5EJEA

Crystal structure of e. coli adenylate kinase g56c/t163c double mutant in complex with ap5a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDACKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEECVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ligand binding to an enzyme by a conformational selection pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ejeA00
1P9RA 3QXCA 1G17A 521PA 1P6XA 4URYR 1Z6TA 4NP6A 4JLOA 3SS8A 1XCMA 1IHUA 4NCJA 5AUPB 5KU1A 1UBFA 5CDFE 5FUXA 3W8NA 4IHQA 2WWHA 3F5FA 1D2MA 1S4QA 4OBEA 3TW8B 2QBYA 1CS4C 2RGDA 2FFQA 2NG1A 2DHRA 1D9XA 1IM2A 1P72A 3DVLA 3SJZA 2ODBA 4OK6A 2R6DA 2C9OA 4HAVA 4ESVA 4TLEA 1TL7C 2F6RA 2HXSA 2WWXA 3DZ8A 2AKYA 2DWOA 4YMVA 3PEWA 4OQLA 2WIAA 1RZ3A 5L3SB 1XF9A 2XOKA 3Q72A 4P4SB 2PJRA 2WJHA 4IDOA 4J0QA 2CE7A 1LTQA 4G5RA 4DLVA 3CPEA 1UPTA 1US8A 5KHOC 2GVDC 1I4TD 4LK2A 3RRZA 2RGXA 1BYUA 4ZIRA 4NYMR 1J7KA 2WKRA 1ZUNB 4OQMA 4IXNA 1GVNB 4XSHA 3L0IB 2QMEA 4MRNA 4Q47A 3T1OA 5BN3A 3U7GA 4A0HA 1XD9A 3X1WA 1ESNA 4JT2A 5EXXA 1BYIA 221PA 3FMFA 4LBVA 4TQUS 2PLRA 2ZSEA 1KO5A 1T3HA 4EUNA 5CYOA 1T5LA 1X8JA 1FOEB 1XZQA 1G8HA 3GJ8A 1LVGA 1NSFA 3L0PA 4JS0A 1E2MA 1OKKD 1W5SA 4ZV4A 1BO6A 3PEYA 4UKDA 3FGNA 2HT1A 2GF9A 2C03A 3W5JA 2QPTA 1XD2B 4ZDJA 1ZBDA 2FU5C 1VKJA 3R9XA 4IVPA 5EE3A 1ZNYA 1O87A 4ESHA 3C8UA 1D2NA 1KMHB 2OHFA 1LS6A 3CF0A 2ZM5A 2ZUBA 2GNOA 4EQ6A 3E1SA 1F6BA 2QM8A 2ZTSA 5KSPA 3CR7A 2VBCA 3EZFA 1XDBA 4Q48A 2IWRA 1G4UR 1DAFA 1SKYE 3MGCA 4PO1A 1KY2A 4GOKA 4D26A 4UNNA 5ELXA 3KXLA 4C0SA 2QE7D 2X2EA 4JL5A 2WPDD 3JVVA 3PCRB 3C5HA 5FTKA 5J4LA 3BXZA 4B47A 4NBSA 1G291 5AWFC 4B3FX 2YKGA 1EX7A 3KB2A 4KXFB 4RJLA 3W3ZB 3TNFA 1KO4A 4OHXA 3UMRA 6Q21A 5F98A 3EZ2A 2R6CA 4ZI2A 1J2JA 4W7SA 4ZCLA 1KNXA 3AF1A 5TARA 1A2BA 2EVWX 1JPNA 2XGJA 3O8BA 3E2IA 1TEVA 2G1JA 2PX0A 4HLDA 2ZJOA 4HAZA 4RD1A 5DH9A 4Q03A 1C9KA 3BGWA 4BZPA 4Q5IA 1TEXA 3ZGXA 2HJGA 2XJ4A 1Z2CA 4B3CA 3BE4A 4XIGS 1R5OA 1JAHA 1W5TA 1KSGA 2ZJZA 1P2VA 3DOFA 4HDCA 5CJPA 3GLGE 5F9HA 2WJVA 1SVIA 3OIYA 2VP4A 5LD2B 2A9KA 3MD0A 3VHXA 2MMGA 3Q8XB 3SHWA 3KUDA 3CX6A 2DWPA 4Q9IA 2JLYA 4TYPA 1NLZA 2P67A 4IKEA 1E9DA 1HY3A 3NG1A 2O8EA 3KJEA 1PJRA 1L2TA 3BK7A 3EARA 2Q9BA 1KI7A 4OL0A 3K0FB 4Q7MB 4G0NA 3SFZA 1BIFA 4YDSA 1NVVR 3Q5EA 1DS6A 3K8YA 4BUJA 5CLLA 5KPDA 2HLDA 5FL7D 2R2AA 3FKSA 1XB2A 4PHHA 4LYHA 3WNCA 2ANBA 2AHOA 2O52A 2F3TA 1W2HA 3A1SA 1K8RA 4FIDA 4RCZA 4TMWA 1G7SA 3AVQA 4PHFA 3GLIE 2ZI4A 1JB1A 3G5UA 2CJWB 2CLCX 4NL4H 3ZVMA 2GWHA 4PHGA 3VTKA 5IRCD 4KFTA 1GRRA 1R4AA 4B73A 4EJSB 5AUOB 1CF4A 3C41J 3FVQA 2UVQA 4CZ2A 2QZ4A 1QHSA 1GRNA 2P6UA 4HUTA 3GCGA 5A0FA 3B13B 5AJVB 3FYHA 4Z8XA 2KJQA 2JLSA 4FMBB 3G0HA 2HEIA 4DCUA 2UKDA 3QXSA 3ZJYA 3FDIA 2ZE7A 3R8CA 4DBLC 3H4MA 3A4LA 3N70A 2I1QA 3T61A 4KFRA 3SYNA 2VRWA 4EPYA 3PENA 4PANA 4F93B 4MYHA 4RD4A 1XXHE 2IYTA 3GLFE 2BIFA 1AS0A 2OXCA 3B8HA 2FJUA 1GKIA 3I61A 3EW9A 2IYZA 4AD8A 4OI0A 2BVNA 2IYYA 2DFNA 4H1VA 2Z4RA 1ZIOA 3WMFA 1LB1B 2C9CA 2FEOA 4RKEA 4WXPA 2QN6A 2KWIA 1J8MF 3WNBA 2IX3A 2OSBA 1Z0KA 1ZUHA 4RZXA 3TQCA 4PC6A 1SHKA 3GP8A 4DLXA 3LQQA 3L0SA 5DIFA 4QNRA 4O3MA 1CKEA 4JVLA 4LHVA 1DAGA 3KJIA 3BIFA 4B44A 1CR2A 5JZVA 1KJZA 1I2MA 3NKVA 3QBTA 2XEXA 1II9A 2RCNA 2WPDA 3HU1A 4LJ6A 1KZGB 2IYWA 2QAGC 3THWB 4Q1BA 2XZLA 1E79A 4RD0A 2GXAA 1WE2A 2CL0X 3T35A 1SXJB 3ZVNA 1DAEA 2BM1A 1TQ2A 3IIKA 4TMTA 1GDDA 1IN4A 1JR3E 1CXZA 4LBWA 4YMSA 4I81A 4XWAA 4OJKA 4MDEA 1G3QA 2GVZC 2RH5A 1VYVA 4YC7A 4GT1A 3THOA 1CR4A 3QKSB 4FN5A 2FSHA 2FSGA 4B48A 5KYKA 1OIVA 1R0WA 3KXKA 4QJ5A 2JIZA 2P6NA 3IPXA 5FTNA 1XXHA 3GLFA 1ZU4A 3K70C 1DAHA 2QMHA 1X6VA 1G64A 3FMOB 3GJ7A 2W0MA 4I1SA 4P31A 3VNUA 1OXSC 4WAUA 1KKLA 1WMSA 1YHNA 2BBTA 4K46A 3WBKA 1AK2A 2OAQ1 3CX7A 3ZS9A 1HUQA 2VHJA 2WIBA 1JALA 2JEOA 1D6JA 2G88A 1OKKA 3IBYA 1QVRA 2FSFA 4V0MA 1VIAA 4M1YA 5FPKA 5L3QA 3NC0C 1Q0UA 4Q4JB 3LBIA 1NVVQ 1GFIA 4HDQB 3SEAA 2VHTA 2YC4C 1Z2AA 1Z47A 4DLYA 2WWYA 2FG5A 1WA5A 2DB3A 3NH9A 1U0LA 3TUIC 1R5NA 2XTNA 3LW7A 1TU3A 1XNJA 4DIDA 5J47A 1GAJA 4AKEA 3U4QB 2ZRFA 1IQPA 1UDWA 3ASYA 3B1YA 3QPWA 4UNSA 1QZXA 1TX4B 4Q1EA 3RS5A 4MYTA 5L8VA 4TZ0A 1ZM3A 1CLUA 1ZJ6A 4RFSA 3AF4A 4MGZR 4PZYA 2WJGA 1IOZA 5KDDA 4URZR 3CF6R 4EFMA 3ND8A 5A4JA 2FF7A 2CLDX 3KFVA 4LPSA 2J0SA 2R8RA 3LQRA 1UAAA 5FPTA 4BZXA 2QT0A 1H8EA 3BFXA 4DIEA 1NF3A 3GJ0A 2CCGA 5C2JB 1E1RD 1KSFX 3ICQB 2PLFA 2DFTA 1E2KA 1U9IA 3IBGA 4GL2A 1FTSA 3B2EA 1KI8A 1OFTA 2KI5A 5KNCA 2XZOA 2VO1A 1E9CA 2HF9A 1U9IC 4LJ9A 4Q1FA 1PLJA 1SZPA 2AK3A 3CX8A 4BE7B 4YMTA 3WHKA 1UBCA 3DPUA 1MKYA 2FFAA 3ZIAD 4GDFA 3RAPR 3AVYA 4N3NA 5G40A 3AVOA 1KZ7B 4ZDIA 4XVRA 1DBSA 1TADA 2IF2A 4B33A 4DDTA 3W8RA 1W4AA 1YQTA 3D31A 2IUTA 1WBBA 4V03A 5FL3A 4E03A 2ORIA 4QKQA 2FSIA 1EG7A 1X86B 3CIOA 5G3ZA 4DLZA 1VCMA 4JVMA 4US2R 3I5YA 3IIMA 4PHTA 3V00A 2Q9CA 3T1VA 4Q4HB 3AVVA 3IDQA 2QAGB 3EX7C 3GEIA 2IW3A 4E22A 5KUTA 2O0KA 2QENA 2LKDA 5EXPA 4LJ8A 3CO5A 2ZYUX 4KYIB 4X8MA 3QUSA 5JFGA 4GI7A 4LJ7A 2DCUA 4HLQB 2J3EA 2VHCA 4PR0A 4DSNA 5DN6A 3ZD6A 1J90A 2G77B 3ZVLA 1UDXA 1W48A 4Q19A 2QGNA 3CUEF 3W6OA 1G4AE 2WV9A 1HH4A 2ZE5A 4HZUA 4WIAA 5JCZA 2CVHA 