXRA 1US8B 4DSNA 2ODNA 5J4LA 5JI3E 5L8VA 2ERXA 3REFA 4WAUA 3IGFA 2V9PA 2REBA 1NBMA 4AYWA 1R5BA 3GJXC 4PHTA 3UXMA 4FW9A 5KSYA 2XB2A 1Z6GA 2QSYA 1R0WA 1II9A 2FF7A 5UKDA 1DAFA 4I1OA 2IS2A 2PJZA 1A2KC 1G3UA 1NN1A 4KFSA 4IW3B 5EJEA 1T0JB 4YXWA 1IM2A 3PUVA 2HXSA 2E87A 4BFYA 3IO3A 1KYIA 3HU2A 3GJ3A 3QE0A 4RVCA 3U3OA 1OIVA 2O8DA 4P31A 3KL4A 3MJRA 1XD2B 3F5FA 3K0CC 3ASYA 2CVFA 1II8A 3DKPA 4M8NE 3UG6A 1J8MF 2QI9C 4JSYA 1NJFA 2QQ0A 4QJ4A 5KNDA 1J99A 2ANCA 2QMHA 2JASA 4LJ6A 3W6NA 3U4QA 1FOEB 3ND8A 1PJRA 4GOXA 1Y63A 4PO8A 3QKSA 1AGPA 2QUZA 4LC0A 1C4OA 3SJAA 3EZFA 3TR0A 2ODBA 1NBMD 4MGIR 2PT7A 3KXKA 4IRUB 4DLWA 5JWRA 4C0SA 5EZ6B 4F7WA 4XSGA 4B44A 1TEVA 2GCNA 3FHTA 4JLMA 2CHVA 2IS6A 2CBZA 2H57A 3NBFA 1S2MA 2V7QD 4Q7LA 1GNRA 4QM7A 2I1QA 3SQXA 4EDHA 4NYJQ 2LCFA 2LKCA 2GNOA 1BS1A 3GLFB 2CE2X 2RGBA 1GILA 2Z4SA 1SVWA 4CW7A 2AK3A 1U8YA 5HE9A 4UNQA 4XWOA 3VU9A 1H8EA 1RE0A 4JLDA 3RS0A 4MGYR 1UADA 4BZQA 3A1WA 1I4LD 1DS6A 3K0FB 1TQ6A 2W0MA 3F0TA 4HDCA 1F2TB 2FFAA 4TMTA 3SYLA 3I5YA 4A2PA 3R8FA 2PZFA 3CB4A 1N5LA 4LYFA 1FNNA 4OHZA 2J46A 3HWSA 1Z0DA 2DR3A 3BK7A 3AF4A 1XEXB 1XWIA 1YZGA 4FN5A 5EQTA 2DFKB 1S0UA 1AZSC 3Q5DA 4C4PA 3CRRA 1QHNA 4URUR 5CDFA 1UEJA 3OIYA 2WOOA 3A37A 3KJHA 5J47A 4NCNA 3LAWA 3LBHA 3TVDA 4GP7A 1R7RA 4KHZA 4RFSA 6Q21A 3ZD6A 1T6NA 3I61A 1FZQA 3FE2A 4IXMA 1KI2A 2CK3A 2WV9A 3H84A 2ONJA 4Y0VA 3VX3A 1ZUIA 3AF0A 5EE5B 1EFCA 2R6AA 3EW9A 4HDOB 3IEVA 3DEFA 2G88A 4I1VA 5C2JB 5GJCA 2BMDA 2DWQA 3W8RA 3A36A 4IVRA 1ZD8A 1HV8A 3T15A 1KIMA 2GCOB 3VHXA 2N46A 4Q47A 4BQSA 2FFQA 3HR8A 2HCJB 3K0AA 3GLFE 4IOJA 5CB8A 1CF4A 2BIFA 4B75A 4M0LA 5LBIA 2ZYVX 4G5RA 4GRAA 1UKVY 1XZPA 2UZIR 1A1VA 1Q20A 4PO1A 5JEEA 1AN0A 3QY0A 2A3RA 4JKYA 3B9QA 2JLUA 3SE0A 3SYKA 1H8HD 4DLVA 2NO6A 2QSZA 3X1ZA 2DWOA 1HH4A 2F1RA 2WKPA 4M9SA 1OXVA 1Z28A 2NQ2C 3SYNA 1ZUHA 1KSHA 4O0MA 4Q4JB 4M9XA 1SVSA 1DBSA 2FEOA 5DN6D 3VKHA 2XNDA 1II8B 5F9HA 2OO7A 3FMFA 4LDJA 3PV0A 2V3CC 2WAYA 1K5DA 2NO0A 3SQWA 4ZCLA 2C9OA 4N0DA 4KSCA 3X1XA 4Q03A 1W36B 3B6EA 4XH9B 4F93B 1VCMA 1RRFA 1AKYA 3VTKA 5GJWC 4ZKDA 3ZZ0A 4ESHA 4A6PA 1FFHA 4YQFA 4B33A 3AUYA 4TLCA 4BECA 1XP8A 3I72A 3U7EB 4L15A 1Z83A 4FCVA 2V6JA 4RKEA 1IOZA 1U9IC 3MD0A 3KX2A 4O2RA 3SJCA 3WYFA 4LJ7A 1E99A 4JLNA 5JRJA 4P4UA 1E2IA 4L9SA 3ZQ6A 3UATA 5KNBA 3C8UA 1XMIA 3GFOA 4KITB 1G8FA 4QNMA 4C0QC 1T3SA 5AJYA 4L8GA 2GDJA 3RRMA 3CF6R 2V6IA 3W5JA 1NG9A 2ZE5A 2IYVA 3NC1C 4Q1DA 2IXEA 1Q1EA 4DEXA 3LY5A 4TL9A 1W4AA 3U2QA 1XMJA 4DLRA 1P3JA 1FMJA 3IBGA 4PO9A 1ONBA 1UDXA 2QE7A 1P7CA 3FKQA 4MRVA 4QHYA 4DDWA 5JI2E 1KDRA 1TF7A 1IAQA 4QJ5A 1VYTA 4DIEA 1WDTA 3PEWA 2D74A 1UBEA 5HTKA 3GPLA 2H92A 3WY9A 2F43B 1XTQA 1E6CA 3B1XA 4LWZA 1Q12A 5DHFA 2ORVA 3AB3A 1N0WA 2IXFA 4HUTA 