5EJEA

Crystal structure of e. coli adenylate kinase g56c/t163c double mutant in complex with ap5a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDACKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEECVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for ligand binding to an enzyme by a conformational selection pathway.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ejeA00
1VKJA 1LW7A 2ZE5A 1ZIPA 3E70C 3TUZC 2V8OA 4CEJB 1BO6A 2A5FA 3K9LA 3B2EA 1IONA 1G8GA 2GA8A 1NL3A 2K5UA 3KKOA 2OM2A 3NC1C 4DEYA 4IDQA 2JLUA 1K8RA 4GOKA 1G20E 1E2QA 4LC1A 4B74A 5JEDA 2NIPA 1S3SA 4AYXA 3SE0A 4OHZA 2ZRIA 3GD7A 4LSGA 5JSZA 2ZQ5A 3MJHA 1S1CA 5KHOC 1DPFA 4LOAA 5CLQA 821PA 5FPKA 2OBNA 1J8YF 3DHWC 1KJYA 2ODNA 1N5IA 1JAIA 2BBWA 2OBLA 2Z4RA 4DLRA 5ELXA 3V4FA 1NJGA 3NDPA 2ZRAA 4A0FA 2J59A 3CWQA 4UJ5A 2BJVA 4Q5IA 5E7MA 4AIIA 1EWQA 1CR2A 4GZMA 1TAGA 1QHIA 2Z5FA 1YR6A 4B6EA 1G19A 1CR1A 3PUWA 4B33A 3TKLA 1VYUA 1G4AE 1OV4A 3K53A 2VTKA 3B5JA 3ND9A 1C9KA 4ZO4A 2KSQA 2PX3A 1GKYA 5KNDA 4DIEA 1J90A 1JALA 2FG5A 1Y63A 3I1FA 2ZU6A 3CW2A 3CH4B 3GEHA 1X1RA 3IUYA 4V0KA 3U4QA 1OB2A 1WMSA 4RSGA 2RGXA 5GJCA 4RZ2A 3U7FB 5FL7A 3H84A 3M6AA 4CEIB 3VKHA 1JNYA 1DE0A 4XTCS 1ZNXA 4AY2A 1SXJC 2NG1A 2B92A 4O2RA 3V4RA 4JLKA 1GTVA 1G5PA 1RZ3A 4TL9A 5KOYA 5H68A 2ERXA 3TIFA 5A0FA 1NMZA 4NYMR 3T15A 5EZ6B 3GP8A 4Z51A 2VP0A 3TQCA 4TMWA 5DI3B 3T5DA 1E69A 1SVMA 4PFSA 3UIEA 1GFIA 5J4VA 4HB0A 3T61A 3CX7A 3B85A 4BEJA 2ONJA 2GCNA 3QENA 1JPNA 4Q19A 1FQKA 2OAQ1 2ORWA 3EG5A 4B48A 3LX8A 2AFHE 1A7JA 4BFSA 1ZIOA 1CU1A 2R65A 1XEXB 1HA3A 3KJEA 3WYAA 5C46F 3I32A 2QTFA 4U5XA 4BLTA 3KKMA 1OB5A 3AVXA 4RD6A 4RFSA 2ZRFA 1DBSA 4LV5B 5IT5A 2XTZA 4KLZA 1XMSA 3KJGA 2ZSDA 1BYUA 5EP3A 1F2TA 4BPBA 1XZQA 2FSIA 2WPDD 1US8A 1E79D 2PEYA 5FUYA 1T8UA 3ZZ0A 2XZPA 1HTWA 4OJKA 1T3LA 3CPHA 5J5CA 1E0AA 2OESA 2MSEB 5EXXA 1AGPA 4NTZA 4Q4AA 2UVQA 3T1OA 3WHLA 3KQKA 4EQ6A 2ZE6A 4D4MA 3TMKA 3C14C 5DN6D 4DT1B 5J4LA 2ZYTX 1S0UA 2H1LA 1IOZA 2DPXA 4OK6A 5DYIA 5TXGA 3PEUA 4D4JA 4YXWD 3U6BA 1JXOA 3R9IA 1XD2A 3ASYA 4FW9A 1FOEB 4PC2A 3CNNA 4LJAA 3TRFA 2D74A 3T1TA 4XOIA 3ZIAA 3GLFA 3ICQB 5GVRA 4MDFA 1UBCA 1P9NA 4I1VA 2C2HA 2FPLA 4IFEA 4L8GA 5D3MB 1BKDR 1XXHB 2NPIA 2BWJA 1Y3AA 4FMDF 1GRRA 2QGNA 2ZRKA 2GXQA 4DEXA 4BRWA 1N6LA 2FE4A 4N1AA 1JJ7A 4I1SA 4OQMA 4TQ9A 3U3OA 3SEAA 3D7MA 3LLUA 2OCAA 4DCSA 2C9YA 2GEUA 1XCGB 4DZZA 4A15A 3RRZA 4GOJA 1QBKC 3BXZA 5K8UA 2DWPA 1KKMA 2H5EA 3E1SA 4OJQA 4KSCA 1WBDA 2O8CB 3DPUA 1RW4A 2KB0A 4GOXA 2XJ9A 4WOPA 1A82A 2QUZA 3S1AA 3EX7C 3EZ2A 1IXRC 4DJTA 1UFQA 4XVQA 4JLPA 1G291 3SYLA 2Z0MA 1TQ2A 2O8FB 3CONA 2PJRA 3QKSB 2REOA 4O0MA 1HE1C 2CLDX 3NEYA 1N0WA 3GFPA 1RRFA 3IEUA 4HB2A 1OH7A 3LVRE 2AFIE 4S2EA 3A1WA 1P72A 1WDTA 3FMIA 3MRSA 4LYAA 4NZYA 4QBHA 4Q1FA 1ZUIA 3ZS8A 2A5GA 4TQAA 3C5CA 1LFDB 5LD2C 1G8PA 1XTJA 3OE7A 3GJ6A 4LRWA 5AJWA 3W9YA 5GJVC 2IF0A 4JLBA 3LAWA 4B75A 1KK1A 2C99A 4OL0A 1ZINA 2OCPA 2VF7A 3BWDD 3BB3A 2Z4SA 4B2IA 1KMHA 2PL3A 1DEKA 3AF0A 3X1WA 1O87A 1VHTA 2W0MA 2ZUBA 4II7A 4PC7A 3W8RA 2A5JA 2ZANA 3WNDA 1AK2A 2YWHA 2ZSAA 3GPLA 2J0SA 1TU4A 2IC5A 2QTVB 1MR3F 1R8SA 1XFAA 2VA8A 4D0GA 3NTUA 2VPPA 4PQYA 4QM7A 3Q8XB 4ABYA 3KTAA 3U3RA 1IN5A 3EARA 4DUGA 4ESHA 2BC9A 1GAJA 5AJVB 2R44A 1G16A 2GJKA 1YR7A 3CRW1 3THXB 1CEEA 1YKSA 4JBYA 4NPHA 2J0UA 2KE5A 1E32A 4IJMA 3DVLA 1P6XA 4URZR 1M8PA 1SXJE 2XITA 3ADKA 4JLVA 4TMVA 2WKRA 1X1SA 2HF8A 1ZC4A 1AN0A 4Q01A 1OXSC 4C0KA 1XPUA 3D31A 1GNPA 3OZXA 2NZJA 3RC8A 1N6HA 4KV9A 2W2XA 2VHJA 1FX0B 1DS6A 4QHSA 3FMPB 2JLSA 4ZDIA 4W5HA 1KSFX 2JATA 5B30A 2YWGA 3PJRA 3SBDA 2WTUA 2PT5A 3VTKA 3AKYA 3QNUA 4Q9KA 4RJLA 1D9XA 1Q1EA 1W4AA 4DLSA 2G0NA 2WZQA 3FTQA 3NBXX 5EUQB 5FOUA 3GLGA 2DFNA 