1TQ4A 4L9SA 5P21A 4QBFA 2QE7A 4TYQA 1JPJA 3KJHA 2ONJA 4BRUA 4DB4A 4XOIA 4CEHB 1N6PA 4EPRA 2WHXA 1G21E 1GL6A 2XX3A 3B1XA 4XH9B 2YV5A 3T12A 2XTMA 1EWQA 2FNAA 5D3QA 2ZQ5A 4IRUB 3LAWA 3WMEA 3ONWA 4TN1A 2NZJA 4PC3A 1KY3A 4PQYA 5E4FA 3HJNA 4HAYA 2O8DA 4MYUA 4ILEA 3R9WA 2ZJ8A 4TL6A 1OH6A 1SVMA 4A4DA 3K09A 1XEXB 3CRMA 1M74A 3FTQA 3MRSA 3QIAA 5C4MA 5KO2A 5GJWC 1U94A 4HLUA 1CIPA 4ARZB 4F4IA 3U61B 4Z8YA 1GTVA 3LY5A 1D5CA 4JBXA 5E7MA 3R8FA 3CRW1 2PMKA 5AJYA 2IK8A 4V0KA 3HU3A 3QI2A 4POAA 4AKIA 1Q1EA 2D7CA 2GCNA 3RRMA 4NCHA 4ZI3A 4LSGA 2OBNA 4QM7A 2AN9A 3EZ6A 3MMPA 2J87A 2IS1A 1DELA 4X8HA 4L15A 3K0CA 2RB4A 2EWWA 2DFKB 1IN5A 1E3MA 5F2EA 4HZIA 2O8CA 1E4VA 1E9SA 5H70A 5AK0A 1E2DA 4FMCF 3ZZUA 4NCNA 3GJ6A 3R7WB 3TSZA 4GPTA 4XWOA 4IXMA 2X77A 3OHMA 1QBKC 4Q21A 1XX6A 4UNRA 3PJRA 3VR6A 2IS6A 2JLXA 1W4RA 4PSAA 2Q3HA 4P33A 2HCJB 1LY1A 4QHSA 3D7MA 3WBJA 2C04A 1NBME 4IEIA 1AS2A 1PUIA 2QG6A 3MG9A 1E2LA 1NP6A 3LV8A 4C0JA 4EIWA 1KK2A 3K0EA 2MSDB 3QF4B 1F2UB 4B71A 4CF7A 2J0QA 2QSYA 3THXA 5GJBA 1E2JA 3OAAD 4UXHA 1XPUA 2QGZA 3E70C 2VPPA 2GZHA 1XCGB 2IEYA 3FB4A 2ZVPX 1Q21A 2DPXA 1ZMXA 1IBRA 2A5DA 4QHTA 4QM6A 4DZZA 1P9NA 4C7OA 1AIPA 4Z54A 2OCYC 2GF0A 3SC3A 1G6OA 3AGQA 3KQUA 1IXRC 4JIMA 4ACAA 4GMXA 5HR5A 2ZSDA 5B2ZA 2OCPA 1FTNA 2D74A 2BOVA 3VKWA 4C0KA 4JLMA 3ETLA 3ZZTA 3EPJA 2CK3A 4MDFA 2DBYA 2IUSA 3GLGA 1T8UA 4YDHB 4XSGA 4AYTA 1NKSA 2Q3MA 5GVSA 1QF9A 5H8WA 2SHKA 2R6AA 2VSFA 4AI6A 3MWJA 5FPYA 2QEQA 2JLQA 2VP6A 1P3JA 1TF2A 2A2ZA 4V0LA 2ZAMA 1J99A 2IYVA 2QRNA 1RVDA 4C0LA 4PX9A 1UKEA 4FMCB 3TVTA 2GAOA 1Z07A 5DYGA 4KODA 1KK0A 2NZ8A 1OW3B 2V4ZA 1RKBA 4Q1CA 1AQUA 2JATA 4A9AA 1E9BA 1TU4A 2I1VB 1C4OA 2NTYC 1TTTA 1CTQA 3D3QA 4D0LB 2WAXA 1MO6A 2BMDA 1SXJC 2GA8A 2VF7A 4ZCIA 1E79D 3LLMA 2GEUA 4PAMA 2ANCA 1DAKA 2GCOB 5IK2D 721PA 5FPHA 1N2CE 1NN1A 3ZQ6A 4HEJA 4KHZA 3C16C 4HLCA 2J0VA 3F0TA 4RD3A 2WWIA 4O2RA 1GM5A 3CRVA 4BEBA 5TXGA 4CEJB 2CXXA 1S96A 3FHCB 1RW4A 3MFYA 1UF9A 5LB2A 4BLOA 1FUUA 2YYZA 2OBMA 4KFSA 3PIRA 3KUCA 2QL6A 3KFXA 5IDVA 2ATXA 1SKYB 1Q1ZA 3J81k 1E2IA 2C5LA 1T5IA 2ODEA 3FMPB 4ASUD 2NIPA 4XTRA 1Q3TA 1NVWQ 1GITA 4GP6A 4FCWA 4IDQA 1KI3A 4ZIRB 4X8OA 5FUYA 3BORA 3ZLJA 1Z8FA 4JBWA 3PG5A 1JNYA 4DT1B 1P5ZB 1IN7A 4W9MC 1KJYA 1G6HA 3TLXA 1ZD8A 2GXQA 3TR5A 5KPJA 4Y0VA 4BLRA 4BFVA 5DHAA 1QVAA 2A3RA 2YWEA 2G0NA 3V4RA 1KDOA 4DCTA 4CEIA 3VKGA 3OFND 3LLUA 3ADKA 3B82A 3PUXA 3VR2A 2ZRMA 1DTSA 1CJVC 2J59A 5G41A 4RVCA 5DI9A 4KV9A 3WYAA 1S9HA 3QKUA 3LVRE 2H8KA 4WVFA 2IC5A 4U00A 4R2IA 3LRPA 5EP4A 3LD9A 3RYTC 4P4UA 1GKYA 2NGRA 4EQ6B 4A0FA 4EPVA 4KITB 5C4GB 1M7BA 3IO5A 1G41A 3P4XA 3QXJA 1V5WA 1T0JB 3CWQA 3FOZA 4R2HA 3CF2A 2J46A 1AZSC 4BFYA 2KBFA 5GADl 3PVSA 2WMOB 3KKNA 1BKDR 2QROA 2O0JA 3FHOA 3BD9A 2W2XA 3U3MA 4KO8A 2Z0MA 1M2OB 4C0AC 3NHBA 2B7BA 2QP4A 2ZITA 4BLSA 3DZDA 3ADDA 2B92A 2GK6A 5E7JA 2GEVA 1CRPA 2YWHA 4M9XA 1IY1A 3HPRA 3A6PC 2V3CC 1VYTA 1UEJA 2BEJA 1EESA 3QBVA 4GZMA 4LC0A 5IF9A 5FOVA 3FFAA 5LD2C 1Z0JA 3FE2A 2F1JA 4LX0A 1Z0FA 4HB3A 3A8TA 2IYQA 2H16A 4LYJA 4MGYR 4D2IA 2PMDA 4JLBA 4QC2A 5A5GA 1MOZA 4TLCA 3AUYA 4DLTA 4EFLA 3I72A 3AKDA 2ODWA 2PT7A 4MKFA 1U8YA 4LJ4A 1VECA 2AXPA 3NVAA 3VNVA 2N1BA 2H92A 2Z4SA 3AVWA 1NG1A 1Z29A 2OBLA 1TNDA 5D3MA 1CU1A 4UXJA 1R7RA 4F92B 5CIWA 3GJ4A 2P5TB 1R0YA 4M22A 1CR0A 2BMJA 1CEEA 2PX3A 4NPHA 1SVSA 1RYHA 1F2TA 3KB1A 3VR3A 3WYGA 3X1ZA 1IJEA 2O8BB 1Z83A 1GUAA 4A8JB 1VG9B 2A7QA 3G82C 3S1AA 4FWTA 2FGKA 1AKYA 2TMKA 2GJKA 1NKTA 2ZSBA 3RRYA 1MR3F 1SVKA 1M1YE 2O0HA 3AVXA 2ZEJA 3WP0A 1KI6A 3ZIAA 4QG7A 1SULA 4NH0A 3GLIB 1J70A 1ETUA 4PPQA 3AP3A 4PAOA 3EPLA 2EFCB 2RKOA 4D4MA 4AY2A 1JECA 3K70D 3PXGA 4CRWB 3FKSD 4PTLA 3ZH9B 3KQKA 3KJGA 2CHVA 4F4CA 2VHQA 2J0UB 4TTPA 1JQJC 4KSCA 5DN6D 4JMPA 2IF0A 3REGA 4HUQB 3FKQA 3BS4A 4FD2A 5JHHB 1II0A 2KSQA 3RC8A 1YJ5A 2R44A 4ZKDA 3VAAA 1CRQA 3PITA 1Y3AA 4JLNA 2VEDA 2ZI5A 4LOAA 2X2FA 4YONB 3RC3A 3SOPA 5FR1A 3EWSA 5FBVB 2D62A 1RYFA 3A1UA 1VCNA 2C99A 1U0HC 5K8UA 1UJ2A 2WTUA 2VP2A 1MO4A 1WXQA 1QG4A 3FFBA 3RS4A 4PAQA 1RJ9A 3TE6A 3CLVA 5BYKA 1L7VC 3C7KA 4NZYA 1W36B 5KOYA 2IYXA 1U81A 4B76A 4WBSA 1BOFA 4MH0R 1D8TA 2V6JA 1CJKC 1A4RA 2REXB 4DSOA 4KCGA 3TIFA 5J4HA 5SZHB 1ZC3A 2RGGA 4B32A 4TLBA 1K5DA 621PA 2H1LA 2ZVQX 3EG5A 1L8QA 4DRZA 3AKYA 4MKGA 3LFUA 5CJ2A 4D82A 1BH2A 3ZZ0A 2IXFA 2PCLA 2V54A 2CLSA 4DJTA 4V0NA 4B34A 4R98A 4JLPA 3EZ9A 2HJVA 1HQCA 1RRPA 4M1WA 4FCTA 2ZRGA 1Z06A 5FTJA 3KDSE 4D81A 5FI1B 1P2SA 3NC1C 3UWOA 3MWLA 1C1YA 3CB4A 2UZ3A 2VYFA 5HPYB 1JEEA 5TB5A 4O0MA 1CR1A 2F1RA 3T15A 3P1JA 1N6OA 5KDLA 3FPAA 4Q18A 1P4SA 2C95A 3QSYA 1F5NA 1PLKA 2JGNA 3QG5A 4JJKA 4RD2A 5EP3A 4FXPA 1KDTA 3KTAB 3NTUA 4KVGA 2ECKA 3TAUA 4B43A 4LWZA 5JS8A 2OUKA 4NTZA 5JWRA 4PQFA 1MV5A 4OK3A 1IXSB 2NO1A 1Z0DA 1RFLA 1JEDA 3QQ5A 4I99A 4BWYA 3DKPA 3L2OB 4V0OA 5JMTA 2XJ9A 3QKTA 3QXXA 1Z6GA 3QF7A 3R9IA 4A92A 1W2GA 4B6FA 1L4YA 2XZPA 4RFVA 4NYJQ 1CJUC 1KAGA 2GJ8A 2GJ9A 4TSFD 3MWYW 2IT1A 2EQBA 4BFSA 4DDWA 1SVLA 2KE5A 3NXSA 2IS2A 4WXRA 3WP1B 1TF7A 1Z22A 4I1OA 4GFDA 2EU8A 3H0KA 4F91B 4TMZA 4B35A 4DUGA 5JI2E 3REFA 4Q7KA 4B3GA 4IDNA 1WF3A 3GPLA 2ERXA 