1Q57A 4UXHA 1LS6A 4MDEA 2HYIC 5JSZB 5JJLA 1E2DA 2BBWA 4V0LA 1SGWA 2MSDB 2X1VA 2O8BB 3G82C 4Q9LA 3CX7A 1Q1BA 2ZRAA 4C2TA 1SKQA 1EWQA 3W34A 1D2MA 1HQYE 1NL3A 5CITA 1XXHA 5HR5A 1V43A 2A5FA 3L8ZA 5E3HA 4NKRA 2C03A 5FFMA 3FGNA 2P0EA 1T3HA 2QGNA 2NZ8A 5DYGA 1Q1QA 1YQTA 3C5CA 4IDPA 3K0EA 2CLDX 3LXXA 1OIXA 3K1JA 3RANA 1DAGA 2F3RA 3W8NA 1IY0A 3D31A 3AVPA 1JXOA 1ZU5A 2J45A 4UKDA 4ZIRA 1W0KA 3GLIB 1XPOA 1KI7A 4AKIA 2ZRFA 3K0AB 4BLRA 3U6KA 3ZQJA 3AP1A 2C9CA 2H17A 2HJVA 3MWYW 3QUSA 2OAQ1 4V0OA 4AI6A 1FTNA 3AVYA 3SEAA 3DOFA 2QAGC 2CL7X 3W3ZB 5KTYA 2HEIA 3PITA 1T9HA 1DAKA 3KQNA 1TU3A 4MYTA 3AF3A 2V7QA 4G5OA 4QC2A 1BYUA 1T91A 2QA5A 4DC9A 2RGNA 1ZAKA 3LA6A 4D25A 3CRQA 1W48A 2ZSFA 4HLQB 1KMHB 3BXZA 1Z6YA 3MFYA 2ZR0A 1QHIA 3TUZC 4Q9IA 4AG5A 3PCRB 3FVQA 5CIWA 1IXSB 4D4JA 4TZ0A 2WVJA 2ZQ5A 5EXTA 1XCGB 2W83A 4ABYA 3EIEA 4GI7A 4QHSA 3RSLA 1W0JA 2VBCA 3GLHB 2GA8A 2DFNA 3QJYA 2H7VA 4KVAA 4C2UA 4C0AC 3WBKA 4HYYA 1S4QA 4FI3C 1KY3A 3PJRA 1G7TA 5EE9A 3VKGA 1COWA 3M6AA 2ZYUX 1FUUA 3BFVA 4EQ6B 1U99A 1GKUB 4KJZA 4MRPA 3AGQA 3AVVA 3G5UA 521PA 2GJ9A 2IWRA 3BH7A 4G0NA 1I2DA 1I4DD 3I5XA 2JJ1A 2XOKA 1IXZA 1RVDA 3D6TB 3IUYA 4P4SA 1YZTA 3OIWA 1P75A 3BBPA 3ZH9B
chains in the Genus database with same CATH superfamily
1DJQA 5TC4A 1JLHA 3L49A 4J16A 4S0ZA 1NVAA 1BVUA 1VJ5A 2WT8A 4N6GA 2O7NA 1YH3A 2WT4A 3CW2A 5LN1A 1L7EA 2Z9BA 4E51A 3ZGZA 1JJIA 1A77A 2W6ZA 1RRPA 1ZH4A 2NVUA 4HX9A 4K2HA 4UHBA 4YJDA 3VI4B 2DKFA 2GERA 3HUTA 3VTAA 1BCSA 1NXWA 1Z06A 3HXTA 2WFLA 3DT6A 1KFBB 1V2GA 3E1KA 3E4CA 3V80A 3P5SA 4MWTA 2AZTA 4BEVA 5DGXA 1QGOA 2BRUC 1I36A 3K0CA 3B6JA 1DMRA 1ZQ9A 2NU8B 4KKVA 5I7OA 2C2YA 5KNCH 3RAEC 1HMPA 3K6RA 4P7BA 4DGSA 4G56A 2JLVA 4JT8A 3R9WA 1PJ2A 2OVBA 1SXQA 3K1AB 1PR2A 2LTAA 3Q7IA 1EVKA 4G26A 3RARA 3IKMB 3UYKA 1Z6QA 4KSBA 4ZVNA 1YU9A 3GVXA 5IC6A 1SIWA 2PMEA 1Q0HA 3RNOA 4XRRA 3BJZA 3SX0A 1Z5UA 5THXA 1AQ6A 2IKSA 1ZIPA 1FS5A 3RS3A 4UVGA 5FA5A 2LIPA 1FP7A 3E3NA 4B4KA 4UAUA 2V3WA 4P3YA 5FA8A 4K6MA 4OH7A 4R8RA 3PJDA 4CLHA 2OSVA 3DEIA 4Z8XA 4YXWD 5C7IO 5KREA 2CZGA 3L43A 3SIPA 2DQZA 5DSZA 2FMTA 3ZXXA 4GKBA 2FGKA 3UVEA 3PC6A 3KUDA 4DMCA 4OQZA 3RS5A 4ALNA 3PYMA 1UXHA 1KPIA 4D9NA 4EJMA 4BFZA 1U0BB 3E61A 1B6TA 2QD4A 4EB0A 4JK3A 3NHFA 4GXRA 5TSDA 8GPBA 1YJQA 3FSGA 4TMXA 2Y8EA 3DMFA 4BKUA 1NTRA 2AT1A 3MWDB 3DGFC 3E7XA 3PEUA 4FOPA 3RYHA 1X7WA 4ES6A 1VL8A 1LF0A 3EAGA 4RX1A 4U0JA 3IILA 2ZB2A 5ALUA 3B52X 5KCMA 4CQMA 3DLBA 5EGNA 3FRJA 3B8HA 4DYDA 4TLDA 3PUIA 1IPEA 2TSYB 2JFZA 3R3UA 2A9FA 1MVLA 3I9JA 5AM3A 3PNOA 2AJLI 4OX9B 4MJ3A 1JIQA 3ROEA 1WQ4A 1KAHA 5KNCD 2TECE 2X22A 2EWWA 1YS7A 3LKDA 2VIIA 1E6WA 3ZBQA 1W29A 1WAMA 3EWSA 3FFTA 2C5HA 2IZ5A 2QU8A 4WOPA 1GOTA 1ML3A 4TT3A 1C14A 5ILQA 5BN3A 