2FH5B 1KK3A 4EJSC 2WAYA 3A1TA 5SZHB 3WP0A 4JSTA 5DI9A 2IA5A 4I81A 3I5XA 3GFTA 3U60B 3LDAA 2QORA 1Z6XA 2IYWA 1OE0A 4POAA 1EX7A 4URYR 5FPTA 1OW3B 1KI9A 3K1JA 4OQLA 1IN6A 3FWYA 4Q4HA 2B7BA 3PEYA 2F6RA 3B60A 3JZMA 3SJCA 1FQJA 2MSCB 1J70A 3OIYA 4B2LA 3B1XA 1D9ZA 1X3SA 1NMYA 3QQ5A 4TMTA 3T12A 2VP9A 2FOLA 1Q1ZA 1GZSA 2XTMA 4WAUA 1TADA 1E99A 5IF9A 4M1TA 3ZD6A 4L15A 3K0FB 2A2ZA 2H57A 2OZEA 3L0OA 1XB2A 4FIDA 2LWIA 4LPKA 4KU4A 3FYHA 4HB4A 4PPNA 3X1ZA 1M7GA 2MMGA 1KJWA 1MKYA 2AN9A 3GFOA 5AUPB 2H8KA 1TMKA 4JVLA 2Y8EA 3B7GA 1W4BA 4G5GA 3KX2A 2RH5A 3AP1A 1Z2AA 3VR3A 4HAZA 4AD8A 2GAOA 4EJSB 4UKDA 1HT1E 4LJ5A 3GLIB 3KQUA 4Y0VA 4TWZA 3QVUA 4DCNA 2WKQA 1KDOA 2ODEA 1SQ5A 4LHXA 1E2KA 2A30A 3DOEA 5BXQC 2YHSA 2V7QA 4MA4A 4BRUA 4XVUA 3A6PC 3TNFA 3EIQA 1OIWA 4JT4A 1BMFD 4XVRA 4QOSA 1PUJA 1WF3A 5E95A 4C2TA 2YWEA 1T5IA 1IBRA 1NLZA 1C1YA 2G0TA 2HJVA 3CX8A 1G5RA 3QG1A 4QL3A 3VQTA 2GKSA 1U0LA 2GRJA 4OI4A 1GSIA 4B71A 1E2FA 1G7TA 5FUVA 2O0JA 4KYUA 3RABA 3IKJA 4B43A 1AJEA 2D62A 3N2IA 1JEDA 2IXEA 3Q7PA 1E9EA 2G83A 2VF8A 1TQDA 1XDBA 4WXRA 4DBLC 2O5VA 2J5XA 4C30A 5CLLA 3RS4A 1WP9A 1D6JA 3EC2A 1VECA 3QKRB 5FBRB 1OFIA 1W5TA 4GMDA 2BBTA 3IBGA 1N0VC 1HUQA 5FI1B 4WVFA 1QG4A 2W0SA 4IDOA 3GJXC 2G1KA 5K8LA 2FU5C 1ONBA 3KDSE 1QVAA 3UANA 1GNQA 3OEHD 5CDFA 2JLWA 1WA5A 4M8NE 3TVDA 1ZBDA 1P61B 4DHEA 3FMFA 3LBNA 1F3OA 2OE2A 2R2AA 3BK7A 1SVSA 5E7IA 4LJ7A 5J4KA 1G6HA 4GMXA 4C0SA 3KJIA 4LHYA 1G5TA 4DDTA 2VSFA 2ZS9A 3AKEA 2ANCA 1HEIA 2A9KA 3CKLA 3RAPR 1KAOA 2WOJA 1E1QA 1JQJC 3QXJA 4OI2A 4BZPA 5FL7D 3CUEF 2CHVA 3OAAA 4C9BA 3TAHA 2YNMA 1E2PA 3Q5DA 3HU1A 5JSZB 1T4GA 1XMIA 4A0GA 3IQXA 1W47A 4DC9A 2B21A 3O47A 5CM8B 4A6XA 4O3MA 1QZXA 2ZJ8A 3EW9A 3KB1A 4Q4LA 1RKBA 1ZVQA 2JJ1D 5DHFA 2BBSA 5KSOA 1C4OA 3LQQA 4XD7D 1NMXA 5IDVA 4C0AC 2WJJA 3K09A 5BYJA 2LKCA 1OJLA 2ZITA 3DMDA 4TTPA 2JEOA 2RGAA 4OQNA 1DG3A 4BEBA 3I73A 2ORIA 1OFUX 5AUNB 2D7DA 4ZKDA 1FUUA 2DR3A 2AWOA 2CVFA 4KAXA 1GRNA 2EYQA 3C4JA 3I5YA 4LJ6A 1YZKA 2FFBA 5FBLB 4DLUA 2V54A 1RC8A 3EA5A 4XTRA 2OEPA 3ZVNA 2ZYVX 2WWYA 1HH4A 2ZM5A 3EPKA 3U4QB 3C15C 3N2EA 1KK0A 1U90A 4HLUA 2HCJB 4JL6A 3OFNA 2WV9A 2ZJZA 4KO8A 4MGIR 5HCNA 2OXRA 2O0KA 2LCFA 3GEIA 5FUWA 4K46A 4Q1CA 1WRBA 1KI8A 4KFSA 4NKRA 3DKPA 3SYKA 8OHMA 5JWHA 5B58C 2IEYA 1M34E 2IXGA 3MWKA 2GEVA 1A5TA 3W5IA 1FMJA 2G3YA 4NH0A 4AYWA 2XZOA 3AVYA 5JJKA 2XOKD 2OAP1 4Q1AA 5KDDA 2QE7A 3IIMA 1J99A 1EXMA 1Z6AA 4QHTA 4PC3A 2GJAA 1QHYA 2CNWD 4YMWA 2DFLA 5CIWA 3BERA 3I4LA 2DBYA 3B78A 2VSXA 1E9CA 3FVQA 4JYCA 4H1UA 1OFTA 1RRPA 2PEZA 2V1XA 4F7WA 2J7PA 1T9HA 3H1TA 3ZIAD 2GK6A 4NYJQ 4QGAA 1KSHA 5HKKA 3QKTA 3U5ZB 1M1YE 3ZH9B 1AA9A 1NIPA 1T0HB 2OXCA 4PO9A 4UQOA 4ERNA 2AD1A 1NSFA 1Z07A 4Q7LA 1AIPA 4RFSB 3LX5A 3SJAA 5EP2A 4UXHA 4HAWA 4NCNA 5K8TA 2ZEJA 2CE2X 6Q21A 3NHBA 2PCLA 2OO7A 1F2TB 3AB3A 1I4TD 3D8BA 2ZVPX 1VCNA 2RGDA 4XIGS 5FPHA 1J8MF 4JZKA 1BYIA 3BFKA 1IQPA 1SHKA 2B7CA 3PEWA 3EPJA 2PMDA 3LW8A 4C0LA 3RDPA 4PZZA 3VAAA 4AKHA 2YC4C 2BJWA 2IS6A 5EE9A 1CJUC 1E4YA 1UKVY 2NPFA 2V3CC 4Q4AB 4OHYA 3CR8A 1RYFA 4QNMA 4EQ6B 2H92A 1JXMA 4BE7B 5HZKA 4LY6A 3FHCB 1NI3A 3HYRA 4PTLA 5FPSA 2QL6A 4YMUA 3MFYA 2IBMA 1XD2B 3DO6A 4C0BA 5FI0B 2Z43A 3B9QA 1E98A 2GZDA 5FTMA 3GLFB 3ICEA 3OE7D 4FWIB 4LI0A 1D2MA 4Q48A 1W48A 4HZIA 3LBHA 1AQUA 2J0VA 2WSMA 4TMZA 3ZS9A 3LO5A 4CT4B 3N70A 3GLHE 4OKSA 1KOFA 2GEDA 2W58A 1WCV1 1YQTA 3BH6A 3TBKA 1T3SA 2BEJA 4W7SA 4DRZA 2FX3A 3QSYA 2KWIA 4JJKA 5JWOA 2GETA 3RVBA 3FHTA 4NP6A 5HR5A 2FSGA 4NU0A 3MWLA 3FFAA 2QENA 4NE2A 3RS3A 3VHLB 1N2CE 4M1KA 1IY2A 3CBQA 2GJ8A 4D4KA 1XWIA 1E9AA 2BHRA 3MJRA 2BCGY 3S1AB 4DUGD 3KQHA 2WOOA 4Q7MB 4HAUA 4PO1A 5BW8A 4D25A 1OF1A 2BMJA 1GWNA 1NN3A 2HJGA 3IDQA 3TAUA 4AKGA 2QMUA 5TDHA 