4MRSA 3PUYA 4D4LA 1N6LA 3IQXA 2XAUA 4N0DA 1F3OA 4C2TA 1ZINA 2A5YB 2JJ2A 4IFBA 3KKOA 2WVJA 2ZE6A 2DYKA 2NOAA 3CKLA 3HDTA 2NPFA 5JS7A 2AFIE 1NJGA 4IOLA 2BWJA 2CE2X 2HT6A 1E0KA 2VA8A 2QPAA 1IN6A 2BJWA 3KKMA 2VP9A 4N1AA 2IXEA 1GZSA 4G5SA 1NNEA 4QBIA 2WOJA 4C2UA 2ZJ5A 2ZRJA 3AF0A 5FOXA 2GJAA 2E1RA 3I1FA 2PZFA 1PUJA 3SQWA 1R6BX 1XTKA 3KX2A 1ZVQA 4JLDA 2FFBA 1W36C 4OK5A 2FV8A 1JR3A 1VCOA 4DCNA 5JBQA 2WWGA 3LWNA 3Q85A 4XVUA 4URXR 5KNDA 2BKUA 5EP2A 3IGFA 5CIQA 1YE8A 5E7IA 4PZZA 1JXOA 1MH1A 4EDHA 3L82B 2JAQA 4YXWA 1X8LA 2VQSA 4IVQA 4PC1A 2W6JA 4HZUB 5DNYB 2V8OA 4HAUA 1QG2A 5AUNB 5TDHA 2B7CA 2WBLC 2ZXUA 1GOTA 5EE9A 5J5CA 1QHIA 2WM9B 5CM9C 3VHLB 4BASA 4KLZA 4JKIA 3UANA 2B8WA 2E9SA 2GZAA 3QPUA 4U02A 3B9QA 3IQWA 1OH7A 3QEOA 2LKCA 3MJRA 4LV8B 3PEVA 4BPBA 1KTVA 2B6HA 1FMLA 1S0UA 3A1VA 1VHTA 4TWZA 2VL7A 4A0GA 1RRCA 2JASA 1GWNA 1DG1G 3A4NA 1N0WA 4TL8A 4TZ6A 2X1VA 3OIUA 4M9QA 1XJ0A 3NEYA 4H1UA 3B1ZA 1KKMA 4Q02A 3BFVA 1WDTA 2J45A 4ZCMA 4NKRA 3OESA 1NVUQ 4GNKA 1A5TA 1VG8A 2NO0A 1II8A 2PJZA 3B6EA 3K53A 4V02A 5CDFA 4EPXA 2ZYWX 2BCGY 4YQFA 4ZO4A 1OPXA 5EZ6B 1KDPA 3PUZA 2ZU6A 2W6IA 2FFHA 3K9NA 4DSTA 5JSZA 1P2TA 3IILA 3PUWA 4PSKA 4BFXA 1ANKA 4JLAA 1PVOA 1UM8A 1VMAA 1R5BA 1ZYUA 5LB4A 3U3OA 4B75A 4HDOB 4BECA 5JEDA 1N6HA 3P27A 4HB0A 1X3SA 5HCIA 1W46A 4GMDA 2F7SA 4IOJA 4FMDF 4TMKA 3GLHA 1N25A 1QHGA 1VYUA 2ODNA 3QG1A 1XD2A 1O3YA 3CM0A 1KO8A 4TYNA 2BCJQ 1DO0A 4IJMA 3OF5A 4C0BA 3AH8A 1NIPA 3ZS8A 4CGZA 4PZLA 2QY9A 3CONA 3RSLA 5HTKA 4DKXA 4C3ZA 3GMTA 1E69A 3BFKA 5EXTA 4HB2A 1F2UA 4NE2A 4G01B 2NO7A 4US1R 4JSYA 3KL4A 1YRBA 3W5IA 3UG6A 2XXAB 1H65A 2GCPA 4M0LA 1D9ZA 1YKSA 2FA9A 1Z3IX 2AFHE 4B3XA 3T5DA 2Q0HA 3SZRA 2OE2A 3LA6A 4DCVA 2FWRA 3DEFA 1N6KA 2RGNC 4D80A 2RMKA 4UQOA 4F38A 3HPQA 3AVTA 4BRWA 1SGWA 1ZD9A 3K9HA 3I5XA 3F8TA 3VX3A 3Q9LA 5JJLA 3C5CA 4F4JA 5DI3B 4WZBE 1E6CA 1KHTA 4O25A 3LX5A 4M21A 3I32A 1W1WA 3DL0A 1P9WA 1E0AA 3GLHE 1JR3D 3WXMA 1E2GA 4KU4A 1EK0A 2D2FA 3QVUA 4TMXA 3PR1A 4C30A 2B8TA 2EYQA 5FBRB 1T9HA 1KAOA 1R8SA 3TGPA 1DPFA 1EFUA 1ZU5A 2QMUA 2IA5A 1I2DA 1T3LA 1VPLA 4F7WA 2BHRA 1MT0A 2ZRLA 1TUIA 3NEJA 2AWNA 4PQRA 4JSTA 1E9EA 3THYA 4R71A 2Q6TA 3RS0A 2JJ1D 3QKRB 1E1QA 2JLZA 2P3SA 4DXAA 5EP1A 3BB1A 1IY0A 1XMIA 1GILA 2CVFA 4ERNA 4JVSB 2ZR7A 4P32A 3TVDA 3A58B 1MABA 4Q1AA 5EQTA 3AV0B 3VR5A 4M53A 4GBMA 3BOSA 3B78A 3B85A 1K6MA 1LFDB 1JJ7A 1S9DA 3RS7A 4D0GA 2QQEA 2A5FA 2CJWA 4L8GA 4CEJA 3W9YA 1E2EA 3U3JA 2Q9AA 3RVBA 1G7CA 1T0HB 4K81B 2X8AA 3K9GA 2OFXA 4LUCA 3LX8A 1YR9A 2RGCA 3I8XA 5B64A 1A82A 1QDEA 3IEUA 2O8FB 4JL8A 3VX4A 4EFNA 1KJWA 3HWSA 4Q7LA 1SXJE 3MSXA 4GRAA 2J41A 3GEEA 3IIJA 2BMEA 4PPGA 5HCNA 3Q7PA 4OYHA 2FN4A 1TMKA 1DAIA 4DT1A 4M1TA 5E3HA 2ZS7A 3C15C 1FUKA 3SFVA 1QHYA 2OO7A 3KZ1E 3JZMA 1X1RA 3QE0A 3DOEA 4JJZA 2CCKA 1XJCA 2QBYB 2GTPA 2VIIA 3ZVRA 4CEIB 3SYKA 4B3BA 4AURA 3MLEA 4YXWD 3VKHA 3DHWC 3KKQA 4QGHA 4IOMA 4TMVA 2YWFA 1ONBA 3DO6A 1Z0IA 4B74A 1ZW6A 3OEED 2VP0A 4AWXA 1G7RA 4UXIA 1OYWA 3TSWA 3UWKA 5TY0A 2F9LA 2YZ2A 4BEJA 2IYRA 2F43B 3DM5A 1OH5A 1HE1C 4S35A 4HSEA 1LW7A 2AR7A 1UFQA 1KMQA 2REOA 5EUMA 4G1UC 3VU9B 1PZNA 4ZKEA 5FOWA 4ZPXA 5ANRB 3HU2A 2YC2C 5LBIA 1SXJA 3TJZA 1F60A 5CYPA 4DLWA 2HLDD 1GNPA 2FGJA 3MCAA 1KDRA 4Q4AB 3K09C 1IY2A 2O5VA 2ZRCA 2L0XA 1OIWA 2F9MA 3QKSA 2K5UA 1OXVA 2HV8A 2OG2A 4WZAE 4KBGA 1VG0B 1DO2A 4R9UC 2JLUA 1FL9A 2I4IA 3EIQA 5FFMA 2ZETA 2ERYA 5FTMA 4EAQA 1MO5A 1XD8A 3EIEA 1NY6A 4BZQA 5B58C 4K8OA 3CNNA 5CB8A 2P0EA 1ELOA 1AQYA 4B2IA 1P75A 2VH5R 5SZKB 4O2LA 2QNRA 2W2VA 2EFHB 3CW2A 1E9RA 4LGMA 1COWD 1XRJA 1OH8A 1OV4A 3NBFA 3QEJA 1W0KD 3QNUA 1EFHA 5J40A 5SZJA 2VLIA 1KMHA 3ADBA 4DEXA 1WB9A 4Q4JA 1WRBA 1XJQA 3BC1A 1RRGA 1G3IA 2FE4A 2IYSA 2X19A 4TTRA 4II7A 2JLWA 3ADCA 1LF0A 2AKAB 3R20A 4LHYA 1E1QD 4M9ZA 5EE5B 1QHNA 5M04A 3NDBB 5D3MB 2YHSA 2REBA 4P4TA 4DLUA 4TT3D 3K9LA 3BH6A 3ECCA 2Z6VA 2YJTD 1GL7A 2YOGA 1ZD1A 2JLVA 1DARA 2BBWA 4P3YA 4RFSB 4EJSC 5KSZA 2WSSA 5SZIA 5C1BA 5JJKA 1NN3A 3S1AB 1ZM7A 4TLDA 4U5XA 4M2LA 4OHVA 1W47A 1FQKA 2HXYA 2RGBA 4A2PA 1R0XA 3NHAA 3GLIA 4B6EA 2Q21A 4FCVA 4G5QA 3H1TA 3V4FA 4X8LA 2FDCA 2QTFA 2OILA 5GJVC 2ZPTX 1YVDA 1Q3HA 5F9FA 1EFTA 1EFRD 3PUVA 2J7PA 2YWGA 5JRZA 1XTQA 1E0JA 3N2EA 4MYCA 4DLRA 4M1KA 2ZSFA 1G18A 1OHHD 1XEFA 3LBHA 4MKHA 1E2NA 2R62A 2JDID 4NYIQ 5AUQA 3M1IA 4PC2A 4L9WA 1Q12A 2J0UA 1HA3A 3LW8A 3AGPA 1FPMA 1H8HA 5FBQB 1E94E 2G83A 4GOJA 1BMFA 2MSEB 1XPRA 4Q4HA 1UBEA 4C0HA 3AB3A 5FTLA 5JHGB 2DFLA 1H8ED 5E95A 5AR1A 5TVKA 2XSZD 2QP3A 2V55B 4NHOA 1NG9A 3OFNA 5FOSA 1COWA 1OIXA 1S8FA 3E5HA 3AEZA 3QVVA 1EGAA 2FPKA 3RWOA 1HEIA 2ASEA 3LH5A 2JIZD 1P61B 4LCBA 3DKVA 4EJSA 1FP7A 3AF3A 1G8GA 5DO9A 3OEHD 3ZD7A 2P2LA 1N5LA 3UXMA 1HYQA 4HB4A 1JBKA 2ORWA 2AWOA 1RJ9B 2P5SA 3HP1A 3OIWA 3OEEA 1SXJD 4Q9JA 4BFWA 4JLKA 3X1DA 4FMDB 1CBUA 1Q44A 4FI3C 3BB3A 1Z5ZA 4M1MA 1WBDA 3TUJC 1UKYA 3QJYA 4RKFA 2CL6X 1V43A 1YZGA 3ZQJA 1HE8B 1YZQA 5H68A 2D4HA 1G3MA 2HDNB 1ZAKA 3CH5A 4IVRA 5G3YA 4MITA 1DG3A 1U8AA 4GOXA 1YRAA 4AKGA 1YZKA 5K8IA 1KO1A 2LWIA 3AVUA 2ZANA 1LNZA 3W34A 1NMYA 5FBLB 4QRHA 5EXSA 1XEXA 1S3SA 3QXHA 4KVAA 3TH5A 