1BU5A 2P2NA 3D02A 1P6QA 2WJGA 4LF7B 1X9HA 3HDTA 1I0ZA 1BXRB 3EODA 1QKKA 1TIKA 3OF5A 3IAM6 2DM6A 5JD5A 3W9UA 1L7AA 2JFWA 4B3CA 1L5LA 3TF5A 3AL0C 2W93A 3FFAA 2UUPA 3OE7A 4L7VA 5A9RA 1ECPA 1RKBA 2H5LA 4A2QA 1MT0A 2CJXA 1OBCA 1DJNA 3Q9UA 3CN9A 4OMUA 1V1MB 1YQQA 5LNK6 1QIHA 2Z95A 3KJIA 1GD1O 2CK3D 1A76A 3HDHA 3KWMA 2P69A 2CFOA 4M0FA 4PIPA 2WWRA 1E9AA 3A4NA 4CM9A 2V0GA 2G0TA 3LVQE 1E0SA 1UP7A 4Y2XA 3K4HA 1DRWA 1PGQA 4JBIA 5TJHA 2YXPX 4YRAA 4LJSA 2E4ZA 1KMIY 2SKDA 2ZM6B 1PL8A 1ZL2A 2C29D 1XE3A 1HKUA 2WMDA 3LI2A 5F64A 4KXMA 2C7VA 4UNNA 4Z0PA 4YWHA 3AERA 3TIVA 3A1EA 4D9BA 2WSBA 3OZRA 1RD4A 4H16A 4B6PA 4PZ0A 1MG0A 3S7ZA 3V6LA 1U8TA 3HYTA 4CLRA 1JQBA 4MVJM 2Y77A 1L4LA 2O8EB 1K08A 4LI3X 1K97A 3HFGA 3K0HA 2GD1O 4CCYB 4F3CA 4HWRA 3W6ZA 2XCIA 4IQ4A 1V3TA 4LXTA 1RCUA 2VNJA 5J40A 1XCMA 4C4SA 1ZA2A 1L2TA 5CBKA 1F3OA 3CUUA 2PRYA 3EZNA 1ZXBA 2EX4A 3QX7A 4DILA 1GFZA 3ZLTA 4ICIA 4EAQA 3FDXA 3HYLA 3RVPA 4GI1A 2JCGA 2Z8YA 1G3QA 3JALB 4ESOA 1G5FA 2XYGA 1P4JA 1KJ8A 5JHGB 3KPJA 3GRVA 3ORSA 2WF6A 4MQEB 4KO1S 4KPYA 4L75A 4FOLA 1G38A 3LFUA 5B7GA 2GM5A 1T26A 3IAUA 3IRUA 1N8SA 4M8SA 1Y98A 4X63A 3U4HA 4B3XA 4IXDA 1PS9A 5BXQC 1I4WA 2QSUA 3MZ0A 5J63A 3UN1A 5JAPA 2LIVA 4DLXA 2X0FA 2X2FA 1JBQA 4NNJA 3AKYA 4TXNA 1YHYA 3T5PA 4FEEA 3WDSA 3G9QA 4DJTA 2HK9A 2Q3FA 5KEIA 1CNFA 1BD4A 2XWJI 2AZDA 1E9EA 1X87A 3LUFA 1E8MA 4XEUA 5HBRA 4BQRA 5G3ZA 3C7DB 2OWEA 3LY9A 4IVNA 4EA8A 2WU3A 3EPLA 1EUCB 5M04A 4NAHA 2RJOA 3D8UA 2XE6A 4X6LA 3HXMA 1HE8B 1NW6A 2VJKA 2C2XA 3STVA 4AMYA 5IEJA 4C5AA 2ZE6A 2W6OA 1TEHA 4MVJH 5KYWB 2PLFA 4YUAA 3THXA 5HKOA 1YDGA 4X66B 2W6IA 2R6FA 3L2OB 4QYTA 1Y6GA 2QMUA 3GBPA 4BQQA 3OJXA 4FFWA 1ZP6A 4MYDA 3WMXA 3I23A 3BIOA 1J0BA 3OOSA 3L6UA 5SZIA 3BZUA 2PMDA 3N5CA 3UA3A 2NYUA 1R4MA 2Z6QA 3DE5X 3KVVA 1OSNA 2DR0A 1VIAA 1XPUA 4QXQA 4CLDA 3R0JA 4OYLA 2BKVA 5H5JA 1XN4A 3OIUA 3E2MA 3ZDZB 3K4QA 2VDMB 2QVGA 3DXYA 4JL5A 1KRWA 5DHRA 4OSPA 4B09A 4IIVA 5DHUA 2HK8A 1M67A 4JYZA 5FULA 1V2HE 5K0LA 2NU6A 4OKNA 1MX3A 1NI3A 2VRNA 4RK7A 4WBNB 1T2FA 3OZWA 1H1LA 1A8PA 4Q4HA 4LOIA 3SFTA 1WJGA 5F3RA 3CKKA 3OVMA 1HKHA 1F2UA 2EX0A 3U9SA 4MUXA 3PWSA 5BSKA 3AV0B 5G0VA 1YR8A 3BQ9A 2D2FA 1OMOA 2ORIA 3LGXA 1FQOA 3RB8A 2RG1A 2QTNA 1E4EA 4C08A 5DIFA 1OPXA 3HP1A 3CLRD 4YA6A 4NMMA 5KYNA 2IPXA 1NYTA 2Q1SA 2Q9AA 1EWRA 2QTGA 4ND7A 3QPBA 3ZZMA 3ORRA 5HJEA 1WXEA 2CVOA 4E07A 2FZWA 1BGVA 2IYPA 3L4SO 4TMVA 3HKEA 3EE6A 4GIBA 3CJRA 1GDTA 1PT7A 1EWTA 2J9FA 5E4TA 5BUSA 5CFQA 1UZMA 2EFCB 4HEA6 1Z5PA 1H6BA 1ULSA 2B1JA 2WVGA 4DDTA 3MS7A 1KZ9A 2J87A 4XD7D 3NALA 1UBRS 4EUNA 1QF9A 3JVIA 4I08A 4I19A 4BO8A 1WKBA 2R65A 4NU6A 3NCHA 3UW1A 3VISA 4UUAA 3LX5A 1DC4A 2C4HA 1DI0A 3HJNA 2JFBA 2JJ2A 4RSHA 1ENOA 3QBTA 4G37A 4I66A 