4UXJA 1XTQA 4UJ3A 2WSSA 1Q21A 5BN3A 2H7VA 3ECCA 2DWOA 4IFBA 3J81k 1D2EA 3O8DA 2FSFA 5CITA 1G4UR 4AYTA 2CL0X 3B1WA 4PO8A 3AVPA 1Z3IX 3FMOB 4MKIA 2QBYA 1E94E 1EFCA 1ZCAA 2F9MA 1QF9A 1RVDA 1OYWA 2ZJYA 4P4TA 5EUMA 3UG6A 1KMHB 3SU8A 2ERYA 3KKQA 1OFHA 3QBVA 1G3MA 4GZLA 1Z6YA 2DYKA 5KU1A 2N46A 2EFCB 2D2EA 4DVGA 1U0HC 4MQBA 4EFNA 3SFVA 1T5LA 4IDHA 2W6JA 4QGGA 1VYVA 3NBYC 4RKEA 1R5OA 1NJFA 1TX4B 1P2TA 5HE9A 3ZZUA 2YZ2A 2IYQA 3B82A 3KTAB 3IIKA 1RJ9A 4Z8YA 2JDIA 3F0TA 3PCRB 1GRQA 3RSOA 3TVTA 5JHGB 2GBLC 2QMEA 4TLAA 4IDPA 1KTVA 2VYFA 3UPUA 1CULC 1N5LA 2J7KA 4HDCA 4V0MA 4G0NA 4QM6A 3FKQA 3QXCA 2VHUA 3CZPA 3C7KA 2J0UB 5FBWB 4MRRA 4TYPA 5JWRA 1YRBA 1CXZA 2GK7A 3GJ8A 3DZ8A 3GMTA 5LB4A 4QJ3A 4NYJR 1JR3D 3QPWA 1NY5A 1G64A 5FPYA 2FA9A 2CMKA 1GITA 2IWRA 4TYWA 2GCOA 1H8HA 2WWWA 5KPJA 1HV8A 3EZFA 2WKPA 1MT0A 2CCGA 4RD3A 1P3JA 2I1VB 3LVQE 1VHLA 2ZUCA 5UKDA 2F43A 4N0EA 1Q12A 1L8QA 2A5YB 4US0R 4JVSB 4ACBA 5AJYA 2FZLA 1SHZA 3I3SR 4DLTA 2FEMA 1XU4A 5JBQA 3FE2A 4NDZA 1Z28A 4G5QA 4JL5A 5FOVA 1T0JB 1S9HA 1ZP6A 3W6OA 1YE8A 2I1QA 3EWSA 3L0PA 4KSBA 2OUKA 5A4JA 1W1WA 4TZ6A 1I2MA 3GLGB 5M04A 2FV8A 2GAAA 4C0JA 3SR0A 1OLOA 1NBME 2QPAA 3AF3A 4NL4H 4OI0A 2AR7A 2DWQA 1V5WA 2ZI3A 1JI0A 3K9NA 3OEEA 1QHHA 5JHHB 1GKIA 2V7QD 1XNJA 1LY1A 4EPRA 3H0KA 1XTSA 1L4YA 4Q4HB 3W90A 1R7RA 4KBGA 3SYNA 3WMGA 1P73A 3A1SA 4TMKA 3A1UA 3HDTA 3ZGXA 4PSVA 3ADDA 4GSYA 1U9IC 1UEIA 4QFMA 4M1OA 2PCJA 2C96A 4N0DA 4LBYA 1YZLA 1Z0FA 4Q1DA 3T35A 1UEJA 4ILEA 4MDEA 4CEHA 1IN7A 3KL4A 3QJYA 2WJIA 4P4SA 1Z08A 4A2QA 1N6KA 3EASA 2PLRA 3KFVA 4G01B 3ZJYA 4B3DA 1ANKA 3RRYA 3ZVMA 5LDDC 1F2UB 4G5SA 4D4LA 3RRMA 1TEVA 2HCBA 3MUFA 2ZRNA 2ZRMA 3WBJA 5G53C 2E1RA 3BE4A 3KXLA 4IRUB 3LNCA 2BDTA 4OK5A 2OV2A 1Q20A 1SKQA 3UMRA 2E9SA 3RNLA 3KKPA 3TE6A 1I4DD 3AGQA 2J46A 2BM1A 1FW6A 1YR9A 1OPXA 1XTRA 3IO3A 3EZ7A 4TLEA 3X1XA 3FGNA 2FPMA 1AZSC 4US1R 1KY3A 2X2FA 2R9VA 4U7DA 3QKUA 1V43A 3SDZA 2FFQA 4Z1MA 3ASZA 521PA 3AGPA 2CDNA 1W0JA 4AG5A 1XEFA 4DSNA 3VR2A 2RGNA 4B3XA 3SBEA 3I72A 2JJ8A 4G5RA 2EWVA 1PLJA 3BFXA 3RS0A 4ZCLA 3SN6A 1CR0A 5IK2A 4HDQB 1PZNA 3RWMB 1TTTA 5F3WB 2ODBA 3THYA 2ZS8A 1XCPA 4TN1A 2YVUA 4BFVA 3QG5A 1OHHA 1Z6TA 1KO1A 4PZYA 1ZD9A 3PENA 2JLXA 4NCJA 1RRCA 5F98A 2NO6A 2AX4A 3SNHA 4D82A 4TTRA 2OT3B 1UDXA 4TMXA 1E9SA 1WB9A 2R6AA 3LLMA 2W2VA 1GP2A 1MRSA 3OAAD 2XGJA 3W6PA 1J2JA 1I2DA 1SKYB 1R6BX 1E0KA 1N6IA 4A2WA 1OXVA 2H16A 2C78A 2PMKA 2DFKB 5JECA 4TTQA 4HI0E 3IGFA 1TEXA 1KDRA 1MH1A 4LBWA 2QM7A 3JZAA 4ZDJA 1EESA 3MCAA 3ZQJA 3L0SA 4M1MA 3RLFA 4PPQA 2EFDB 3O8CA 3CPEA 3FB4A 2VH5R 1SVIA 4OBEA 1J7KA 1SVLA 2G88A 2NTYC 2ORVA 4PC1A 4TZ0A 5JJIA 1E2GA 4B2PA 5CYOA 1SZPA 1XJCA 3QXXA 5KDOA 3EPLA 4TSFA 1WQ1R 3BJIC 3OIVA 1VDZA 4BFUA 2JASA 3I61A 1P60A 3I62A 3BAFA 5FUXA 3SHFA 2GVDC 2BOVA 2QP9X 3BH7A 2FWRA 2GNOA 4B3CA 4A8JA 4E09A 1SVOA 1M74A 1NLYA 3E5HA 4LZZA 4I1UA 1OXUA 4PHFA 4Q4JA 1AZTA 4OHXA 5EXTA 1O3YA 1W0KA 1GKUB 3PUVA 1IY1A 2A78A 2WJVA 4A0HA 1YU9A 721PA 1DAKA 1G41A 2XAUA 1KDPA 3BS4A 1COWA 1X8JA 1W2GA 1G8HA 2ZR0A 4M53A 3CLVA 4Q9LA 5EE5B 3NBZC 5BQ5A 1NVVQ 1CP2A 2QTHA 5B64A 3K0AA 2PJZA 3QPUA 5JRJA 2WWIA 2Q9CA 3IPXA 1W5SA 2IW3A 3CB4A 4DIDA 4B3GA 2OCBA 1YHNA 2C03A 1KO5A 3MSXA 1IHUA 1P9RA 2QE7D 3W6NA 1ZM4A 1H8EA 2OFXA 5LBIA 4LX0A 1CF4A 5IRCD 2QEQA 3W5JA 4QBFA 3CH5A 1QHSA 421PA 3LFUA 2YKGA 3OIUA 2FNAA 4E03A 3IEVA 1G21E 1PUIA 1JECA 2BIFA 4OHVA 3VNVA 1KZGB 4DKXA 2J7PD 4LYJA 4R98A 1DO0A 1N3BA 4ITRC 4HAYA 2IXFA 4E5UA 3SHWA 3ZZTA 221PA 2IF2A 4GP6A 5HKKD 1IM2A 5JS8A 3B1ZA 2C9CA 2AXPA 2HLDA 3NVAA 3WY9A 4V0OA 2ATVA 2NO9A 4JLAA 3V00A 1XP8A 2QSYA 1I4LD 1ZNYA 3AKDA 3U7GA 1GDDA 2B6HA 2P2LA 2ZSBA 2GWHA 5JMTA 2FDCA 1U94A 1MO5A 4MRPA 2OFWA 2HYDA 4B3FX 1SGWA 