4ARZA 2QU8A 5CM8B 3O8RA 3Q7QA 5B30A 3AKCA 3IO3A 3FMIA 3EIHA 4LJYA 2A5GA 4U7DA 1MRSA 2AD5A 3B9PA 2GBLA 1G9XA 2BV3A 3HYRA 2I3BA 1E9AA 3PV0A 1AN0A 1P60A 2CEAA 3U3KA 4A82A 2V1UA 2XB2A 2PT5A 4W5HA 4DLSA 3U2QA 2IUUA 1PV4A 2GBLC 3LNCA 1K5GA 1XP8A 1XTJA 3CRRA 2OZEA 4WA7A 3WRXC 2JDIA 3L8YA 2EYUA 4TL9A 1LF5A 3SHFA 3PFIA 2ZYVX 1E2QA 3EWAA 3R7WA 3GFTA 1W0KA 2ZUDA 2V1XA 2MSCB 3IEVA 5G53C 4ZDWA 4EPTA 4NCIA 3P4YA 4LC1A 5AJWA 3F3YA 5TMPA 4LHXA 3KQHA 2KBEA 1Z28A 4AG5A 4LPKA 3TKLA 2QPOA 4DDUA 2OM2A 1TUEA 1W0JA 1ZIPA 4QNMA 2QM7A 1XXHB 3NIBA 4G5OA 3GLFB 1XTIA 3ICEA 1ZUIA 2QT1A 3WMGA 1S1MA 2PH1A 2IWHA 4W5JA 4DHEA 3CBQA 2C96A 3UKDA 5IHPA 2HYIC 3P32A 4TTQA 2RGNA 4CT5A 3RS2A 2WSSD 3TQFA 1ESMA 1KIMA 1W36D 2WJJA 3I8SA 4A2WA 2H5EA 3T1TA 5L3QB 5HKKA 1OLOA 4MA4A 1FNMA 4IEEA 3TAHA 4KFUA 1Q20A 1AGPA 5DE3A 3ZYCA 2W6JD 3SNHA 1SKQA 3EXAA 1DADA 3MJHA 1OFIA 4W5WA 4RZ3A 2FMXA 1FX0B 8OHMA 5IT5A 3U60B 3WNDA 4QHYA 2ZJYA 4YMWA 4OQNA 4RZUA 3D6TB 3TW4A 5JLJA 1S1CA 4UJ5A 1W7AA 2IHYA 3RS3A 2GXSA 1UKZA 2JA1A 1MO3A 3MAAC 4QGFA 1N5IA 1ZP6A 3KXIA 2ZREA 1HQYE 2ATVA 5EUQB 2FOLA 1NI3A 2R65A 2QAJA 1QHHA 3CNOA 3U7EB 3LBNA 3AUXA 4GSYA 4JYBA 2OFWA 4AC9A 4TL7A 4L5BA 2B21A 3TSOA 1W49A 4Z1MA 2XNSA 1DVRA 4OKSA 1NIJA 4BFUA 1G16A 4WZ6A 1EXMA 4HLUC 5KTYA 3U44A 3RLFA 4KJZA 1P62B 5JJIA 3HR7A 2WAYA 4QJ3A 2BBOA 3DDCA 1F48A 4Q4LA 3NWJA 2ZJAA 1L4UA 3QPVA 1XCPA 2QQ0A 1DOAA 1E4YA 5F3WB 4HAXA 1QRAA 1PLLA 3SJCA 2J7KA 1SVOA 2GETA 4DWJA 4D25A 1IN8A 1NN0A 3U7FB 1E32A 1RPZA 3TRFA 5J4YA 2YOFA 3K0AA 1G8YA 1GNRA 4BFTA 4BLTA 3SBEA 1M7GA 1IXZA 3AM1A 2GAAA 1NN5A 2AXNA 1NVXQ 1II8B 4Z51A 1NMZA 2FPMA 3O8CA 3SN6A 3I4LA 1ZNWA 4OHWA 4LHZA 1Z08A 1ZNXA 5JSZB 2JCSA 1GP2A 4URUR 3PQCA 4DC9A 1YR7A 2XTZA 1ODFA 4QOSA 4ABYA 2IEZA 4CEHA 1OE0A 3C14C 2OLJA 3EA0A 3BWDD 3O8DA 4RCYA 5DISB 2YOHA 3MUFA 4IFEA 4CVNA 1GG2A 2G6BA 2JJ2D 2C98A 1S3GA 1Q1BA 2OEPA 1UKVY 3GLHB 5C18A 1G20E 2BMFA 1JJVA 3NH6A 5K8LA 2CHQA 4ASUA 4Q9LA 2N42A 3Q3JB 1G5TA 1LS1A 2W58A 1GIAA 5FOUA 5L3SA 1NRJB 1AJEA 1XPOA 4JL6A 4P4SA 4OI4A 4QGGA 2CMKA 1G3RA 1IAQA 2CK3D 3GFOA 3RANA 3RNLA 2ZUCA 3U6KA 3RSOA 2PEYA 4XJXA 1US8B 4MRRA 1OXXK 4IOKA 4QFMA 3EZ7A 5BQ5A 5UKDA 4TSFA 3VR1A 2ZYTX 2C77A 1ZM4A 5IK2A 1HURA 5JECA 3U7HB 1HTWA 1CULC 2PZEA 3IKJA 4MUBA 4B2LA 3UPUA 1U8ZA 2QTHA 1ZCAA 2YVUA 3P26A 4OHYA 1WQ1R 1KI2A 2ZI3A 3K70B 3NBYC 1N5KA 3EC2A 4A15A 2Y8EA 2GXUA 1KK3A 3KQLA 2ZRAA 5BWMA 2P6RA 2JJ1A 2W2TA 2OAP1 1ZM2A 3KKPA 4LHWA 4QBGB 1HV8A 3LO5A 1E9FA 3I3SR 2P65A 5FI0B 3T5GA 2GHIA 2WZQA 4TLAA 1KI1A 1N3BA 3B5JA 2W83A 3EAQA 5KSYA 4TYWA 1T3SA 2ZIAA 3UMSA 2AD1A 3OIVA 2Z5FA 2A30A 2ZU0C 4MRPA 1I4DD 2NPIA 1IONA 3SJBA 3LXRA 4JLVA 2NQ2C 4AYWA 4CIDA 4ITRC 5CK4A 3GJXC 2YNMA 2QA5A 2QTVB 5JRJA 1JR6A 4MQBA 4BFZA 1G7TA 2QI9C 1VCIA 2BDTA 4NDZA 2VTKA 1T8TA 2IL1A 4WW0A 3AKEA 5HE9A 5BN4A 3RDPA 1ZCBA 2JJ8A 2WJIA 2C8VA 4LJAA 3QKRA 2EFDB 3GFPA 4KSBA 3B60A 5B57C 5EE1A 4Q1DA 5HZKA 4M1OA 1WCV1 3LXXA 1RRFA 4C7OB 1KI9A 2ZJ2A 1N6RA 1F2TB 4L16A 3U5ZB 2O8BA 1JI0A 2BEKA 2ORVA 5DLQC 1N0UA 4JYCA 4ACBA 1XEWY 4XD7A 4JBYA 2DR3A 4Z1MD 2HF8A 3GLGB 4I1UA 3M4YA 1OB2A 2QMOA 4L4UA 1M34E 2V7QD 4C0QC 2IS4A 2O8FA 1A7JA 1OT3A 1TF5A 4E09A 1G8FA 1NL3A 2PL3A 4DDVA 1Q22A 1FQJA 4B3DA 4QJ4A 3EA5A 3KQNA 3M6AA 3BERA 3IUYA 2WICA 1M7HA 5FOTA 3A4MA 1U99A 1OJLA 4A36A 5HE8A 5AJXA 3GD7A 2RHDA 2O8EB 1P73A 4Q7JB 3UATA 3K0FA 1VHLA 1HT1E 4A2QA 3QOFA 4LZZA 1UEIA 4AK9A 4DEYA 2NMVA 5BW8A 2GCOA 5DYIA 4QXAA 1P7CA 1DEKA 1R2QA 4E5UA 3BAFA 3K1JA 1DE0A 2FX3A 5LPNA 5GVRA 3EPKA 3CH4B 1A2KC 4C4PA 3DMNA 1Z6AA 1ZRHA 2FZ4A 4URVR 5BYJA 1XTSA 1X8KA 4PPFA 4A0RA 4XTCS 2GJSA 4MGIR 4OHZA 4OI1A 2GKSA 3A1WA 3L43A 3WRYC 2F43A 4M4SA 2NO6A 3W6NA 4LY6A 3A37A 4NYMQ 4A8JC 1NBMD 1A1VA 2ZRBA 4GZLA 4IDHA 4C9BA 1QHXA 2IYUA 3EPHA 3QY0A 2J1LA 4US0R 3VU9A 2G1KA 1RE0A 3ND9A 2H17A 4OI2A 2ZI9A 3O47A 1OB5A 4UJ3A 3BH7A 1AKEA 4LRWA 2GK7A 4E07A 4KAXA 4PO8A 5HKKD 2G0TA 5GJCA 5KDOA 1UBGA 4Q4AA 3AVPA 1XMJA 4RZ2A 1IJFA 1NLFA 4NMMA 4KYUA 3RHFA 1E96A 1GKUB 1R8QA 3CWZA 3BRWD 1M8PA 1N5JA 2KB0A 1YZNA 2F1IA 3WYFA 4WOPA 4TQAA 1P2UA 4Q66C 5FUVA 1FZQA 1E2FA 1Z0AA 2F3RA 4LBZA 5DGXA 2NO9A 3HYTA 5HZHA 1KGDA 3RWMB 1E0SA 3L0OA 2OT3B 4MGKR 4A1FA 4Q9HA 4Q00A 5FH9A 1ZC4A 2ZI7A 2V7QA 5BN5A 3X1XA 2ZI6A 3GJ3A 1N6IA 2GDJA 4M8NE 1GNQA 1LV7A 3X1YA 5JCPA 3UK6A 3JZAA 1I4LD 4Q9KA 4RY2A 2WKQA 3AP1A 4QBHA 1G5RA 1VTKA 2BC9A 2ZRIA 2GRJA 4D0NA 2D06A 1OSNA 3THWA 2OCBA 1Z63A 2C9YA 4KI0A 2Q3FA 4HAWA 2PEZA 1KO7A 3K0SA 2C2HA 1W44A 2CBZA 4DCSA 1GSIA 1YZUA 2OV2A 2WKPA 4G3XA 5C46F 3B1WA 4XWKA 1U0JA 1Z6XA 2QP9X 4LBYA 1Y63A 3NDPA 3W6PA 2CDNA 3CPJB 3SYLA 1OHHA 2VSOA 1EX6A 3CZPA 4N0EA 4HATA 3SI7A 4XVQA 2RHMA 1S2MA 2J5XA 5EJEA 2D7DA 4TYYA 2E87A 4PFSA 3FHTA 4FINA 2V6IA 3N5CA 2R9VA 2WJYA 2ZAOA 2RAPA 1W4CA 3SU8A 2F1HA 5H1YA 1KOFA 3TUZC 1Z6YA 3WHLA 1ZM9A 4H9GA 2Z83A 2ZRNA 1B23P 4KLNA 2AK2A 2VHUA 5FR2A 1VDZA 1Q1QA 4TT3A 3VFDA 2J9RA 4BLQA 5FBWB 3EASA 4CDGA 4YLGA 3SE0A 1XMVA 5FPSA 4MUAA 5JEEA 5FUWA 4PXAA 4OQFA 3VMFA 4MKIA 2ZSAA 3IPYA 2Z43A 3U4QA 2GILA 2JLRA 1NY5A 1B0UA 2N46A 3X2SA 2UZIR 2EFEB 3B1VA 4Y0AA 1T91A 2BKEA 4UNPA 