3OE4A 3OQBA 5AUPB 3BIWA 4UTNA 5CIYA 4LJ9A 1YRYE 2HMVA 3DLIA 3BRSA 1F9AA 3E7FA 4CFZA 4HFRA 3GHYA 1DBWA 3TTSA 3VYRB 3OAAD 1J1IA 2E4AA 2QD3A 2QRNA 3F98A 3P20A 1R50A 2GZ3A 2OC9A 1VSQA 3A1SA 4ARZA 4MS4B 5KOIA 1DHRA 2GPTA 4FDTA 3W2HA 4QXPA 4QT0A 4GVLA 5EJ6A 3H2ZA 4D42A 4TRMA 4YR7A 2V5AA 3BE6A 3GRUA 1BW9B 3ZBTA 1IC6A 2YV5A 1D5CA 1RWVA 3GZNA 3LX8A 3O2SB 3OF2A 3UWKA 4D3FA 5HUHA 4F60A 3ICEA 1GA6A 1Z6TA 2X0NA 1NUSA 1RKUA 1XVLA 2PZGA 3L7NA 5JVDB 4YREA 3ZGLA 3DZ8A 5LP6B 4TKUB 2VK8A 1NHWA 1ZJZA 4TMZA 1M7BA 4XVCA 4DREA 3O3CA 1BSVA 1R74A 1E3IA 1XEWX 4JI5B 3X43A 5IWAB 3AOGA 1T4MA 4R54A 5CFOA 4C07A 2YUTA 4G9BA 5TPZA 2NU8A 4DCPA 4OQNA 3H16A 2QRGA 3B6MA 4LG1A 2R8RA 2NGRA 1MX1A 2PD6A 2RCNA 2VHEA 1ZKMA 3OIVA 3USZA 3PLAE 3PFCA 4X84A 3MJCA 4EF4A 3WNBA 4N7RA 3AF5A 4J03A 1ZC3A 2GCEA 3WISA 2Q21A 4EO7A 4OLJA 3E3AA 4YYEA 4UXJA 1E9RA 3KDAA 3QELA 4LDZA 2HC9A 4FYXA 3C87A 2XUDA 1VYVA 4Z53A 4ZRDA 3USES 2WWVD 4KXYA 4LGYA 5KX5A 1K7XB 1S3FA 2ZRLA 4MI6A 3Q9LA 3O3NB 4MEBA 3ONVA 1NVFA 4ED9A 5LQUA 4S2EA 4D46A 3ED5A 4G4IA 4KQ1A 4UEWA 4CV1A 5L7YA 1PEKE 4NBTA 3FHOA 4M89A 4MDHA 1T9CA 1U6KA 1EFRD 1Q7GA 4V2UA 5IYZB 1B00A 4IJMA 2DUNA 3VKUA 6LDHA 1A8HA 1UPFA 3AI2A 2UUAB 4HQOA 1F0KA 3N2EA 2MYNA 1EUQA 1WW3A 1EXVA 3AKZA 4NATA 2J4DA 3FNGA 2EGHA 1NY6A 2IPNA 2YC4C 2A30A 3AV3A 2ADOA 3GFBA 3PNVA 1XU7A 5TDHA 4JJ4A 2FUCA 1XTUA 4H7JA 8MHTA 2EFDB 3GEGA 3MS2A 4KQHA 3OECA 5IDWA 5ALMA 3IBCA 2YNMA 2PXXA 3KHKA 5KOJB 1E32A 1SHJA 2REXB 5IM4F 2OBNA 1RAIA 3KYCA 1DUIA 3PUXA 4OXQA 4CKWA 4KDCA 3CT4A 1WZCA 5AH0A 3UK6A 5ELMA 2GYWA 1E4EB 1VM6A 4J94A 1K63A 3QXCA 4HH1A 4CMEC 5KBYA 2V7GA 5AW9A 4QM6A 4EG4A 3H6KA 3L1UA 1IG0A 1E3DA 2BI4A 4G4SO 4XAQA 1Q44A 1RWNA 3QVGA 4PWYA 2PKYX 5ITVA 3O2JA 4G6ZA 2O8FB 2I4IA 4NBRA 5TE9A 1ADYA 2GWHA 2IYSA 2YKGA 4Y30A 1GQOA 3PDWA 4QZVA 1IL0A 1EX7A 5JW6A 2O8NA 4KLNA 1GGJA 3HY3A 1T9GS 3EARA 2WPNA 3L06A 3Q8LA 1EB9A 3DC2A 3QXHA 1B16A 3AESB 2R87A 5SYNA 4R68A 1QGED 1JSCA 1ACLA 5AK6A 4C9BA 2JLXA 3TM5A 2GPWA 2I66A 1NKSA 3L04A 3LP8A 2NLOA 3CR8A 1FTQA 2WK1A 5DTQA 5AW1A 4CTJA 2OHJA 4FX5A 1CJUC 1GZ3A 1HT1E 1SO8A 4QQKA 4RF2A 4C0LA 4F3TA 1WKCA 4UFPA 4NJEB 4BV8A 1A5BB 3FPKA 5G4LA 5A05A 3GK3A 4P2GA 4ZVLA 5E4YA 2WWYA 4HWTA 2MINA 4ZQCB 1P19A 3OCUA 5BOVA 4B4DA 4HZUB 1PWZA 1DIOB 3B3JA 1XJ0A 4R1OA 4RLHA 4D8TA 2OV3A 3TFOA 1QHYA 1ECBA 1C30B 1XRSB 1XXLA 3GH3A 1FYFA 4XDZA 5JANA 4K1XA 1TAGA 4CCYA 2XCQA 3VA7A 3NNNA 4HV4A 1PFYA 3FRHA 3PQ3A 1H4TA 1P45A 5TGDA 3VZCA 2J3EA 1PGJA 1M33A 3T0GA 1BA2A 1VE7A 5JVDA 3OQVA 3RIMA 2YZMA 2E82A 3K2EA 3H0CA 2YVAA 3HJUA 4QRIA 4W9NA 4XJTA 5FUMA 3F7OA 4ZI5A 1EM8B 4L9WA 4Q16A 4BFSA 4Q93A 3AUXA 4GAEA 4UTVA 2X0RA 3JYPA 2SCUB 4JBYA 5ECWA 1GPAA 1FNDA 1NVUQ 5TJ9A 1E64A 1WCWA 