2HXYA 2OCYC 4X8OA 4X8MA 3CPJB 3PV0A 3U44A 4FMCB 1IAQA 2Q3HA 5FL3A 2ZRHA 3FOZA 4B47A 5LB2A 2QSZA 1N6PA 4JBWA 3PEVA 5L3VA 2EFGA 3FFBA 1ZMXA 4G1UC 1FUKA 2MMCA 1U2RA 4Q47A 2B8WA 2D3WA 5CJPA 1W2HA 1VCIA 2AL7A 1X8LA 3AUXA 1JBKA 1E1RA 4NONA 3EZ9A 3A4LA 2CL7X 1N6RA 3E2IA 5KNBA 2ZRGA 4LGMA 2J9RA 4IKEA 2PBRA 4TL8A 2BBOA 3T06B 1NRJB 2ATXA 4K8OA 4LK2A 4D81A 1E9BA 1DOAA 2YOGA 3JVVA 3AV0B 3AF2A 4XWOA 2P6UA 1XD9A 4XSGA 5KPDA 5H70A 4BASA 3TH5A 5TMPA 3Q3JB 2NMVA 3NHAA 3R8FA 4HEJA 1XEXA 2QPOA 3B6EA 4W5JA 1CS4C 1U81A 3MMPA 4RCYA 4HB3A 4H9GA 1GOTA 2EFEB 5KNCA 5C18A 2ZI7A 4C0HA 3VR6A 1KDTA 1ZC3A 4M4SA 4MRSA 1XMVA 1VIAA 3P26A 4DLYA 2H17A 2ZI4A 3QE0A 2ZAOA 4GP7A 5GJBA 3UWKA 2PT7A 4IOJA 5G40A 1UBGA 1ZU5A 4BLRA 2AKYA 1Z0DA 4M1SA 1E9DA 2GF9A 4TYNA 2IEZA 4RD2A 1W36B 3VKGA 4V02A 3G0HA 4ZCMA 4EPXA 1SXJA 3LY5A 2J3EA 2R62A 1KYIA 1ZNWA 1MABA 1L4UA 2QPTA 2V55B 3CNLA 3TR0A 2ZJBA 2ZI9A 2JIZA 1ZYUA 2RAPA 2VP5A 4KFUA 2QROA 2R6FA 2WSSD 4WA7A 3QEOA 1G7CA 2WWHA 5FTKA 4BLSA 3ND8A 3ADCA 4L16A 4M0LA 2ZROA 4X8LA 5KSYA 4TLBA 5EZ5A 5JRZA 5JI3E 2G6BA 1KO4A 2V6IA 1JR6A 2ZTSA 4S35A 3ZD7A 4ZCIA 3RS2A 3VU9A 3QY0A 3V9PA 2VQSA 4LDJA 2JA1A 1TF7A 4ASUA 1Q1QA 4CF7A 3F8TA 2ZYWX 621PA 3VR1A 1NVVR 121PA 1W4CA 1HT2E 2C77A 3BBPA 3DEFA 5F2EA 1D2NA 3VR4A 1FP6A 5G41A 4NBSA 1LNZA 2W6JD 2JLRA 4JLOA 3LXRA 2CK3A 1AS2A 3BORA 1X6VA 1M6NA 3R9XA 1XBTA 2AHOA 4GI7A 1KMQA 1E79A 1P62B 4F4CA 2JDID 1SVKA 2BCJQ 4KHZA 1G3UA 1LV7A 2FGJA 1E3MA 5CIQA 4D80A 1N5JA 4A6PA 3DM5A 3QKSA 4BFZA 4F4IA 2A5DA 1SVWA 5DLQC 1VYTA 3TLXA 3D6TB 5P21A 4A2PA 1WXQA 2WJYA 1RYHA 1G9XA 1OIVA 1G8FA 1TUEA 3CNOA 1U8ZA 4RD4A 4YXWA 4XWAA 2J1LA 2Q21A 3VX4A 2ZVQX 4OHWA 1H8HD 2VEDA 4DDWA 1XEWY 4DLZA 4E07A 3AF1A 4JBXA 3LH5A 4BFWA 3HR7A 4XH9B 1DTSA 2C8VA 2CCJA 1ZM9A 3TR5A 2QBYB 3DL0A 1Z6GA 4DCTA 2FFHA 3AVUA 3PXGA 2VP6A 1W7AA 4IEEA 1N25A 1NG9A 5F9FA 2JLVA 1D5CA 3UK6A 1OKKA 4HZUA 2VHCA 4C0QC 2P3SA 4YDHB 4GRAA 1T6NA 2QZ4A 2OFOA 4M9QA 5F9HA 2F1RA 4Q9JA 1HQCA 1NF3A 1KI6A 3WP1B 1RJ9B 1E6CA 1AKYA 4DWJA 4NYIQ 4WW0A 1WE2A 2NOAA 2WMOB 4QNRA 2RGBA 3PFIA 4AKIA 3OEED 5C4MA 3F3YA 4HAVA 4TT3A 5TVKA 4NCIA 1TUIA 3UATA 4V0NA 4DB4A 3R7WA 2DFTA 3RS5A 3M0EA 2IX3A 3GLIE 1DADA 4KVAA 4RZXA 2GXUA 3OESA 4JKYA 5TV2A 2YINC 4TQUS 3UMFA 4EPYA 2OSBA 4WZ6A 4CT5A 3ZLJA 4IOKA 4C3ZA 2CJWA 1M7BA 2AK2A 3T1VA 1XJQA 3HR8A 3IIJA 1TU3A 4TYQA 3UXMA 4QBGB 4YDSA 1L7VC 1UF9A 2Q0HA 3KXIA 1XD8A 2GCOB 5SZJA 1AS3A 1RRGA 1P7CA 3THWA 1MO6A 1UBFA 3K9HA 2F43B 1OXXK 3NH9A 1YZTA 4M22A 4R7ZA 4UNNA 2BM0A 2JCSA 1UBEA 1XJ0A 3Q9LA 5L3QA 1ZNZA 2OG2A 1E2MA 3P4XA 2QT0A 2QU8A 1NVXQ 2HF9A 2J87A 4FCWA 4DLVA 2J41A 1LB1B 1DVRA 2WJHA 4FMDB 1E0SA 2QP3A 2ZPTX 2FSHA 2NO1A 1CIPA 3I8SA 5CK4A 3TSWA 1OYYA 3SOPA 4QGHA 2W00A 3WXMA 1ZD8A 2MSDB 3QIAA 1FP7A 1E96A 1NN1A 1GM5A 4Z1MD 2WICA 1QHHB 2RGNC 4KFTA 1EFRA 4ZIRA 5EJEA 4IHQA 4B32A 1E9FA 1VIYA 2PLFA 1G3QA 1UADA 3L0IB 4RD0A 4MITA 4UXIA 4EKDA 5IK2D 1EFHA 4ESVA 2CXXA 1II9A 3REFA 3BD9A 4IXMA 3SC3A 4IVRA 2N42A 1W44A 1S8FA 2ONKA 3BIFA 2O8BA 4RFVA 1OHHD 2BKUA 4L5BA 4PAMA 2GCPA 4JYBA 4LCBA 1IXZA 2REXB 4LWZA 4CEHB 3KQNA 1S2MA 3HYTA 3C5HA 1KNXA 1R0WA 1Q0UA 4P4SB 1US8B 2R6CA 2XNSA 4I4LA 4MUAA 2WM9B 4RY2A 3A4NA 1W4RA 1XTKA 2IYLD 5KDLA 5A5GA 3L8ZA 5L8VA 3PUXA 3CWZA 5L3SA 3FKSA 5HZHA 2AXNA 5EE3A 4NCKA 2X1VA 3I92A 3A4MA 3PITA 4Q9IA 2ZR9A 1ZUNB 1NIJA 4PPFA 3IILA 4Z8XA 1GIAA 4FN5A 1TF2A 4LHVA 1HQYE 2ECKA 5CYPA 4EJSA 2WMNB 1R5BA 1B23P 4B35A 3U61B 4C7OA 4O2LA 4LPSA 2E87A 4TL7A 2XX3A 1II8A 2QI9C 5J47A 4QGFA 2I3BA 1KSGA 4P0TA 5FOTA 2IS2A 1A2BA 1ZD1A 5DHAA 4PAQA 3P32A 3THYB 2BMDA 4WZAE 2VL7A 2O8EA 2ZI6A 1PLLA 2QQEA 3HPQA 3ZVLA 4GNKA 3FPAA 4AURA 3BB1A 1ZU4A 1E2HA 2VRWA 3BH0A 3DOFA 2IS4A 2ZSEA 2BV3A 