4DB2A 2FH5B 1JXMA 5DHFA 2H7VA 1N0VC 4D6PA 3TMKA 2ZR9A 1ZNZA 3BJIC 4A8JA 2RGAA 2QSZA 2WMNB 3BH0A 4DSUA 3HR8A 2DY1A 3UMFA 4DVGA 2YINC 3IHLA 1GRQA 1OXUA 2RGEA 4Q01A 4BQSA 2CNWD 2WWWA 5CB6A 4S2EA 4D4KA 4G5GA 3RRNA 5FL7A 1FP6A 1KI6B 1OFHA 2W0SA 3A1TA 1FMJA 4XD7D 2GEDA 1AM4D 3WY9A 3TBKA 2R6FA 5JI3E 4I4LA 1G5PA 4RSGA 4JT4A 5L3RA 2GZDA 2OXRA 3QENA 3T34A 1XBTA 3OE7D 3SDZA 3K0CC 2FEMA 4URWR 2W6ID 3T06B 1AGRA 1YZTA 4HYYA 1AZTA 3OZXA 4FWIB 1NBMA 2VP5A 3AP2A 1XMSA 1CJTC 2D2EA 4ON9A 2WOOA 1AA9A 1J8YF 1YR8A 3ASZA 3LDAA 2J7PD 4PC7A 1U98A 5EE0A 4DUGD 2D3WA 1TQDA 1JAIA 5CLQA 2XITA 3I62A 3OAAA 2QAGA 2QUZA 1E1RA 2PZGA 3OEHA 4HUQA 2CHGA 5DSZA 4EPWA 2ZROA 2H57A 2IXGA 1RIFA 2XNDD 4KBFA 4LJ5A 4NONA 1D2EA 4IDPA 2IHBA 1G3UA 421PA 1E98A 1R0ZA 4AIIA 4TQ9A 3H86A 1H8HD 1W0JD 1XU4A 3C4JA 3FWYA 5TV2A 3D8BA 1DAMA 4IW3B 1FW6A 4R7ZA 3RABA 3M0EA 3VR4A 3AQ4A 4AG6A 4PSVA 1OXTA 1KI4A 4AKHA 3IHWA 3W3AA 4QL3A 2HUPA 1CP2A 2ONKA 4BLPA 5J4VA 1OYYA 1XWIA 2F55A 1YU9A 1M6NA 2XB4A 2OFOA 2AX4A 4CW7A 4ZDKA 2OLKA 1VIYA 3T1QA 1KYIA 4I1VA 1FNNA 1HT2E 3CZQA 3GJ5A 2O8DB 3BBPA 2AL7A 5EZ5A 5JWOA 3Q5DA 1E2HA 4YMUA 2QORA 1R10A 1SQ5A 2VSXA 1OFUX 2BM0A 2EFGA 3CRQA 3SBDA 1VG1A 2EW1A 1BMFD 1JQLB 4P0TA 1KNQA 4JLJA 1KK1A 5CK5A 3SR0A 2XXAA 3GQBA 3LVQE 3W90A 2FZLA 1NMXA 1XFAA 1TQ6A 2R6GA 2IBMA 4NU0A 2MMCA 3L8ZA 821PA 3OE7A 3UIEA 3KTAA 1OF1A 3N2IA 4RD6A 3V9PA 2V9PA 4OQXA 2OCAA 2ZRHA 1EFRA 2ZE8A 2O8CB 5LDDC 4AYXA 4V0ME 5DI3A 2OESA 3I73A 1U2RA 4LV5B 1FX0A 3ZDQA 3I92A 5CITA 1SHZA 2PCJA 4NYJR 5L3VA 3U3RA 1E2PA 3TK1A 3DM9B 3P20A 5JWHA 3NBZC 1AS3A 4LI0A 1KSJA 2A5JA 2IYLD 4FW9A 5K8TA 3AF2A 3JVUA 1NJFA 4QGAA 2GESA 2H18A 4UNQA 4CYMA 2W00A 1G19A 2WWFA 2XOKD 4OJQA 3B7GA 3DMDA 1GL9B 3CR8A 1UADA 2ZRPA 1NSTA 4GP7A 2A78A 3QF4A 4B2PA 1YR6A 3GEHA 4JZKA 3UG7A 1G1MA 1WP9A 2DWQA 3A36A 3THXB 1X1SA 1QHHB 4BGDA 2XSZA 2ZRKA 4M9SA 3SJAA 5KSOA 3THYB 5BXQC 2LCFA 3MWKA 2PBRA 2C78A 1XTRA 4NYIR 2ZJBA 1SVWA 3PEUA 1T4GA 2ZR0A 1TAGA 1MABB 4LV6A 5KNBA 4NCKA 2HYDA 3U44B 2HCBA 2FPLA 4HI0E 2ZRDA 4LDJA 2CCJA 4LYFA 5AJZA 2CNWA 3CPHA 1YZLA 3NBXX 3VQTA 1CJMA 1FFHA 2EWVA 1Q57A 3U6BA 4LYAA 4JKYA 2QRZA 1W4BA 4CT4B 4PPNA 1XEWX 1N6NA 4D4JA 2ZS9A 1BS1A 2WSMA 1T6NA 3SQXA 121PA 1KSHA 1G8PA 1U90A 2VF8A 3H84A 2G3YA 4EKDA 2BJVA 4M1SA 1EFCA 1XZPA 3TR0A 2G9NA 4MRVA 3K0AB 3H2YA 2XNDA 1NLYA 1RC8A 3CNLA 1TPZA 4A6XA 1EWRA 2CL7X 5J4KA 4PO9A 2ZS8A 4A6PA 2BBSA 1E99A 1MRNA 4JVNA 3EC1A 3BB4A
chains in the Genus database with same CATH superfamily
1P9RA 3QXCA 3WLMA 1QZUA 4KQFA 1G17A 4HN2A 3LG2A 4DMLA 2B1RA 3F47A 2FN3A 2X5KO 1JQ3A 4NP6A 5DSXA 1N2CB 4NCJA 1S2OA 5G1NA 4KKVA 4RF5A 2XGSA 4IHQA 4UPDA 1D2MA 3RSSA 2MDTA 2RI0A 4OBEA 3TW8B 1CT9A 2QBYA 2W8BA 2BFDA 1RWWA 2ETXA 1CS4C 2Q3DA 2NG1A 3OC6A 5IVPA 3BD7A 1U2SA 2A4KA 4PRYA 5A4DA 4PRZA 3OP4A 3RSQA 3ZVKA 4OK6A 3HADA 1JAZA 3BRQA 3HCDA 2R6DA 1TL7C 3NPAA 2F6RA 2WWXA 4M6WA 2NPOA 3PEWA 5HIMA 1DJNA 2Y1WA 4JBNA 3MINA 5B1DA 4RLSA 3SQNA 2XOKA 3Q72A 4P4SB 4TKVA 4OVKA 2GUGA 2A9JA 4J0QA 2ZCUA 3MS7A 2I87A 3LZDA 4E2XA 3P9IA 1E7WA 3TLYA 4M7WA 4P35A 5KHOC 1NQTA 2GVDC 1TJYA 4LK2A 1QNLA 1UEXC 1H1LA 3OCWA 4YREA 3ETJA 2JFHA 3TO5A 3E3AA 2DXIA 1E59A 1WKCA 1PZEA 2X1HA 1H0HA 2VDWA 4FHEA 5JSKA 1FZTA 1T9DA 4XX0B 3FWKA 2CXSA 1GVNB 3JQ7A 4ZVLA 2BR5A 2QMEA 2EIXA 4TSRA 1USGA 4XDZA 4X65B 2XKJE 2RHRA 4ZGGA 4Q47A 1KRWA 2JH9A 4EJFA 3ULKA 2ZR8A 2NUAB 4F1JA 3W4KA 2W48A 1IZZA 5EXXA 3ZXIA 3FMFA 2GCGA 2JIDA 2ZSEA 3MTQA 2R96A 2HMWA 2IZ6A 4J7XA 4EUNA 5CYOA 1Y6FA 1X8JA 1XZQA 1B26A 1DHRA 3L0PA 2SCUB 1OKKD 3OY7A 5DLPA 3RK1A 2GF9A 4JQYA 1XD2B 1ZBDA 4Z3DA 4MSUA 4WKOA 3B52X 4PSDA 3R7DA 2KPOA 4IIJB 2GARA 4PSUA 3AUUA 3K5PA 3ZCXA 5EE3A 5HJ5A 3C8UA 2NVUB 3ITKA 1X7WA 4HR7A 2ZM5A 2HGSA 1MC1A 2PLAA 2FPIB 2ONZA 1TFRA 2YWBA 2QM8A 3OIGA 3CR7A 1XDBA 4W1SA 2VNAA 1FU8A 3MGCA 4YMGA 2V4UA 2AN1A 1B2RA 1RQRA 3ORHA 4C0SA 1QE5A 4FB4A 2QE7D 2X2EA 3L06A 1Y5LA 1KYYA 2R7MA 3I9LA 4EKYA 3V46A 1GSOA 4R9RA 3RTAA 2FFRA 4HN4B 4O4IA 4MDHA 4TTVA 1S3FA 4KXFB 6CHYA 3MCVA 4WJZA 4OHXA 2IU4A 2DG2A 5B4VA 1VPDA 3SEQA 1IDOA 5TARA 3UJNA 2XGJA 3GN2A 1WTCA 1B3RA 1TEVA 3A9SA 3AR4A 4EY8A 3L4BA 3MJVA 4HLDA 4ENQA 1Q19A 4MUKA 2JCBA 4PX2A 1C9KA 3DT6A 1XZCA 3BGWA 2WF6A 1T0IA 1TEXA 2A8YA 3ODPA 4G4IA 4BZPA 3CJQA 4CIBA 3FOCA 3BE4A 4LC9A 5K01A 3LYHA 3PT9A 1U0TA 2RK4A 5T4EA 1R5OA 4QWWA 3K1YA 3PXXA 3LYAA 4TOIA 3D1VA 3GLGE 1P2VA 3NBQA 3H2HA 2O59A 1RXYA 1PZFA 5LLDA 2VP4A 1I7DA 1X7XA 2O1XA 5DMXA 2B98A 1HMYA 3Q8XB 4BQRA 3SHWA 1KAEA 2O3SA 3KUDA 2IXAA 1XJWA 1I51A 3EGXA 1O95C 3N2GB 4MRMA 4QXPA 3B12A 5F1PA 1N5DA 2DWPA 3KQTA 5ARBA 1NLZA 2C9ZA 2P67A 4IKEA 3GO4A 1Z2OX 1C0KA 5LMCA 3KJEA 3EARA 3D0OA 3HA5A 1EVYA 1AQNA 3GCDA 2Q9BA 3S8YA 1GCOA 2CDBA 2BFCB 2FSSA 4YDSA 3F9CA 4P54A 4BUJA 2WTXA 4EHNA 2ZAIA 4ZOBA 3DOIA 3FKSA 4PHHA 4QAQA 3N6RA 4LMBA 5I4CA 2ANBA 2AHOA 2O52A 2BFMA 3ZR4B 4RCZA 4K6OA 4EITA 1P4GA 2SBTA 3T3MB 3GLIE 4DR5B 1Q77A 2CJWB 4X1YB 1SCUB 2GWHA 1CB7A 3LHFA 2ZZNA 3HCWA 4C5AA 4Y2GA 1ZOPA 5AUOB 3BRCA 1CF4A 2HF2A 3K5IA 2A94A 2H5JA 3ITEA 4G0QA 1WU7A 2QZ4A 5TF0A 1NM5C 2PFKA 2B82A 2RI1A 4HXYA 4MR8B 