2FLWA 1E77A 4TMWA 2G7MC 1ETUA 4O4HB 2VDWB 3GRRA 3EOAI 3WAJA 4RTSA 3K9NA 1N3BA 3HYSA 4IFIA 5EINA 3KXDA 1GWNA 4RY0A 1YBHA 5IP5A 1EWKA 3IMFA 1FTGA 1E1RA 5K0EA 2EZUA 3NBAA 4P8RA 3DEYX 3IIIA 3WLIA 4BNUA 5DWQA 2JGDB 4OF4A 4GM4A 1IJFA 2FUNB 2GJKA 3ZWPA 3C1OA 1MABA 1EJ6A 4YIHA 5AUOB 1RAFA 4L9RA 2DFVA 4X90A 3WRYC 4BE7B 1QX4A 2PU7A 4KL8S 5D3QA 5M34A 2XDQA 4RY2A 2CJPA 2NTYC 1LFAA 1ZGHA 1ECGA 3I6BA 3U4QB 2XJ4A 4C20A 3HVHA 2RHHA 3GNSA 4KEAA 3GZJA 2WQZA 1T2NA 1BHJA 1AKRA 1TJ5A 1U5CA 2IDMA 2H2HA 2NSJA 3L07A 4OYRA 3RSFA 1Z63A 3DDOA 4ZN6A 1ZM4A 3FB1A 5AJHA 3JYLA 1EESA 2H5IA 2JJ8A 3L01A 3FNFA 2WTUA 2BVNA 2H9IA 5G0TA 1U5AA 2WLTA 4X1OA 3ZKWA 2PY6A 3KYDA 3CLSD 3RREA 1PQUA 3I92A 4JZKA 4BVKA 3ETNA 2E48A 1ZH0A 5L51A 1XDZA 3A7EA 3GJRA 1NJGA 1ZOLA 4NU0A 3F71A 3WQHA 3E27A 3L5KA 1OD6A 4GXNA 3R3XA 3T7EA 3LC7O 2YRWA 2FKAA 5BYBA 4KE7A 3DM9B 1HY3A 4PPNA 2ZIUB 2FPSA 4Z1MA 3O8CA 3KYCB 3LSTA 3SP1A 4U4AA 4L6CA 3IPRA 2WZCA 4Y6SA 3PZBA 2WSYB 2PJDA 3GRAA 4HZGA 3Q1KA 4RF3A 5HOQA 3DD1A 4LXQA 3ZVNA 1AGXA 1JAXA 1UPAA 2QL7A 4I4TF 3AEXA 4BO2A 1XJCA 2CMGA 3PHHA 5E1OA 1IZZA 4WJKB 3N05A 5DYYA 1JEYB 1TKCA 3QVGB 4HPXB 2P0AA 4EB3A 3IQGX 4NRDA 2MSNA 2OYCA 4U8HA 3O94A 3R0XA 2VH5R 1NAIA 1V96A 4WK6A 1AF4A 3BOSA 3K9CA 1RPTA 2DHEA 2ASVA 2P9TA 4IUYA 3HG7A 5FOTA 2WY2D 2RC5A 2IJGX 3LC0A 4G4JA 1KQPA 2GD6A 1N2XA 1Z34A 3CNEA 4PN3A 1OFUA 4HSEA 1QORA 3R6TA 3W8DA 5K3EA 4TS4A 4LXXA 3T1NA 1SCUA 1U7TA 3C97A 4OQDA 1JR3A 3IT2A 4O2LA 3QPAA 4A26A 2CCKA 1SCNE 1NJ6A 4LCBA 3SVZA 3TOVA 3IBYA 4CKZA 3FG9A 3GFQA 4PFQA 1NJ2A 4G1CA 2I80A 5CNIA 5B4VA 2ECKA 1KAQA 1Z13A 1GG9A 1RYNA 2ENUA 3FVWA 1MN6A 2Q1WA 4OB8A 2ODAA 3K71B 4H18A 3CJTA 1E2FA 3S29A 3SCZA 4EY3A 3LUAA 1LUAA 1QH9A 1K9VF 3LFTA 4NONA 5JALA 4ASUD 1RAAA 1OXBB 2Q4OA 2WMNB 2I71A 2Y4OA 5B2ZA 2IE8A 2OB1A 1NJ5A 4OLBA 3L0SA 2P9HA 3R4VA 3TMYA 1G4UR 1YI8A 4YRCA 3EG9B 4F93B 1AKEA 1BVHA 5EKTA 4J49A 2X4LA 3WLLA 3M3HA 3ZDQA 2Y1GA 4ZT3A 1XRNA 2CYCA 3G8CA 1KMMA 1ZGBA 4LRXA 4N8SA 4Q7JB 3K1YA 3WNDA 1QRAA 3GAMA 3LPCA 1UFKA 1OXUA 2GKOA 3H9UA 3O4GA 3VHXB 4EJ0A 4ND5A 2RSLA 2J3QA 3ELUA 4DMKA 2HDNB 2EOAA 2FWRA 4LBWA 2HU5A 2W9XA 3M89A 5AJVB 2X2EA 2JVKA 2X7JA 3STYA 2RGXA 3B1WA 3IVRA 2ZI4A 3IDAA 2WMOB 2ZSAA 1XHFA 2A1TR 2OHFA 4RZUA 1J0XO 4EITA 2GK4A 4LK2A 3UWMA 2O6HA 2VEOA 3CZPA 4HDMB 4MO9A 4MYCA 4BPRA 2EBFX 3D3NA 1DV1A 5BSFA 1ZI8A 1WDWB 1VIMA 1VE5A 1VFNA 3COZA 1F38A 2QKYA 3ILXA 4KFUA 3TJMA 4Z54A 5IKPA 4BNYA 3BB3A 3AEUA 3AR4A 3HE3A 4YECA 3S1LA 1B8PA 3FRIA 3T4UA 5ENVA 1H9AA 1V3QE 2B8WA 2NQ8A 3FKSD 3F3MA 4QPCA 3FTEA 2J3HA 1TIPA 2JH9A 5HMMA 4PLYA 3N8NA 2QM3A 3KLNA 3M4YA 4Q0MA 4M1EA 4FB4A 1GKIA 1FRVA 1XRQA 4ZCTA 5BN1A 1OIWA 2XDWA 4ZCRA 4KOEC 4GOKA 3QEJA 4A16A 3OWXA 4QUJA 1TU0A 2Y4NA 