2F3RA 2JLZA 1R4AA 4KVGA 1W0KD 2WIBA 3U3MA 3B8HA 2XXAA 4ZPXA 4Z54A 1LF0A 4W9MC 1FFHA 1N6NA 4CGZA 2GDJA 3Q72A 5DSZA 4Q1BA 1COWD 1FTSA 1R10A 4L4UA 4RZUA 2GESA 4NYIR 1KI4A 4IVQA 5G3YA 4HLCA 1S9DA 3BRWD 4V0LA 4MH0R 3WNBA 3VHXA 2RCNA 2F1JA 3LXXA 4LYHA 4R2IA 4BQSA 2CLCX 2XZLA 3HP1A 4PHTA 4D0LB 2DCUA 4Q02A 4ZDWA 1H8ED 1ZM3A 4IVPA 3UKDA 2Q3MA 1L2TA 1RE0A 2O8DA 4TLDA 1NVUQ 5FBQB 3WYGA 1KI7A 3BC1A 1ZAKA 2ZJ2A 1BS1A 4EPWA 1UKEA 2Q6TA 1BIFA 4AC9A 4PQRA 2VLIA 3TSOA 3MWJA 5KO2A 3B13B 2HT6A 1LS1A 3NG1A 1NN0A 2ODWA 3AUYA 1D8TA 2F1IA 4RCZA 2UZ3A 4BFYA 1CRQA 3H4MA 4PSKA 5CK5A 2HLDD 2FN4A 3WBKA 4BFXA 2V4ZA 2ZE7A 1EX6A 4YONB 4A8JB 3K70D 2C95A 4HATA 5AUQA 1XPOA 5HTKA 1E2EA 2IHYA 4IOMA 4URUR 5AR1A 4CW7A 4FMBB 5FR2A 1Q1BA 4G5OA 1LVGA 4Q4JB 3QF4A 1KJZA 1Z47A 3CRRA 2QRNA 4JLJA 3VX3A 3L8YA 1VG8A 4EPTA 1G3RA 4LJ4A 1VMAA 4R2HA 3Q5EA 1BOFA 2EQBA 3A36A 3HU2A 4C4PA 4D2IA 2ASEA 4HDOB 3G5UA 2Q3FA 4B76A 1F5NA 1G7RA 2R8RA 1KIMA 3H2YA 3K0AB 3KFXA 5CB8A 3SS8A 4YMTA 4LBZA 1E1RD 1YVDA 2QGZA 2QNRA 1Q57A 4QRHA 2QY9A 1UAAA 1Q3TA 4QXAA 5FH9A 1AGRA 4LUCA 3X1DA 1HY3A 1AM4D 2ZRLA 1XTIA 2GXSA 4I1OA 2KBFA 3HU3A 4FI3C 5KTYA 2DHRA 2NZ8A 3GLHA 2VSOA 4LJ8A 3OEHA 3A1VA 3IO5A 5HE8A 4EAQA 1VCOA 1ZUHA 5DH9A 5C2JB 2ZS7A 1TNDA 1LS6A 4B34A 3GLFE 1E4VA 3IPYA 2XB4A 3K70B 3PVSA 1UM8A 1CJMA 4WIAA 2F1HA 5AUOB 2R6GA 3Q7QA 4DSTA 4D26A 1RIFA 2IYRA 3O8BA 3IHWA 2IYXA 4PPGA 1E2LA 1OIXA 4FD2A 3T1QA 3R20A 2DB3A 1YJ5A 3U44B 2UZIR 4CVNA 1MO3A 1UDWA 4IOLA 2VIIA 3FHOA 1K5GA 4WBSA 3REGA 2OLJA 2CL6X 2FMXA 3KXKA 1SXJD 4PR0A 1YRAA 5EP1A 3AVWA 2QAJA 4U02A 3TK1A 1AQYA 3W8NA 2WWFA 2ZJOA 5FBVB 2CBZA 2JIZD 1ZW6A 4M9ZA 1T91A 2OHFA 4ARZA 5JFGA 4HUTA 3P27A 4DDVA 2JJ1A 5CJ2A 1GG2A 3K8YA 4F38A 2QQ0A 3A58B 4Q7JB 4IDNA 4X8HA 4XD7A 3QEJA 2C5LA 1U8AA 2G77B 2RB4A 2GXAA 1YZUA 1CRPA 1Z8FA 1ZJ6A 2QG6A 5FOSA 2REBA 4M1YA 5BN4A 4KLNA 4MYUA 4JIMA 4CRWB 5JLJA 2C04A 2HEIA 1DARA 4LV8B 4BLQA 2I4IA 4ASUD 4JKIA 4QKQA 3BB4A 3TW4A 1QG2A 4Q9HA 1Q3HA 4HUQA 2FF7A 2ZUDA 1Z0JA 1HE8B 3AQ4A 3CF0A 3F5FA 5EE1A 1N0UA 2CK3D 4XWKA 1Z29A 4ZDKA 1FNNA 2GILA 3ETLA 5IHPA 1Z22A 3RSLA 4JLDA 2F55A 4PSAA 2V6JA 3LW7A 2W6IA 5GVSA 1QHXA 3K0SA 2OILA 1SXJB 2IYSA 5AJZA 3LD9A 1MABB 2HUPA 1S1MA 1HURA 4O25A 2XOKA 4G3XA 3NH6A 5JS7A 1FL9A 1EWRA 4XSHA 4AG6A 3X2SA 4MKHA 1KO7A 2CNWA 1NN5A 1MRNA 2YWFA 4P33A 2RHDA 1NP6A 4D6PA 1AS0A 5EQTA 3TUIC 4BFTA 4Q21A 5J4HA 2HT1A 1FNMA 4MUBA 5DE3A 2ZXUA 1E1QD 1Q22A 4PANA 2NO0A 3SJBA 2JJ2A 4ZV4A 3VU9B 4KITB 2P5SA 2AD5A 3TQFA 4BLPA 2AWNA 3R9WA 3DZDA 2AK3A 2QAGA 3QXSA 4KBFA 5DNYB 1OKKD 5ANRB 3KUDA 4CZ2A 2KJQA 4YMVA 1NBMA 1R0XA 3A37A 4MYHA 1XCMA 4M21A 2EYUA 1DELA 2ZETA 3HWSA 1H65A 1RFLA 2H18A 2CE7A 3K09C 5BN5A 2GTPA 4QHYA 4YMSA 3GLGE 4TL6A 3ZDQA 4F92B 3GEEA 1W46A 2BMEA 1E9RA 4TT3D 1ETUA 1KKLA 3DDCA 4IW3B 3AF4A 3PQCA 2YJTD 3QPVA 4KI0A 4M9SA 5KUTA 2XNDA 3TUJC 4EFMA 4JVMA 2PZGA 1E0JA 1DO2A 1FTNA 1KI3A 1TL7C 2CEAA 5E7JA 2F9LA 1T3HA 2OBMA 2PZFA 3EAQA 2IL1A 3KB2A 3LBIA 4Q1EA 1JR3E 4Q66C 3LQRA 1HYQA 1N5KA 4HLUC 3WRXC 1OH8A 1G3IA 1VPLA 3KJHA 4CEJA 2J0QA 2UKDA 4L9WA 3OFND 2JLYA 1DG1G 3X1YA 1S3GA 2D2FA 4DXAA 3PUYA 2EWWA 3GJ4A 3RYTC 5JZVA 5C1BA 2WHXA 3GJ5A 3LA6A 2A7QA 3U6KA 1F60A 4Q03A 2ZYUX 1DAMA 1EGAA 3K0CA 4PQFA 4P3YA 1OSNA 4OYHA 4LHWA 4BZXA 4HZUB 4OK3A 3OHMA 2IHBA 3KUCA 4MGYR 4PZLA 5B57C 1U8YA 2XSZA 5FTLA 1BH2A 1IN4A 1P2VA 3NIBA 5JJLA 1XEWX 1KI6B 3CM0A 1GNRA 3QBTA 5L3RA 4DLXA 2O0HA 1K6MA 4MGZR 4JLNA 3P4YA 5EP4A 1CJTC 2R6DA 4IEIA 2HYIC 1VCMA 1PJRA 1EFRD 3R7WB 1Z0KA 1II0A 2RGGA 4PHHA 4YLGA 4A92A 1KSJA 1CBUA 1EK0A 1Q44A 1X8KA 2CVHA 2X2EA 4KCGA 2ZJAA 1F48A 3H86A 4PX9A 2ZRCA 2CJWB 4CDGA 1XXHE 2YOFA 3QVVA 2QA5A 2QRZA 2EFHB 3SZRA 4JMPA 2WIAA 4B3BA 1PLKA 2C9OA 