4UW9A 4DCGA 1QK5A 3QE9Y 2BP7A 3DO5A 5EJ2A 3TW6A 3FYHA 3CURA 2PMEA 5ES3A 3FUVA 4CLDA 3G0HA 3QXSA 1YQGA 3FDIA 3ROEA 4DBLC 5GGYA 1YIAA 3A4LA 5JSFA 3V1UA 3JYOA 1C3VA 3D0QA 1H2EA 3M5WA 4PTYA 5JQWA 5J1TB 4WBNF 2HR1A 4MJLA 1ZJYA 2D4AA 1RM4A 3AT1A 2QZSA 3OVMA 3VC7A 1EEXB 4DIUA 3GLFE 1C3OA 4Z0TA 4GU5A 3B8HA 5B36A 3H4VA 2VT2A 2FJUA 3L0CA 1E0DA 3OZSA 4KPEC 3EW9A 1N32B 2BE9A 4XPIB 3HKBB 3I2JA 4ROSA 1AKWA 1JEAA 1ZIOA 3HEAA 4H1VA 4GR9A 1ADJA 4JLWA 2FEOA 1G2IA 1PP4A 1YB5A 1L5KA 3WNBA 2OXTA 4AJKA 2OSBA 1ZUHA 2GFQA 3K92A 5BN5B 1G5HA 4QLAA 5C1IA 1PK7A 2C97A 5DIFA 2CJYA 3TIIA 2PX4A 4JVLA 1HFJA 2EZ4A 1NXPA 3BIFA 4GPBA 1JEQB 3EGDA 3OZDA 4MAMA 1C7QA 2OYCA 3NDIA 2PH7A 4WDRA 5DCYA 4RTSA 2XXJA 1BG6A 1Y6GA 1II9A 1ZS9A 2GPBA 3NJ4A 3K30A 1PL0A 2X0FA 3HU1A 4BXOA 4Q0MA 1NUQA 3ONVA 1KZGB 2IYWA 2QAGC 1NXSA 5ALWA 2AOXA 4ALNA 3OKCA 2CL0X 4RXUA 3I42A 4NZZA 1T9GR 2YDXA 3A6FA 2NP7A 3SYMA 4TMTA 3UBMA 2V0CA 6REQA 2HI0A 4LBWA 2A9QA 1G3QA 5HIKA 1AY0A 2RH5A 1GPYA 4JUBA 3E58A 1K3FA 2P2DA 2CXNA 2DMRA 2FSGA 4HG2A 3Q7EA 3FMVA 1R0WA 3KXKA 4QJ5A 4UM7A 1FRFS 3IESA 3E7XA 1XHEA 2BFBA 3IR7A 5ESDA 3V32A 3GLFA 1QP7A 1EQAA 2QMHA 1E3EA 1TZCA 3FMOB 2NUPB 3R2JA 1U0FA 2BBTA 4HWPA 4INJA 4C6HA 1OMOA 2DSTA 2XWPA 2E49A 3OH8A 4CV2A 3CX7A 1D8AA 2HK9A 2WIBA 1IZ0A 2A9PA 1IWPB 1Z12A 4F7DA 2EL7A 1AU9A 2JEOA 1P17A 3MTBA 1DU4A 4BQFA 2CXRA 2VJOA 4UDYX 1QVRA 4V0MA 4BAZA 1KFJB 3ITDA 1Q0UA 2BELA 3I12A 3LBIA 1UOOA 3I52A 3PLAE 1RBMA 3EG9B 1G9SA 3CV3A 4FYJA 5I7OA 5GONF 3KAPA 2N9UA 4OB7A 1U0LA 5EEGA 3ZHVA 2QD2A 5I7EA 5KQRA 4FDAA 2PE5A 1EUCB 3LW7A 5J47A 1GAJA 3GFSA 3OLXA 3OT5A 3BDVA 1WWKA 3DFUA 3C5VA 2O3JA 3LCUA 3B1YA 5GV7A 1UDWA 3N7TA 3QPWA 3TB6A 4QXMA 3LBYA 1HE4A 4MYTA 2AJTA 1ZM3A 2OXIA 4E5SA 2EGGA 5E1DA 4F12A 1WKVA 3AF4A 3NB0A 2M1ZA 4GYKA 1WNFA 4HS9A 4PZYA 4XRGA 1U8EA 4MUEA 3WTBA 1X0XA 2WJGA 4PIVA 5DRTA 4RMIA 3FSRA 2XDWA 2D59A 3DTVB 4ZQEA 4N7RA 3BXGA 4DRYA 1GL3A 2FPWA 4MV5A 4DCJA 1CDEA 4GX1A 3LQRA 3FGZA 4XYMA 3TOCA 3ZY5A 4DIEA 1UAAA 2YUIA 4GLOA 1I5EA 1KSFX 3GBSA 3KELA 3UO8B 3AW8A 3IBGA 2AYXA 3AYXB 5ALVA 1KI8A 1OFTA 2KI5A 3TLBA 3D4LA 2DZDA 3I4FA 4IXWA 4DADA 2ENUA 3Q7IA 1W4LA 1IEXA 4J0HA 4L0QA 4RV9A 1PLJA 3CX8A 5KNLA 1I36A 2K7ZA 1YVUA 3R3JA 2H0AA 4R5MA 2C2MA 1UBCA 4GDFA 1VLMA 2J3QA 4G85A 4WCFA 4C7KA 5IBCA 1SUCA 8MHTA 2OC9A 2GHQA 4XVRA 3EVCA 2SNIE 3BKWA 2UV8A 3TR6A 4ZJYA 1TADA 2BDEA 5HK8A 2B4YA 2F17A 1NHWA 1YQTA 4MVJE 4D6YA 3OZVA 2EBWA 3L7LA 1UQUA 2QZPA 4QPJC 3A05A 3OZIA 4UTOA 1ZI8A 2CMFA 1NYLA 4JVMA 5SICE 2WVHA 1EK1A 1X3LA 3V00A 3WIUA 4Q4HB 1LRJA 4BNJA 3IDQA 2OFPA 2IW3A 3G68A 5KUTA 4RTRA 1R9GA 2QJFA 3VPGA 3A25A 4X8MA 5JFGA 2WU0A 4W1QA 2P5UA 3JX9A 5IC6A 4L9RA 4EI9A 2EGHA 4ZHQA 1N33B 3QVKA 2XUDA 1TW3A 1VB5A 1Z39A 1ZXLA 2XUHA 4G65A 3AMVA 4KOAA 4KR6A 4QVKA 4YRTA 3TYXA 3VKVA 3RRFA 1HH4A 2XR1A 3GUCA 3W6OA 3T3NA 1JFSA 4AUEA 1TQ4A 3AIKA 4L9SA 4QBFA 2QE7A 3KJHA 2ZBRA 4KHPB 2JF0A 3C85A 1K3TA 3LA8A 5B53A 1KBZA 4CJXA 3RLIA 3CVOA 2WQZA 4EHHA 2WHXA 3L0YA 4TV8B 4DC0A 4YJKA 1V7ZA 2ZSUA 3T12A 1B16A 3IXLA 1EWQA 2ZQ5A 1P0CA 1I1QB 1KDVA 4MPRA 3ONWA 4TN1A 3RFTA 3EWNA 1HYHA 3AJAA 1KY3A 4ZQHA 3K1TA 1V39A 3I09A 3EQ9A 1PG0A 4MYUA 1KRHA 5EWJB 1I0LA 1E3SA 3FYSA 1OH6A 1BWRA 2Y0DA 1PD0A 2O2YA 5GY7A 3WXBA 3ZNQA 4CUJA 1DG9A 3FY4A 3UHPA 1U94A 4HLUA 4F4IA 1GTVA 1PSZA 2PL5A 3LT1A 3LY5A 3MVEA 3WTCA 4B8ZA 5E7MA 5BSVA 3R8FA 3C6XA 2IK8A 4V0KA 4CN8A 3IDOA 3D5QA 3BXFA 3HU3A 4RZIA 3V2UA 1WR8A 3GIDA 1Q1EA 4F45A 2PKRA 2D7CA 4ZPJA 3RRMA 1BS2A 5H02A 4CI0B 1XDGA 4ZI3A 2PZ8A 4MAFA 1JKMA 4DMMA 1FFYA 1WCWA 2YZ7A 1RLOA 4L15A 4AX8A 2B4KA 3RHSA 3OM0A 3WLFA 4BBZA 1BC5A 4IS3A 4ZCQA 3OKFA 3SPXA 2EWWA 4MW1A 1O58A 3QE2A 4HZIA 2O8CA 4GUAA 1OY1A 2WAMA 4TM8A 5H70A 1KR5A 4FMCF 2XQVA 2EC5A 2QJRA 2VDRB 3HYNA 4WUTA 5AI8A 4ND8B 1XQXA 1M34B 1XAIA 4XWOA 2X77A 4Q21A 3WKAA 4UNRA 3LC1O 1JDUA 2IH4A 4P33A 2NU8B 1U3VA 2B36A 3M1LA 2B5VA 2JGMA 1NAIA 1NBME 2C04A 4MLZA 1L5OA 3OM1A 3MG9A 1J0DA 1SFRA 3KLMX 4TSKA 3RM3A 4X62B 2FDXA 2B61A 3D0RA 4KPUA 2WIFA 4RUKA 5C80A 2ZYRA 2J0QA 3THXA 3F1LA 1E2JA 5CDSA 4LY0A 4UXHA 5HF5A 5BN4B 2VPWA 2OORA 1DJPA 2QGZA 3E70C 3W1WA 1REQA 3T7JA 2G6TA 3E1KA 4PN3A 4NV0A 1ZMXA 3KYJB 3IKTA 1IBRA 1A0OA 5CVJA 4QHTA 3DE7X 2XW6A 1P9NA 4K0RA 3SC3A 4TPKA 2DE0X 1B74A 3MXOA 1E5LA 1X7HA 4JIMA 2V5VA 5ER9A 4K9LA 1NVGA 3DZHA 3C3CA 3ZWOA 3ZYZA 4UREA 1NYQA 4RK7A 3NBKA 3ETDA 3VR4D 4ZOQI 4QG3A 1TIBA 1MHTA 3FM9A 4C0KA 2CK3A 2IYFA 2IUSA 4HDMA 1T8UA 1XCLA 2X9QA 3JWPA 3FVRA 5K3FA 3ZQKA 1NI4B 5DVZA 3HACA 3HXPA 4EKEA 3VM6A 4YB8A 3WYDA 1XTZA 1P3JA 2QK4A 3B3QA 1TM1E 1V26A 2ZAMA 1P5JA 4UU7A 1RVDA 4C0LA 4PX9A 1UKEA 3FUXA 2HMYB 3WL3A 3TVTA 3RBXA 4MYDA 5JZ9A 3H2ZA 3TPZA 2AUNA 1D2GA 1T15A 4LK3A 5DM60 2K6GA 4FBMA 3Q7RA 1OW3B 1SK8A 4J90A 1RKBA 1L7OA 1TVKB 2GHTA 1AQUA 5GM2A 4IIDA 2EKQA 3MBIA 2GM4A 4B4DA 1MBZA 4YA6A 3RYFB 5SY9A 4D0LB 4ZK6A 3OKPA 3BKXA 1MO6A 2BMDA 5EMMA 4KW7A 1H2ZA 1QO0D 2TMDA 4QFCA 5IKOA 3CUUA 3RYHB 3L7KA 4PAMA 3K4QA 1DAKA 3DJFA 4QTUB 2XYGA 1RI5A 2C4KA 3G0IA 1GGVA 1HC7A 3PGMA 1QWSA 1MZVA 1PK8A 2R8OA 3IQFA 2NYAA 4ZQFA 5FJIA 4DARA 3KPWA 4HLCA 5KX5A 2OCIA 4LDPA 