4M99A 1C1DB 1E2HA 4TWAA 5FBRB 1R6BX 5LR6A 1NW3A 1NUQA 3S2UA 3FUUA 3S0JA 1A7UA 1LQTA 1SRQA 3C1AA 5ESWA 5L4SA 2I33A 4X54A 1KAEA 4UCWA 1MV8A 3R5XA 3HADA 1KI3A 2CWDA 3DDZX 4D3XA 4RCVA 3R9KA 3T3PB 3WXBA 3BIXA 3OO1A 5JDIC 5C7YA 1E9CA 2CNLA 4FMCB 3IUEA 3C3DA 4LDAA 3DKIA 2ZIGA 3FLAA 3HKDA 5EIFA 4EG8A 2W6JA 3LNCA 4HTFA 1GSIA 4PC2A 5FHQA 2HK6A 3GP8A 1RXCA 1VZ2A 2A14A 2JAOA 2P3OA 3RVBA 1JFVA 2KMLA 3OY7A 4XI9A 1U8AA 3PICA 4EECA 3AFHA 2BFOA 2XE4A 3HYRA 3NHWA 3WLMA 4OL0A 3FKSA 4NS1A 2PUCA 2BDEA 2UAGA 1I7LA 3EUWA 5KWVA 3D4NA 2P40A 2BEWB 4HY3A 3VSBA 4Q7MB 3IMGA 4TTPA 3EGDA 3B1KA 1Y37A 3QU9A 1PDWA 4KPUB 2XTMA 4TTRA 3DSRA 4OHMA 2C5FA 4IL5A 3FCCA 4IO1A 4LYDA 4EBBA 2A1UB 2A88A 2P2DA 2VQ3A 4HL6A 1X3SA 5FEUA 1W5FA 1EFDN 1N7GA 1SZCA 1QH1A 2IEAA 2HD4A 3NIWA 4N8DA 1DC5A 2HHAA 4WD3A 4B81A 1KYXA 4ZTUB 3C8MA 3W6UA 1G3IA 1ODFA 4GHWA 3KJXA 4K86A 4B87A 1JG1A 2ZJ2A 4KFRA 4K9PA 4LVNA 3U48A 3HSSA 1P0MA 3MINA 3NH9A 5I9TA 4BLPA 4UU8A 4DA7A 4KREA 2KQUA 4Z2YA 2YDYA 4FU0A 2XYPA 4RIGA 2NMVA 4QBGB 5F76A 1GM5A 4DIBA 4ARAA 5CT4A 3X3HA 1H3NA 4NJOA 2AUNA 3RU9A 2FHSA 3QV2A 3BSYA 5EJFA 4ZCPA 5CXSA 5FADA 2EEPA 1WZIA 1ISGA 3ZGVA 3B7GA 1XQVA 3P7MA 2I4NA 1JR3E 4NCXA 5IANA 1DWOA 4IJKA 1RI3A 3DL0A 3GVIA 4U39A 5FNZA 3D8HA 1MA3A 1C8LA 2Q0SA 1TK3A 1IWPB 4A0QA 3HA2A 4KVFA 4Q9AA 3MTAA 3S2ZA 3PDIB 3KKOA 2V0CA 2CC2A 1KTVA 1M6EX 2X8JB 4MR9A 1M8PA 2GBGA 4WKOA 4XQEA 2V74B 5KOHA 2R0QC 4NBVA 2FETA 2YR0A 2QNRA 1D0SA 1MAVA 4LVCA 4M7OA 4KXFB 4EYKA 4JYCA 3OMLA 2YHAA 3TPFA 4AJ1A 2Y6UA 2NU7A 4NZOA 2YFQA 3F2IA 2PR7A 3GELA 3L7KA 3T95A 5ALLA 3LSYA 3SLRA 2YY6A 4D4HA 2HLHA 1F0PA 4A8PA 3VKWA 2IS1A 2PH3A 2ZI3A 6GPBA 2DXIA 3T7SA 3VTFA 1CIJA 1SCDA 5KSZA 2FZGA 3BJRA 2GBPA 4DAEA 3ADOA 4M8KA 2AXQA 2Z30A 4A82A 4EY7A 2C1ZA 3D6NB 4HQFA 1KO1A 5DB4A 1UJ4A 1P2DA 4IICA 3J81A 1Q0SA 3MMXA 4Z49A 1QZZA 1X80A 1ZXLA 3RS4A 1V7CA 5AK4A 4NESA 3WBJA 1ZW1A 3BD6A 3ITEA 3G5LA 4CV2A 1PUIA 3SD7A 3VXKA 4MCJA 2QAJA 3H2YA 4YRTA 5A7FA 3R0VA 4MS1B 3SWWA 1FU8A 4TT8A 1X7ZB 7ADHA 5AW6A 3VZRA 1RFLA 4WCFC 4G01B 1NR1A 3E0QA 4YUVA 4B83A 4CKCB 5IDXA 3T99A 1XYYA 2WP8J 1ORWA 5DULA 3S2IA 2OUKA 2WDZA 1QIGA 4GP9A 2YJTD 4XEHA 1OHHA 3GJSA 1XO1A 2B2XA 3IAFA 4UDYX 3RQIA 4WDQA 2ERYA 1FB5A 2MOKA 3BXGA 1LY1A 2EHDA 1A2BA 2ON6A 2IHBA 2XNKA 4K88A 4TSFA 2O57A 4JL8A 3EUFA 1RZRD 3V8BA 4WNIA 4B32A 4J76A 3UANA 1EVEA 2R7AA 4I5GA 1TMOA 4GLJA 1S9HA 2YVUA 2OHVA 3QUAA 4KQEA 4NMXB 3SU8A 4B6SA 1CUYA 3UO8B 1BXKA 1E94E 3FFBA 4FGLA 4HC4A 3SOPA 4OFXA 2PL3A 1WB9A 1XK7A 5ER6A 2QN1A 4ZYTA 5IVIA 5KTRA 1Q0TA 1LA2A 1K66A 2ZREA 5HQ3B 2X15A 1P72A 5ALIA 3GJZA 3Q72A 3VU1A 4QYIB 2ACKA 4NV1A 2CXQA 2B35A 5HZGA 3BREA 1Z5OA 4EHIA 4M37A 1K3UB 1A9RA 1XEFA 3N0XA 1M2NA 2YIMA 5A5DA 4ZMSA 2BMJA 