3THWB 4W5WA 5LD2B 2WBLC 1G7SA 3L82B 4PHGA 1P2SA 2X77A 4DSUA 4CEIA 2D7CA 4FCVA 5DO9A 5L3QB 1W36C 1TPZA 2EVWX 3DMNA 5E4FA 1W36D 4MYTA 1JB1A 3FKSD 2HXSA 4RKFA 5TY0A 2IWHA 1QVRA 4FCTA 4AKEA 1SKYE 4J0QA 3CO5A 4EDHA 1DAFA 3CF6R 3NEJA 1OXTA 2ZE8A 4JJZA 4L9SA 4XJXA 1P4SA 1GILA 2ZI5A 3GCGA 2ZRJA 5DI3A 4EIWA 1E2IA 1KO8A 4LBVA 4PXAA 1E2NA 3TSZA 5DYGA 4LHZA 5J4YA 3AP2A 4ZIRB 1IJEA 2IUSA 5HCIA 2Z6VA 2GBLA 1U98A 3CIOA 4ZKEA 4BECA 5K8IA 3TGPA 3AKCA 2QMHA 1G18A 2SHKA 3KKNA 2VHTA 5J40A 5FTNA 2QN6A 2QM8A 2F3TA 1JR3A 5CDFE 3RANA 3QI2A 4NCHA 4P32A 4BLOA 1EFTA 4HLQB 1Z0AA 1VTKA 2O8BB 1S4QA 1DAHA 3EIEA 4GBMA 1FPMA 4QC2A 2FFAA 5DGXA 1KHTA 3CZQA 4URWR 4CIDA 1VG1A 3ONWA 5EE0A 2KBEA 3QOFA 3QUSA 2QMOA 3MGCA 2A3RA 2G9NA 3AVTA 3AVVA 1QHGA 5DIFA 4A82A 2IUTA 3FDIA 2ZJ5A 3NDBB 4KXFB 1Z83A 3AH8A 3GJ7A 4OI1A 1F2UA 2V1UA 2YYZA 1Z0IA 2F7SA 2Z83A 5L3SB 3U7HB 1F6BA 3AVQA 3MLEA 1CTQA 2ZRPA 1S96A 1Z2CA 4UNSA 4K81B 4MGKR 3IBYA 4Q18A 1A1VA 1ZRHA 1XX6A 4OQFA 3U3KA 1R2QA 2X19A 4QJ4A 4GFDA 1X86B 4MYCA 5AK0A 4DT1A 4JLMA 4A4DA 3DM9B 4IXNA 5SZKB 5BYKA 1G6OA 5FFMA 1KGDA 3O8RA 2QT1A 1KY2A 2FZ4A 3G82C 4C7OB 3OIWA 4D0NA 4UNPA 1ZM7A 3T5GA 4DCVA 2IYUA 1GVNB 4URXR 1II8B 4EPVA 1NY6A 2Q9AA 5D3MA 3NWJA 2WVJA 1XXHA 3CR7A 3QXHA 4LYFA 5AWFC 1Z06A 1P2UA 5FR1A 3UWOA 2O8EB 3AM1A 1GL6A 3NC0C 1N6OA 4MRNA 2P65A 5D3QA 2RGEA 3EPHA 1U9IA 4F91B 3MG9A 2L0XA 2ZR7A 4AK9A 4PC6A 4F93B 3OF5A 1RPZA 2WPDA 1EFUA 1XMJA 4LV6A 1GL7A 5KSZA 2J45A 4YQFA 2XXAB 2EU8A 2O8CA 3HPRA 3GJ3A 3L2OB 4HLDA 2VBCA 1K5DA 4Y0AA 4R71A 2CLSA 2B8TA 4KJZA 5JI2E 1UJ2A 2FPKA 3EZ6A 4KODA 3D3QA 2O8FA 4GDFA 4HAXA 4LC0A 2GZAA 5CM9C 4JS0A 5EXSA 2P67A 4KFRA 1ZCBA 2WAXA 1NKTA 3TJZA 3M4YA 2WJGA 5DN6A 4DSOA 4OQXA 1T8TA 3EC1A 2FJUA 2V9PA 2JLQA 3B9PA 2X8AA 1MV5A 1U0JA 2DY1A 4Q7KA 2O8DB 2NQ2C 3K9GA 1JQLB 1DAGA 2W83A 4A9AA 4JT2A 3IQWA 4E22A 3MD0A 4US2R 4GL2A 5HPYB 2P5TB 2GF0A 2YOHA 4UNQA 1DAEA 2BVNA 5TARA 4BUJA 3K0EA 1KI2A 1OH6A 2IK8A 4QBIA 4UNRA 2JAQA 3CRMA 4GPTA 1VG0B 2QP4A 1UKZA 3EA0A 4FINA 3PG5A 3WMEA 3LWNA 4EUNA 3W34A 5GJWC 1A2KC 1XRJA 1GL9B 4M9XA 4RVCA 3EWAA 4JVNA 2GHIA 4AI6A 1ELOA 4BWYA 1MOZA 3QF4B 1ODFA 3GJ0A 1A4RA 2PX0A 4PAOA 3GQBA 3VFDA 2ZAMA 1YZGA 4WXPA 4C2UA 5E3HA 2GVZC 1G17A 2N1BA 1KI1A 3WNCA 1SULA 2JGNA 1UKYA 5FOWA 3T34A 3WMFA 4CYMA 4R9UC 4LJYA 4BGDA 3THXA 1IN8A 1TF5A 3A8TA 4QJ5A 4TYYA 3CRQA 1P75A 4JSYA 3RWOA 5DISB 2ANBA 2RGCA 3KQLA 3Q85A 2BEKA 2YC2C 5H8WA 4B73A 5AJXA 5EXPA 1CJKC 1M7HA 1QDEA 2GJSA 3W3AA 3GLHB 2NO7A 2IS1A 3DKVA 5JCZA 3P1JA 1FX0A 3LRPA 3JVUA 4YC7A 2ZREA 3U7EB 1E2JA 3RHFA 3RC3A 4U00A 2VO1A 2GZHA 2GJ9A 4DLWA 4DB2A 3SJZA 4B6FA 2HV8A 1YZQA 5FTJA 3M1IA 4KYIB 2CHQA 3THOA 1JAHA 4P31A 3W3ZB 4I99A 4ZI2A 4A36A 1IXSB 1G8YA 3CRVA 3VNUA 1OT3A 2P6NA 1DAIA 5KSPA 3EXAA 3UG7A 3NXSA 1E2DA 3B1VA 2VP2A 1LTQA 2FEOA 1PVOA 1W0JD 2W6ID 3AVOA 1CR4A 4MKGA 2IYZA 2ZRBA 1R5NA 4FWTA 2ZU0C 3N5CA 1KAGA 1FZQA 1WBBA 1FMLA 2ZRDA 1P9WA 3BFVA 3WYFA 3SFZA 4ARZB 4M2LA 3VR5A 4B44A 3ADBA 1NKSA 1XZPA 5SZIA 2XEXA 1VG9B 1UPTA 2EW1A 4LJ9A 4A1FA 5G3ZA 3VMFA 2ZSFA 1ZM2A 3L43A 3K0FA 2FGKA 1LF5A 4JL8A 1XPRA 4RD1A 2P6RA 1ESMA 4F4JA 2P0EA 3SQWA 2IYYA 2JJ2D 3EIHA 3VKWA 2XTNA 5CB6A 1W49A 4ACAA 3UMSA 3LV8A 4URVR 4FXPA 4P4UA 2QAGC 5GADl 4WZBE 3HJNA 2WWXA 2AKAB 5C4GB 2IUUA 2CCKA 1CJVC 1G1MA 3NBFA 2IT1A 3MAAC 1NSTA 1NBMD 4HUQB 5H1YA 4MKFA 1NG1A 5TB5A 4N3NA 3KZ1E 4AWXA 1CLUA 1QRAA 2VHQA 3TW8B 4NMMA 1TQ4A 4QG7A 3GLIA 3P20A 4A0RA 1P5ZB 4BZQA 5JEEA 3C41J 4GT1A 4H1VA 3BGWA 1GUAA 4NYMQ 3QF7A 1IJFA 1M2OB 2KI5A 2XNDD 4TSFD 2IYVA 1PV4A 3C16C 4M1WA 3U3JA 1EG7A 2YV5A 4V0ME 4NHOA 3PR1A 2BMFA 3RS7A 4A8JC 4EFLA 5KYKA 3RRNA 3WRYC 1JJVA 1U99A 5LPNA 2NGRA 2CHGA 5FOXA 4FMCF 1R8QA 1JEEA 4RZ3A 1MO4A 2RMKA 1KNQA 2RHMA 2VP4A 3C8UA 4Q00A 5B2ZA 4DCUA 1XF9A 2C98A 3R8CA 2O52A 1YZNA 1NVWQ 4TLCA 3K0CC 2ZIAA 1KZ7B 4HYYA 2PZEA 2XB2A 2D06A 2BKEA 1YR8A 3SQXA 4MRVA 2QAGB 1IY0A 2Q9BA 3ZQ6A 2OLKA 1TQ6A 3ZYCA 1JPJA 3QKRA 2XJ4A 2G1JA 2XSZD 2WWGA 3AP3A 3PUZA 3ZVRA 3WHKA 2PH1A 4DDUA 2W2TA 3B1YA 1Z63A 1OH5A 1ESNA 1AKEA 2D4HA 5BWMA 3CF2A 3NKVA 1QHNA 3MWYW 4HSEA 4ON9A 3BOSA 5JCPA 1R0ZA 1NNEA 2RKOA 3U2QA 2IYTA 3CX6A 1BMFA 1B0UA 4ZI3A 4V03A 3K70C 3IHLA 3SI7A 3I8XA 2TMKA 1NLFA 3PIRA 2HDNB 3AEZA 2LKDA 1CKEA 1KK2A 1R0YA 1Z5ZA