1YZFA 2J0VA 3F0TA 3LNTA 4RD3A 4XDGA 5DM0A 3CRVA 4BEBA 1M2JA 2QNIA 4DG5A 2OL4A 4CTKA 2UYCA 1UMBB 3FHCB 4R3NA 2B78A 5LB2A 1WUTA 4M1QA 4CR7A 3M1AA 4KFSA 3W7BA 3G8CA 3RUEA 3V2IA 1HNWB 4DN6A 2QL6A 1BEEA 1ZNQO 5B12A 2P9JA 3F49S 1D6SA 2C5LA 4DIFA 4J2OA 4B3JA 4IIGA 3WFZA 2JIMA 4G56A 4FDTA 5K0BA 1Q3TA 1DQNA 3MWEB 1GITA 4JXXA 3D59A 5AKKA 4ZIRB 4X8OA 1NU6A 3PHCA 3TGLA 4FOOA 3BQNB 3ZK8A 3PG5A 4X61A 1PN3A 5DBIA 3DB1A 4NJEA 1B8NA 4CIXA 4D9IA 4U2KA 1ZI6A 2A33A 3I9V6 1QYVA 3I2HA 3FYTA 4ARSA 1EJ6A 1PX2A 1XROA 4LZOA 3PE3A 3OG9A 3F3MA 2GXQA 1PNTA 4PG4A 3VNSA 4Y0VA 3IT1A 2RDMA 5DHAA 4R54A 1F8GA 3LUGA 2QYOA 4BNDA 3SR4A 4EF5A 6YASA 1O9BA 4EMTA 3OFND 5FWYA 2VJNA 2GH1A 2VG8A 1CJVC 1C0LA 1ORTA 1XZEA 2ZGVA 3D6NB 3DAGA 1BCSA 2VZ9A 4P7KA 4FYPA 4MPDA 5DI9A 4D9GA 4XIJA 1T4CA 4KV9A 5HM6A 2MYPA 3WYAA 3RU3A 3ZCVA 4P0PB 3M6XA 4K6CA 5ICGA 4I1YA 4WNAA 4A16A 3LVRE 1UPUA 4TV9A 1UODA 1VIVA 4U00A 3ZCPA 1I1NA 3ZY6A 4D45A 1RM3A 4P4UA 3NWBA 2NGRA 3C43A 2B0CA 1T8RA 2CC2A 3CUYA 4Z53A 4KITB 3UFBA 2O6HA 1WL8A 3RADC 4CU2A 3KQYA 3IAS1 2HREA 4OA5A 2W11A 2H08A 1CVRA 1NDQA 1BMDA 3WICA 3EBPA 3G2MA 4Y2RA 3CWQA 2EW8A 2PZAA 4QU8A 4R2HA 2C7BA 4YT5A 2E48A 3DYBA 4BFYA 1A77A 2QN3A 3NT4A 3LCVB 3ILYA 1WQ3A 1G8JA 1E3WA 3JAWB 2ZULA 1KH3A 2AQHA 4H2DA 1SU6A 2G28A 2W2XA 2AMYA 3BD9A 3H9CA 1WY5A 5AW1A 1MCZA 1JIIA 3K15A 3BJMA 3SKYA 5EHZA 3QFHA 1N2ZA 4ZTZB 3ADDA 2B92A 4HCJA 5AESA 4AY5A 3P4UA 4AQDA 4OIFA 4CKWB 1CRPA 2R1ZA 1L7EA 3GT0A 2YWHA 4OBXA 1PL8A 2HQBA 3SXJA 3OD5A 1EESA 4JELA 1FFAA 3I1JA 2VAMA 3GGPA 1N9GA 3FE2A 2Y93A 1W88A 1IU9A 1K6JA 1Z0FA 3ADPA 3ZNOA 1OWOA 1I8TA 2RHLA 4D2IA 3HBLA 2W98A 4MQ6A 4F8JA 5A5GA 2EF1A 4L27A 3HKCA 4DLTA 4EFLA 3UMMA 4JI8B 2HA0A 2PT7A 1MVLA 4QULA 1PJSA 1FVXA 4JEHA 4MKFA 2G25A 2QT9A 3VNVA 2AXPA 5M3BA 2WNSA 3JS5A 5I9LA 1R9JA 3L0BA 1Z29A 3IDAA 1TNDA 3HLTA 2MYNA 4JDUA 4WESB 2A35A 2FPUA 3RHZA 1VGVA 1WLSA 3GJ4A 2R00A 3HB1A 4JVOA 3UHOA 2BMJA 5HZGA 2EJWA 2PX3A 1R6TA 5B1YA 1F2TA 3SE7A 2P6PA 4PAWA 3T3PB 3GA7A 1CUGA 1M1XB 2JI8A 3DD5A 3QXGA 1CUVA 4R84A 5E9WA 4WCVA 3R4CA 1BCRA 3ILVA 1EH5A 2FGKA 3QMWA 3S1AA 4LOKA 3W6ZA 3TG2A 4FWTA 1YZHA 5JSYA 1MR3F 3QOWA 1WP4A 3K72B 1YS4A 4JP3A 2H7XA 2ZEJA 4FFBA 5EZQA 3WP0A 3ZHUA 5JIBA 2GN9A 3PNLA 1J70A 1Y5MA 1Z0UA 4PPQA 4X20A 4MZDA 4AWBA 4PAOA 1JEJA 4UU0A 1A8IA 5DTEA 2ZG6A 3URMA 2LVBA 3B3AA 1G0OA 2YASA 4RVGA 4DGSA 4IQ4A 2ZIUB 2JIPA 3MILA 3NHFA 2O07A 1H3EA 4K9NA 5EZSA 2Z2ZA 2F3UA 1JECA 1FP4B 1GPMA 1TO6A 4RBNA 4L0MA 5D7NA 2NQTA 3E84A 4YCMA 2QN2A 1JS1X 1WD7A 4JUCA 1MB9A 1CZUA 3A4IA 4XR4A 2VHQA 4TTPA 1RYEA 4UOQA 5EQDA 4L2IB 4BC0A 3QMVA 3DNPA 4HWTA 1XLTC 3TRIA 2PFSA 3PRKE 3PQ7A 4KSCA 2HC9A 5DN6D 1S8AA 1Y3HA 3HBAA 3IT3A 4WN9A 4N48A 1FDRA 2IF0A 3CVUA 2H1FA 3REGA 1MJ5A 2XV1A 4DQVA 5BT9A 5KYXB 3BS4A 5JHHB 2Y1DA 2GR9A 5GMOA 1YJ5A 2R44A 1F4PA 5ENZA 3VISA 4E1AA 1CQZA 3GEMA 4GHWA 4JLNA 3SC6A 1V9LA 4RU1A 2FK8A 3PSHA 4MJXA 3SZOA 9ATCA 3SOPA 1P0IA 2CVQA 2I2XB 3EWSA 2UYHA 2D62A 3LC0A 3MGAA 3A1UA 1XKQA 3ZWBA 2C99A 3DOCA 2WTUA 4CL3A 4EHAA 2V0NA 3ZGZA 2OZLA 3UENA 4B85A 3RS4A 4I50B 3BQ9A 5DNWA 5JSHA 1L7VC 1WBJB 3GRRA 1YBAA 1EIZA 1W36B 2Q3JA 1Z38A 1Q14A 5EJ4A 1D8TA 2V6JA 4DA6A 5CRIA 4HLNA 1QE0A 4BVFA 1H5QA 4DSOA 5AW8A 4LSZA 1ZC3A 3Q1LA 3U09A 5ALYA 4B32A 1GU1A 1K5DA 1HG1A 3GRZA 4PFQA 2P8JA 3FZQA 1MX5A 3STHA 5L9AA 1U4NA 2ZYGA 3LUFA 4FYKA 4MS4A 1TCVA 4DRZA 1IK6A 2B2CA 1SIWA 2ZCVA 3AEQA 1QDLB 2IYPA 3B51X 3BUSA 3ZWWA 1Z26A 5F7OA 4DLKA 2VTBB 4DJTA 2GPTA 1KFCB 2FZGA 1R18A 4XB2A 3TI7A 1HQCA 5JDIA 4H1WA 5T41A 4G9BA 1Z06A 1XNQB 1S7GA 5FTJA 4HNAB 2V0GA 4PNPA 5FI1B 1ZGZA 3ZX5A 4IDBA 2YDYA 3CLSC 1ZRNA 1IIRA 1PO7A 1W52X 1CR1A 1C1XA 3LP6A 4J1TA 4V38A 4CF4A 5F7XA 1F38A 3KPUA 2JARA 3BMCB 2VPTA 4INZA 1ZQ9A 4MS3A 3EPPA 3DYVA 2OHIA 4QJBA 1F5NA 2RCYA 3A6EA 4RD2A 3KTAB 4ND7A 1DB3A 2ECKA 4X3CA 3QEKA 4F3RA 3KZOA 3DLAA 2CDCA 1CQJB 4IM7A 3ESZA 3KSAC 5JWRA 1CC1S 8LDHA 1D7AA 3HJRA 4K9KA 3UMJA 1JR2A 3MJDA 4JUAA 1DDIA 4ZAYA 1VXRA 1AT1A 4PLWA 3QQ5A 4PZ0A 4RMGA 3ZW7A 4XGRA 3ZQ4A 3TOXA 5ADVA 3ZDAA 4BWYA 4MEBA 4V0OA 3RKUA 4QOEA 4DJ5X 3DC2A 3QXXA 3ANTA 1Z6GA 2OK7A 1KVTA 3HMQA 3KKEA 2QR3A 1XWWA 2X1MA 3R9IA 2TS1A 1W2GA 3S2YA 3NHUA 1L6RA 2XMBA 3KEGA 4FNMA 3T7KA 2CMHA 3FZNA 3SLKA 4RSMA 2DH6A 4KRYA 5ALNA 2AF3C 1BXGB 2GJ9A 1YE3A 2OWEA 2IT1A 2EQBA 2YQ5A 1AVTA 3IDSA 4HGPA 4IH1A 4OSOA 4N5MA 5IH3A 4NBRA 2BF4A 1YMUA 2CDRA 7GPBA 5MGNA 1B8PA 3EEOA 4AZTA 3ZV3A 4PLZA 1ZKDA 1RC1A 3H3JA 4CL0A 1L5HA 4AZ3B 3REFA 4B3GA 2FWPA 5LOVB 4LDRA 2EX1A 3GPLA 3TEJA 2NU9A 5J2UA 4JI3B 5DWQA 5LA6B 3GI1A 2G4VA 4ZYVA 2A5YB 1QR6A 1E60A 3KKOA 2PSDA 3CLSD 4INOA 3ESXA 2ZE6A 1S2DA 2DYKA 2NOAA 3KNZA 2NPFA 4JX8A 2HT6A 4RM2A 3AB8A 3J80A 1O6FA 5B1EA 5CGQB 1KVUA 3VYWA 1V96A 2QG4A 1NXQA 3KKMA 2OQ2A 4DREA 3VPSA 2AZ4A 3OOEA 2PGXA 4QBIA 5EMJA 4C2UA 1DFHA 4TV9F 3ZDYB 4K86A 3R3HA 2GT1A 2GJAA 3LPDA 2L69A 1PUJA 3SQWA 1R6BX 2PRYA 3ANMA 3DPSA 5WRFA 3CCFA 2O2HA 2ILVA 1VL0A 3GA5A 5CB4F 2FV8A 1DZ3A 1MF7A 2A0FA 2JI7A 4RK6A 4U2BA 1JN0A 3DULA 2XCUA 1BGWA 1OLSA 2WWGA 3M33A 1Y80A 1QKIA 3Q85A 1RP1A 3QFCA 2LRHA 5K5EA 1MJHA 5CIQA 4OPMA 2W70A 2E89A 