1SVOA 2Q1UA 2WG0A 5FUXA 4ZV9A 1YUMA 3ES9A 4WVFA 3NV9A 1YB1A 2W37A 1GYRA 4QTYA 2O3QA 4EARA 5JPCA 2HU2A 2EKZA 5EPOA 4CI0B 1P5ZB 4PCVA 1CCWA 2GZSA 4RK1A 2ID4A 1YZUA 4OFBA 4EW2A 2R48A 4RMJA 2P6OA 5JJBA 1PK7A 1D8TA 3NEJA 1ISMA 4JC4A 2ZJ4A 4MRSA 1JFTA 4IQ0A 3H2IA 1JHPA 5GGXA 5EQJB 3BEDA 1UBNA 5F7ZA 2Z0MA 1H8HA 1OGYA 5IVDA 4WOKA 3UYLA 1UPTA 4GX1A 4F86A 4RA6B 5TF4A 4L4ZA 2VG8A 3DZBA 1Y81A 2ADFA 4MKRA 2WYVA 4INZA 4RPGA 3UWPA 1IEQA 4QDXA 4QDZA 2HBYA 2JRLA 1CDOA 1DSSG 4BNIA 1F8UA 1Y3CE 1R10A 2FOIA 3LJKA 5CLJA 1VYUA 4EP1A 3E7DA 1YB4A 3OP4A 1Q15A 2IYQA 5JAHA 1XMPA 4QICA 1GDDA 4ETMA 1H0KA 3R09A 1OWPA 1PWHA 1N0VC 2ZWOA 2EW2A 2RHWA 1OTXA 2HYIC 2YIJA 4BNZA 1Y6ZA 1BMFD 2R11A 5P21A 1B2RA 4B3JA 3UPTA 1ZUD1 4AO7A 1TYCA 3IMCA 1KZ7B 1PJ8A 2P90A 2HHJA 2MU1A 1JAZA 1OX5A 4I4LA 3FROA 5LL6P 4MUBA 4B6OA 2GFQA 1HNZB 5LA6F 4DV0B 2X2OA 2YICA 4G36A 1KEEB 1E3MA 4H0CA 1PBTA 1Z4JA 1ADBA 2YHSA 3PD0A 4Y2QA 4JLWA 4H6PA 5G1NA 2AG5A 1LNZA 1PNTA 2Q4DA 4MKFA 1X3LA 1LB1B 5E7QA 3R5SA 1P2UA 1RQLA 1FFXA 5FLYA 1WUIS 1XGKA 4Z0NA 2VAMA 4TYPA 4X8OA 1UH5A 5LYYA 1JDBC 4ZV7A 3EY4A 2J3MA 2JRCA 1F8YA 3REOA 3TQIA 1DQNA 4MB0A 1DU4A 1Q2UA 2R7LA 5LZ7A 3L02A 3GLFA 5TPWA 1BXRA 4XWWA 3UT5A 3SVTA 2VYCA 2LD4A 4CLOB 5B1EA 1Z2DA 1MZPA 1G8YA 1CERA 1HDZA 4I5DA 1AXGA 3SLKA 4LBYA 2HCBA 5D5PA 4NE9A 4IP0A 4EFDA 3QKRA 4E5MA 1EK0A 2YMMA 1G1AA 3QWAA 4UE2A 4ER3A 3GH1A 1X1AA 2JHPA 2ATCA 3AKDA 5CFZA 3WWCA 2QVYX 3Q7QA 1Y6RA 1RAHA 1LPPA 2XQJA 5K4HA 1JKXA 1TJ4A 3BJIC 2IGTA 5AHKA 3FA2A 3DVSX 4RY9A 2R9VA 3Q7TA 5FEMA 1D1PA 2OBMA 2AFVA 3H9BA 4LXGA 2J5BA 4JUCA 4ZVMA 1OWOA 2CF6A 2OFPA 2WPDA 3LLCA 3QTTA 4PGAA 3HCRA 3FWKA 4Q48A 1Q16A 2J30A 4RDCA 5CRIA 3WLQA 2ZYWX 2HR1A 3KOZA 5TARA 4B35A 3AI7A 1HE2A 1F51E 1PU2A 2IZOA 2B7LA 4HDSB 3R77A 2CVPA 3EWNA 1H65A 2J6CA 3OX1A 1XVAA 4NCKA 3FOWA 2AWNA 3M4ZA 4X6YA 2B3DA 2C54A 3GLQA 1GAJA 4M7RA 1RWOA 3L1VA 1CWUA 1O95A 3CNHA 5TEWA 4QDJA 1X7XB 4D56A 4G8JA 3A1NA 2EP5A 3NT5A 3RIEA 4BX8A 1CR1A 4Q24A 1UPCA 2OG1A 3SJ7A 5ECYA 2X3FA 1A9ZA 3UXEA 4ALLA 1E2GA 3GT0A 3GCXA 1OZAA 5JFTA 1JAIA 1SJ9A 3JALA 3UWOA 4L7QA 1NASA 1T5IA 4EZEA 3ILHA 1CZRA 1JQ5A 3WQBA 2PQ0A 4DCVA 5KS2A 3O1JC 3DDSA 3VI3B 5F1PA 1UJCA 2MCFA 1N2ZA 3MCZA 3NOXA 1Q7TA 3PGVA 4EF6A 1B1CA 2PJUA 2AX3A 4G5QA 4Z9FA 1JLRA 1TRHA 2QAGA 2QTWB 2QSJA 4LX0A 4RC9A 4RJIA 3NGLA 1BE1A 1W46A 4BNKA 5CYOA 1T8TA 2J41A 3S8EA 1LS1A 1KPGA 3SHFA 3VR6A 3GUHA 2GUWA 3JD2A 4OLHA 4F71A 3QX8A 4ZZ3A 3OG9A 5EJIA 4DWJA 5JZVA 1FLAA 2M1XA 2R97A 4WFKA 3K1TA 1PJBA 2QDKA 4WW0A 2WE7A 3L8DA 5FWDA 4F85A 3BL6A 5AO9A 3OPNA 3WHLA 1UMDA 4L5JA 3HO6A 4KR9A 5HSGA 3WGYA 5F7OA 3VNUA 1L4YA 1Z0IA 5IW8A 2VJYA 4XDGA 4LCEA 2O8CA 1GAXA 1AQYA 2VZ9A 3TZCA 3MS4A 3GJYA 4YMTA 1XDBA 1P1IA 1KZ6A 