chains in the Genus database with same CATH superfamily
1DBPA 3LU1A 4CV0A 4I5DA 4M0UA 1N9GB 3U80A 2ZJ7A 5E0KB 5EA2A 2A5FA 5JXWA 3K9LA 3B2EA 3PFKA 1T4BA 3HYNA 3KKOA 2OM2A 1RCUA 1V5GA 3RK4A 2WU3A 1C4XA 4PINA 5TVGA 1E2QA 2VAVA 3WTBA 5I47A 1HC7A 3I2YX 4JXJA 1D0IA 3MJHA 5I6DA 5KHOC 1QH8B 5HZMA 3T3DA 5FPKA 1X77A 1W88A 2PX5A 1N5IA 1JAIA 1JWAB 4IAOA 4IIDA 3D7NA 4INPA 4WFKA 2YHIA 4Z9YA 4C05A 1WXGA 1O95D 3IEIA 5DIZA 4UVGA 1Y33E 4ZWNA 1LQ2A 3V4FA 4DLRA 2IE8A 2NU8B 2CF5A 4A0FA 1QGUA 3SX4A 2H1CA 3CWQA 3HLTA 3ELUA 4Q5IA 4UJ5A 1CZLA 1VLJA 4G67A 5E7MA 4FOSA 5HA5A 3O90A 3BGSA 1V41E 4PQGA 1YD7A 5EHZA 4ZZ3A 1L8XA 1NW8A 1RXYA 3ROTA 4GOLD 1CR1A 3G1UA 4CGYA 2PR7A 4WZAA 1YVPA 2FQYA 5MN5A 4B33A 1DXQA 4WJZA 4IX1A 3H4TA 2Z1DA 1JKIA 1VYUA 1Y1QA 2VPYA 3LWZA 1G4AE 3JX9A 3NBMA 2IH5A 4UEOA 2GZMA 2VTKA 2CY0A 2V7VA 3HCDA 4MHSA 1OTXA 3CEMA 4DIEA 2H2HA 1J90A 1JFFA 3TB4A 2FG5A 3K1TA 3LHKA 1IMOA 2ZU6A 3L9WA 3GEHA 4TV9A 1HE4A 5CYGA 1LLUA 2RIPA 1X1RA 3L0DA 2PUGA 4EHFA 2EX1A 4S2UA 1WMSA 2RGXA 1VSBA 1Q16A 3OZIA 2YBEA 1IAVA 4M8LA 2TRSB 4WY8A 1EFDN 1JNYA 2QTMA 3LMKA 3J7AC 4GLOA 2V4UA 4XIYA 4FBGA 1KEEB 4AY2A 1R0BA 2OV6A 1ZDMA 1E58A 4DMGA 2HHHB 4RWEA 4JLKA 3FMVA 5TEVA 1GTVA 1G5PA 3PFWO 5J1TB 4TL9A 3FTCA 3V33A 4E51A 5ITVA 5H68A 3B6JA 4D9BA 1JR4A 3SXUA 2VDVE 4FFMA 3LBAA 3C48A 2VNJA 3GZNA 3K71B 1GNSA 3AWDA 2QVLA 5EZ6B 3GP8A 3PC8A 1JG2A 2JG3A 3HYLA 3HBMA 1SUEA 2RHOA 3U7QB 1U7PA 3KR2A 3N0TA 2WG1A 4PFSA 3SS9X 1GFIA 2QUAA 4PYIA 4HB0A 2FMKA 4LDZA 1ZGCA 2VK2A 2XECA 2Z2ZA 3IULA 3QFCA 3TO5A 4WH0A 1VJ5A 5JZ9A 3K4HA 2BELA 4ESEA 2OAQ1 3ZDXB 3JATB 2AFHE 3LX8A 3AO0B 3EMKA 1TMGE 2BCEA 1F2DA 3DZKA 3OX2A 3TDNA 2R65A 4H7PA 2Q8QA 3OUUA 4PLVA 1DUSA 4O33A 4N65A 4KMRA 1YUNA 3KSZO 3KKMA 2B78A 3V1TC 4EA7A 3KQQA 1TM2A 2IYNA 1FQOA 2BKLA 2OV4A 1JSXA 4Z7NB 2GCEA 1BYUA 1TO1E 1EGMB 1XZQA 3TIGA 4W9NC 2P2NA 4DRXA 3OQHA 5BSUA 1HLDA 2W5UA 3P97A 5K0SA 4C4SA 3F90A 1JBQA 1T8UA 5FUYA 5HF8A 2Q8PA 3R74A 2VJYA 1HTWA 4Q9AA 1UBHS 3WL4A 2FB9A 4CTJA 3T7CA 2EZ8A 3L4SO 4ZP1A 1RC0A 3IV7A 1AGPA 1J1IA 4NTZA 4Q4AA 4R4JA 3ENNA 3RFVA 3WHLA 3WK9A 4YCSA 5JH7F 2ZE6A 4NZ9A 4D4MA 3ZCTA 3CUTA 1H69A 2GCIA 5CD1A 5DLEA 4QUJA 5ALYA 3IPRA 2JKZA 4GPZA 1WS6A 1JSCA 4HX9A 5TXGA 4R84A 1VRVA 3Q7EA 4R7GA 1Y6ZA 3U6BA 4Y8VA 2I3ZA 2HLPA 3R5SA 1SPBS 2NXWA 4TQGA 4BJHB 3TRFA 4C4ZA 4CMBA 5C1DA 3T1TA 1RAFA 3IURA 3QLJA 2ZVDA 2P68A 3QLEA 4A8PA 1ZONA 1OILA 1O6ZA 1UBCA 3K32A 3LS2A 2C2HA 1GZ6A 1XXHB 1Z4OA 5IN5A 1JT2A 1V3UA 4JP1A 3O8QA 1CEYA 3GUCA 2ZRKA 4RLQA 4PXYA 1OWMA 2ZIXB 1N3YA 1N6LA 3ZY3A 2L42A 4BOYA 4M1EA 2QD5A 5DYYA 1JJ7A 2YV1A 3G5LA 4NJEA 3LLUA 4HVCA 5DK6A 4ZT7A 2JFXA 2Y27A 3PUJA 1XCGB 1KQ3A 1UT5A 1ZEMA 1VDMA 4X6UA 5EY5B 5K8UA 2O8CB 1MN6A 2H5EA 3E1SA 2JFQA 4FGUA 5K3DA 4FZ5A 2P9JA 3GA5A 2KB0A 4GOXA 2XJ9A 4GI2A 2H0QA 1YDHA 3S1AA 1XLWA 4D1YA 1B6GA 1I51A 1KJ8A 3W2FA 4Z7QB 1SC9A 2HMVA 3OQJA 1GZDA 4GR5A 1BHSA 4JGGA 4LHSA 3BMXA 3LUBA 4QPJC 1G291 3C7AA 3R09A 3RVRA 3SYLA 2Z0MA 3QNWA 2P6PA 4ZVMA 3CONA 3F3MA 3EIOA 3I9MA 3NHRA 3O4VA 2REOA 4WKBA 5IJ0A 2VPWA 1IPFA 2NT3A 5DNCA 1QFMA 3TFOA 4D8UA 3AY7A 3RUCA 3LVRE 3EFHA 3HUFA 3JTEA 3X1JA 4DEVA 3R7NA 4P7FA 1NQTA 2HDWA 