1ODJA 1P29A 4PZZA 4BNMA 3AU8A 1LPMA 3OOSA 1CQIA 5ALPA 1UP6A 4YXWA 1JPUA 1X8LA 3E8XA 1F20A 1BE0A 4MV7A 2Q4DA 4FEAA 1QJCA 2WBLC 2ZXUA 3PNVA 1CYDA 1U7ZA 2IEAA 3MMSA 5EE9A 4BO2A 4BASA 1QHIA 3WAKA 2FP4A 1DUIA 2JAWA 1VL6A 3QVGB 1P77A 1WEHA 2GZAA 1BHJA 4FOPA 3B9QA 4EW6A 1JTVA 3R5SA 3MJRA 2Y66A 1B1CA 1B7GO 1LQUA 1Z8NA 7REQB 2R5FA 3R77A 5EMKA 1S0UA 1YQUA 2CYCA 4Y9UA 3DL7A 2VL7A 3L6EA 1RRCA 3K6RA 1X0VA 3DDWA 4GM4A 4MVJP 2B5OA 3P96A 3BA6A 3VPHA 4EY7A 1SUAA 2X1VA 4YUAA 1I2AA 3OIUA 1XJ0A 1P80A 1ISJA 3CRZA 1SCBA 1KKMA 1O57A 2OOSA 3GL9A 1WDTA 4Q02A 4AF7A 1JKJB 3AETA 3R3YA 3QELB 2VJMB 5CU7A 4ZCMA 3RIEA 3U9SA 4XM2A 3VU8A 4HTAA 6AT1A 5CH8A 1T9KA 3MRXA 3KE9A 3R6LA 1TFUA 5ESRA 3B6EA 2C8LA 3B5EA 4BEWA 2EL9A 1I10A 5IP5A 3G8DA 4PCVA 3JQ7B 3L18A 2J6HA 2QVCA 2FFHA 2YHBA 5C8YB 4TS3A 1T1IA 1P2TA 3BIOA 3IODA 4MROA 4YJ3A 1E5DA 2W90A 5G02A 1D0VA 3U40A 1MX3A 1UM8A 2XT0A 1PFYA 3GDFA 3K6JA 4HDSA 2PD6A 4WKNA 3U3OA 5KC9A 2DJ5A 2BLNA 1N6HA 1GLVA 2VNJA 3KRTA 3WYBA 3F1KA 2AFVA 5KYUB 1MX1A 1W46A 3OBIA 4YRPA 4EELA 4FMDF 4MWDA 3LGAA 2O2IA 4J0GA 4YAGA 5JO0A 4ZEXA 2OZPA 4C04A 4BWFB 1VYUA 2YJNA 3Q9SA 5KKCA 2C4HA 5JR3A 1O3YA 3CM0A 4ZCRA 1KO8A 1F9AA 5IUJC 4C7VA 4TYNA 1SBTA 2I6XA 4GZ3A 5CB4B 5EIBD 3CRNA 3OF5A 4C0BA 4D9NA 1K0FA 3KAQA 3CG0A 1U6IA 4RGVA 4PZLA 3RASA 2NVUA 1MHPA 4P3PA 4RV5A 3FWNA 1MAVA 3O75A 4R2XA 4XWGA 3E2PA 5GGXA 1V5GA 4DKXA 4BWGA 3UPTA 3ZE7A 4EI7A 3BFKA 2HTFA 5DNUA 4ZWNA 3EVFA 4HB2A 2JFVA 1DTWB 1IHXA 2FMKA 3NYQA 4G01B 5K20A 2O2DA 1U5CA 3QVSA 4GQAA 4JSYA 4US1R 3T5AA 4ZXFA 4M0LA 2WB2A 3U7QA 4NECA 2ODPA 4KXWA 1ZH4A 5K0GA 3ZTYA 1WOMA 1IL0A 2AFHE 2Q8PA 4MS1B 2REQB 4JC4A 5KC8A 4AECA 3O9ZA 1QHEA 3ISJA 2P1ZA 3PQEA 4JMLA 5E4JA 2FWRA 5DN9A 4DCVA 3UUGA 3WGKA 1N6KA 1UBNA 2Q2OA 3T4PA 2UUCB 4UQOA 3AEXA 1KP2A 4F38A 4XFDA 1U8TA 4WI1A 4BRWA 5J23A 2KLHA 1U2ZA 1YBHA 3D7RA 2ZWPA 3K9HA 4JN6B 1T5TA 2CVZA 3F8TA 3WLTA 3NEPX 2MTBA 3AC0A 1U7TA 4YCNA 4RX1A 4HBZA 4UD2A 5DPMA 3V8RA 3DL0A 3T6KA 4W5NA 1P9WA 3EMBA 1XK7A 3N58A 2FP3A 4MINA 1CUBA 1GCAA 3F6PA 3G1WA 3QVUA 1CZLA 4TMXA 4TUYB 4FHGA 2B8TA 2EYQA 3E7WA 1IZ9A 1T9HA 1R8SA 2QW1A 1FX1A 3E3MA 3PI7A 5DV9A 1DZIA 5AVJA 3KVVA 3RVSA 4EWLA 4H16A 3O73A 1EFUA 5EPUA 2I99A 1SXPA 1EQUA 2WILA 4L3OA 4TT8A 1H0RA 1RLUA 3ES9A 3S44A 2DETA 3A7EA 3EGXB 3ME5A 2PS3A 1GDHA 3OCYA 3PC2A 4F7WA 1DBVO 1E4EA 1L1EA 3PPWA 5K6RA 3WVNA 3UMGA 2AWNA 2P8SA 4IZIA 3AZOA 1VB3A 3TIVA 2YFKA 4TTAA 5IAAA 1H1DA 1R6UA 3RGWS 4D02A 2ZJ3A 1IY0A 4F84A 2BFCA 1GILA 4JODA 4ZYZA 4KFCA 2UZ0A 4FR2A 4IMJB 2D6FA 1USKA 3A58B 1MABA 2H2GA 4J0JA 3RBAA 2C5GA 1GDTA 4UHBA 1FYFA 2WZDA 3BOSA 4I0WB 1CUEA 4RC9A 4I6GA 3N8GA 1VYHA 3UJBA 2A5FA 1MEJA 2IV7A 2CJWA 4CEJA 1K1EA 1VSVA 2OV3A 2QZJA 1Y8ZA 2NSDA 3CEHA 1V8FA 3PWKA 3TQSA 4K81B 3ILXA 3M5CA 5AHWA 2OFXA 3DV2A 3BIJA 1IULA 4OB6A 2WWVD 1W96A 3I8XA 3FGOA 2IHKA 3KSBC 2VK2A 2YRFA 3F96A 3I2GA 4MR8A 1KJWA 1ZAYA 3WADA 2JCXA 1EVLA 4FOSA 1XAJA 3OM8A 2GMWA 4HFMA 4S05A 1P1KA 2XWJI 3DMFA 1BAPA 5I9MA 3V7NA 3NXKA 1EGVB 3IIJA 1QIMA 2XMCA 1MZPA 3AF6A 2Y92A 1E1YA 1NF8A 4G2TA 2VZ0A 3QWHA 4PQGA 3TXXA 1RI4A 2ZATA 1QH0A 3D3WA 4NATA 3KDAA 5JQGF 5KNCH 2F8MA 5BWOA 5IYZA 3NUZA 4GI5A 3KKKA 5JO9A 4ANFA 2O23A 2IE0A 1C3OB 1J0BA 1ORRA 1NOKA 1QLJA 2CCKA 3OF2A 2C2BA 4KE7A 4NH4A 2VIIA 4CEIB 1QE3A 3SYKA 1OLUB 1EE2A 3N2KB 3MSCA 3SVLA 3BMOA 1JA1A 4LJLA 4NICA 3OEED 1UJ6A 4EL5A 1GZ4A 4UXIA 3L6DA 4JI7B 5GONA 5TY0A 4FZRA 2I1WA 4I3GA 4BAUA 2CD7A 4DY4A 4WOBA 4EA8A 1XVLA 4HDKA 4YNBA 2NV2B 4BU0A 3GNLA 1FA9A 4S35A 1Y9DA 2ZJ1A 4FFOA 4HSEA 5I9NA 2AR7A 1J1ZA 1UFQA 2IUYA 4FSXA 4Y6QA 1MQAA 2X13A 4FFDA 1APBA 1PV1A 1GN8A 4HPWA 2GB4A 3VU9B 1ETHA 2ORED 4OSEA 4F9TA 1PZNA 3S28A 2Y1KA 4TKUB 5ANRB 4L07A 3HU2A 4PNEA 1B8VA 3OPYA 3TJZA 1UZLA 3PXBA 4UHKA 3PDIB 4J0DA 1ZGJA 3TTVA 4GVXA 4Z49A 2J4FA 1L5YA 3I6MA 3BK1A 3RS9A 4YRKA 5JDIC 1E1DA 1JZSA 1NQ5A 2BGKA 5BN3B 3GPBA 2FEAA 2NTVA 1LWOA 2PXAA 4W9NA 4WZAE 5C81A 5ICSA 4WQMA 1FL9A 1OA0A 2I4IA 4LIPD 5FFMA 1YQXA 2FW7A 2ZETA 2ERYA 4R2JA 3FG9A 1XD8A 3CNNA 1UIMA 3EXFB 3ESYA 4JI4B 4JI5B 3V8MA 4REOA 2FUCA 5SZKB 2I78A 2QNRA 4O2LA 5FLEX 4OX9Y 1OTHA 4DV3B 1E9RA 2FVXA 4I5DA 2ATEA 3V4ZA 2V03A 2PT6A 4R8MA 1XE3A 2DLCX 1XRNA 3QNUA 5J40A 2JGDB 1KMHA 4M8KA 4TWJA 3PGKA 3BTSA 1LUAA 3T3HA 4DEXA 4Q4JA 3JPWA 1P5FA 1RRGA 3NIFB 1G3IA 2FE4A 2X19A 3P9PA 1NRWA 2H2WA 3Q4GA 4D4HA 2AKAB 4CKBA 4MR9B 3F6CA 5KWSA 4IS2A 3NDRA 2FJPA 2GTIA 3ZW9A 1Q7BA 3KTFA 1AUXA 4YRCA 4O5OA 4RPKA 3V3KA 4ML3A 2YNMC 3GJZA 5M04A 3A0UA 4RDIA 3WNZA 2PL1A 2YJ4A 2YHSA 4B7CA 5JNVA 2G9VA 4MWEA 5CM2Z 2PIAA 1KYVA 2REBA 2ZUVA 4DLUA 2VJQA 2K7FA 1BJTA 4HDRB 1QFZA 5C8DA 5BWLA 5CG1A 5IFLA 3NV7A 4GLJA 4AUMA 1MPTA 1VBMA 2Y1FA 4PGMA 3BULA 1HLGA 2VQEB 1DARA 2I2CA 2FPSA 1JIKA 1UT5A 4RFSB 5TQ0B 5H0IA 1U2GA 1PJZA 3EPRA 5TJHA 1MOSA 4TQGA 1EUZA 4HP8A 3ZBQA 2HJHA 4WBNA 4YCDA 3K6SA 4JV5B 1KJIA 3CLRC 3CFYA 4PCLA 2Y77A 1IVYA 4RM3A 2UVDA 3T5MA 3TOVA 1Q11A 2P4QA 4RMJA 3WQQA 4MO2A 2EDAA 3L5KA 1QVWA 4TGLA 2LD4A 4B0PA 3SHTA 4W99A 4Y2UA 3BSFA 2Y1LA 3PJGA 4KLAA 2VF2A 3GGJA 4WLEA 1M10A 4DY6A 2QTFA 1H6DA 3NFYA 4AJ9A 2ZPTX 3HFJA 1EFTA 5TT0A