1RM5A 1FFSA 2Q5HA 4R2LA 4FW8A 1OXSC 1U11A 3HI4A 1LU9A 2BV3A 5K0JA 2O8EA 1TA9A 2HWYA 3NB0A 5CIQA 1CEQA 1QXSA 3CUWA 3M9LA 4TL6A 2G9NA 5TT1A 1MJNA 5CA1B 2HHCA 4JIMA 1NM5A 4V0SA 2GLXA 3LOUA 2WWGA 3QWHA 4KWCA 1NUUA 1ZA1A 3TL2A 4XLLA 3KVYA 1LSOA 2F1IA 2FN4A 4Y1FA 2XOKD 3H1TA 2JATA 3I83A 4KO3S 4QYXA 2QXTA 4YJGA 2MMCA 3FZGA 1E4YA 4RY8A 4U7JA 4OG2A 4V24A 2PRKA 3U7IA 4HYTA 2WA2A 3DXZA 1J9ZA 1KQ3A 1OAAA 1KBQA 2JHFA 1ZXXA 2Y66A 3P9CA 4HGRA 5EZYB 5CA0F 1NVXQ 1F48A 5EVJA 5K0ZA 3NXSA 3Q2IA 1DARA 1ZI9A 2W2LD 4EHFA 3SC2A 3I9MA 4JNCA 1Z25A 6CHYA 4DYHA 4FBGA 1L4FA 1AN9A 1DX4A 1VKNA 4BLVA 4F21A 5T7BA 4X7PA 3FBWA 3TI7A 1F3LA 1N6PA 1A2OA 1WULS 3L4KA 4H1UA 5LZ2A 3B3QA 1MNAA 4BLTA 4M60A 2XMQA 1XTJA 3SNKA 1A8UA 5JVDF 4TN5A 3U3ZA 1LLUA 2Z58A 5ARDA 1N6RA 1X8XA 3NXKA 1EE2A 3I3SR 1X1BA 2DHQA 1WXWA 4YQEA 5EIOA 1OB5A 1NU8A 5A0TA 4D8WA 5BSEA 4MR8A 5DCLA 1Y4DE 3T1VA 2YMQA 3KKQA 2R8EA 3PFHA 4MZDA 3Q6IA 4OK5A 2SKCA 4DG5A 4RH0A 3SJBA 3T7AA 4OK3A 2SKEA 1ORRA 4Z51A 1OZHA 4MS3B 1Q0ZA 3DQZA 1BX0A 1KO7A 4PO3X 3BH6A 3H6HA 3JASA 1GTVA 5C5CA 1GHTA 1XCBA 2H48A 1SQ6A 3A4TA 5SY9A 3FSRA 5BW5A 2HKIA 3PU6A 4KVGA 2O0KA 3R5FA 5JU6A 4KQIA 1KSGA 3JZFA 1KETA 4XX1A 4D6YA 3VDRA 3LPNA 2HJHA 4GYWA 1PNVA 2JLQA 4OYHA 1USKA 3OSZA 4GLBA 1U3CA 1ZN7A 4FYYA 4HMOA 4LRSB 1AUQA 3ZCQA 4MS1A 5HK8A 3P4YA 1Q7RA 2DUUA 2OCAA 1P33A 3PFWO 3USCS 1WM1A 3P27A 1V4BA 1J25A 2O9JA 3QVWA 3HHPA 1QZTA 3F78A 2O14A 5FT9A 2D7CA 4F6CA 4IBOA 5AW8A 4Q7QA 2XRZA 1XT6A 4MX8A 5FBVB 4R8KA 1C3VA 4PYRA 4ZVUA 2A0WA 3V1TC 4BQPA 3JATB 3V34A 1BMFA 3OEWA 3VO9A 3T94A 1TZ2A 4GMHA 4E4RA 2R7KA 5BPFA 1E3WA 1E89A 2FP4A 2GEDA 4MCIA 5IJWA 4W7IA 3PTAA 2D0IA 2YCBA 2Q4TA 4ZOLF 2BFDB 3ZCVA 4YRZA 4JYPA 4KB5A 3H2HA 1C0LA 2R1ZA 2WM8A 2ZUBA 1PFWA 5DHSA 5L4NA 1Y5NA 4LZLA 4RK0A 4YCBA 2ZSUA 4BN4A 4YP6A 3EGDB 3BWBA 4ZU6X 3RSCA 3T9BA 4C7OB 4LS3A 2L0XA 2AYYA 1E2PA 2VHTA 1HDXA 4OB6A 5F35A 4BNDA 1H1DA 5AUQA 1U9CA 4K6HA 3ELWA 2UZ3A 3AR6A 3P9IA 3E7PA 4GI3A 2JAWA 3KXLA 4UAGA 1FUEA 5B5SA 1CVIA 2I1VB 3KSRA 5IAOA 3HK2A 5E4FA 1YL7A 4QFBA 2CYAA 2O1EA 1L7VC 2Q3BA 4NMLA 1B42A 3D8BA 1MF7A 2GN2A 4LJ4A 2E5LB 2AIRA 3TRFA 4PZPA 1T9DA 2DWCA 3JAWB 5EZQA 3TGLA 1QLWA 3FMOB 4XIGS 3PVSA 1CY7A 5KSOA 4RFSB 2WD9A 3IEIA 2BTOA 3KWJA 2CEKA 2D4AA 4R9VA 2YY7A 1VMKA 1G60A 3M5CA 4B9EA 1I3NA 1SK9A 2Q9BA 4KO4S 1FFAA 3QSGA 2WG1A 2B61A 1Q22A 2QWXA 5EAIA 1FNCA 1KJIA 3MK31 4RHFA 3H5IA 1JFFA 1YR9A 4MB6A 3RC3A 3VPHA 1WW2A 2FH5B 3ILVA 1VB5A 2X13A 3NR2A 5KSWB 2HZ7A 2XMCA 2PQMA 4IJVA 3D8TA 5CGZA 3BL8A 1BFDA 2G83A 5KOHB 3ZK7A 3GPIA 5FV7A 4ZPXA 2P68A 1VIYA 2FX3A 2PCJA 1PNOA 4KG7A 4KQ9A 5D86A 1UXKA 5LP6F 2V03A 3K72B 3P26A 4V0MA 2HF9A 3FF1A 1IHPA 2AD1A 2LBPA 2Q29A 3IKVA 4TV8A 2XCRB 1VHWA 1POXA 1SVKA