1H0RA 3A1WA 3Q9UA 1Y81A 3MOSA 2P91A 4PNPA 2E18A 3P0HA 2Q5LA 4QZVA 4TQAA 2DVMA 3W3AD 3I3OA 1A8PA 2J3MA 1EEHA 3OE7A 5H3HA 3IAFA 3F9RA 5AJWA 5GJVC 5I45A 5I9NA 2IF0A 1HL7A 4JLBA 4M1ZA 3PT9A 2QY6A 3EOAI 1XNRB 2C99A 5BSHA 4OL0A 5DXAA 1B1AA 2MHCA 1XN4A 2RKWA 2Z4SA 3BWDD 3ISJA 4B2IA 2PL3A 4D9FA 4AF6A 2EEZA 2J85A 5AH0A 1JG3A 4UBMA 3X1WA 3D2AA 2ZUBA 1UFRA 3DV0A 3MWGA 2FYTA 3IEMA 2A5JA 2FQ1A 2ZANA 4UZFA 2IC5A 3WISA 3EVDA 2IV3A 5D6OA 3INGA 3ZN2A 4C03A 1U0RA 4KC0A 1BW9B 1ZKDA 4TKUA 4XWTA 2DERA 1XFAA 1U7TA 5H82A 4QM7A 1IHPA 2C2OA 4E2ZA 4C4XA 3MILA 3ZCRA 1GAJA 3B12A 1JQBA 1NOJA 2R44A 3I42A 3Q5GA 3BJEA 3DAFA 4B6SA 4D9EA 5DCUA 4YT5A 1YKSA 2QK4A 5A03A 1DWPA 2J0UA 4IJ5A 2GRUA 4URZR 4DWWA 2IZ6A 2AC7A 2XRFA 4CKCB 3RADC 5JY6A 1SXJE 2XITA 3IRUA 4YP6A 4B6EA 5ILGA 3ROZA 1ZCFA 2WZCA 1GNLA 4EUSA 4DPKA 3GO4A 5JXHA 1OXSC 1YBMA 2E4VA 2ORYA 4EOGA 2FK8A 5LDGA 3NBQA 1GNPA 4A6DA 1U4NA 5IF3A 5AW6A 3U3XA 1FS5A 2G4VA 3AG5A 2VHJA 2P40A 1FX0B 1DS6A 1BRMA 2V7PA 2Q5QA 3ZE9A 2BE7A 2RK4A 3IQFA 4MV3A 2YWGA 2D13A 3RVOA 4U2GA 1R0KA 4YNBA 3L8DA 1PP4A 2PT5A 3K35A 3SZMA 3VTKA 3QNUA 5JVDA 2UUPA 4RJLA 1D9XA 5ENZA 1Q1EA 2NNLD 3GLSA 3JYQA 5GZ6A 5TX7A 3EFEA 4IQ0A 5EUQB 5C7OO 3R3SA 3GLGA 3UAYA 1KK3A 1P1HA 1T36A 1AF4A 4D5GA 3QJ5A 2AS0A 5DI9A 2A4KA 3SAJA 2ZSHA 4AG3A 4I81A 3GFTA 4UC0A 1HK7A 1I6WA 1CUYA 3LDAA 1EFPA 4ILKA 3U60B 1YFLA 4LF5B 4IP0A 1C3XA 1OE0A 2P77A 4POAA 4V3CA 3C8MA 4I1IA 5FPTA 1YS1X 1CUEA 4H27A 4AZ3A 1KVRA 4I3HA 3NATA 4BAZA 4FFNA 2NN3C 4MO9A 3FNFA 1FLDA 4O4IF 3K1JA 4DGQA 4FOLA 4Q4HA 4C4AA 3LUFA 3SJCA 2B35A 2MSCB 3OIYA 4B2LA 4BO3A 1YHYA 4X6LA 1UC4B 2IEGA 3BJZA 3Q11A 1X3SA 3QE2A 2VP9A 2QW0X 2SKCA 1N34B 1JAZA 1TADA 1CDDA 2R8BA 3MF4A 1E3TA 2QL5A 1OASA 2XBUA 4L15A 3UK2A 1DTWB 2A2ZA 4JX8A 5FDFA 5FWAA 4DLPA 2PUCA 3NJ4A 1SBTA 3FYHA 1GEGA 3TZBA 4PPNA 1Y0BA 2AMVA 5TS3A 4B84A 1M7GA 5EWLA 2UVPA 3KQSA 3UAWA 4BO5A 4MS1A 4WXHA 2YHBA 1V8OA 4EY7A 1DC7A 3NNDA 5A9SA 3Q87B 4J7CA 1KJWA 1EUDB 2C9ZA 2NU9A 2H8KA 2I99A 1PYDA 3LSYA 4JVLA 4EB6B 2PUFA 1XZFA 3ZWCA 1W4BA 3C6KA 3BL5A 3JQ9A 4QT4A 3C5WP 3HZRA 4JD5A 5JDCC 1UZUA 1YRWA 2EGGA 3VR3A 4MI6A 4EEKA 2LDBA 4TMYA 2NU6B 1W96A 3IUMA 4Z4HA 2C59A 1RTKA 1IXKA 1UWVA 1OU4A 1WUTA 2B5VA 2PSJA 2UUOA 3HUEA 2QR5A 4LJ5A 3HO6A 4MX8A 3WQHA 3GLIB 1JQAA 2VF2A 4DCNA 1RR6A 2WKQA 4EY3A 4GWGA 1G5QA 1KDOA 1WZNA 1UR5A 2HDHA 2ODEA 1L1EA 4FT4A 4MRMB 4Q39A 3USCS 3H9BA 3PIDA 3C87A 3ZZNA 1F1JA 3R77A 4XVUA 4EECA 1HOXA 2D54A 2OAEA 3HC7A 4N3AA 1U2PA 4YRTA 3A6PC 4LVUA 1MAWA 2C5EA 3H6GA 4DZTA 1BMFD 1W75A 2HKIA 4KTVE 4QOSA 5T5QA 1WF3A 1TVEA 2Y9MB 4QQ8A 5E95A 4C2TA 1QP8A 5I7EA 1NLZA 2HJVA 5THXA 2AJDA 3CX8A 2BL4A 4G8JA 2C7QA 3NZEA 1QOQB 2O8NA 5ALEA 5JCOA 1X94A 1N57A 2J67A 4HNQA 3VQTA 2WVGA 1LNSA 1L3CA 2OQ2A 2FR0A 2X6QA 2PFGA 3PIIA 5JQGF 3WA7A 1E2FA 3ILHA 5FUVA 2GAJA 4IGFA 4J0IA 1A9YA 4OB7A 4YMGA 2NTJA 3W5HA 1PNOA 2OO5C 3CE6A 1KBZA 2PA3A 2G83A 1J25A 2ZTVA 3D2BA 3OCZA 3OT5A 1TQDA 2E0IA 3R5KA 4DBLC 2W7TA 2O5VA 4H59A 4N6GA 3RQSA 3E58A 1XZNA 1P2FA 3LHSA 3ZWMA 1WR8A 3H87A 3EC2A 5FFNA 5AK3A 5I7OA 2EJVA 5FBRB 4RVDA 2QRKA 5J2TF 5E2IA 1DOHA 2G1UA 2P27A 4NDAA 1X7YB 4MVJE 2C7VA 4XB2A 1ZSYA 5ADUS 5LUAA 1XZIA 4YRFA 1VL6A 4IDOA 1OFUA 5CNMA 3VSDA 3HVRA 4OXQA 3R3XA 1H2YA 1CS0A 1VHWA 3PKZA 3M6MD 5T4FA 2P79A 2VLBA 3RUPA 1YRLA 1WL8A 1OX6A 4ISBA 1TK9A 4OAOA 4PFKA 5F35A 4LECA 3LGAA 2GQ0A 1WA5A 4LC9A 4BNLA 1QYXA 1LRJA 1QCDA 2QTAA 2GOYA 4AW9A 5FCDA 2QR2A 3D0QA 4OTZA 1P61B 4WV3A 2UUCB 4EB3A 1I3CA 1IYZA 2R2AA 3K9BA 3BK7A 2D59A 4RTRA 2DZDA 3QVTA 4LJ7A 2PWBA 4RGVA 2FG6C 5E7IA 4BS9A 5M7EA 1NXTA 4C0SA 4Q4DA 4KXYA 4BNWA 4DDTA 3CTMA 3JQAD 4HEA6 1ZWLA 1J9ZA 2ZS9A 1D4OA 3N8KA 1QS0A 1JAYA 1HEIA 3CKLA 2WF6A 3ET5A 3ETGA 3KELA 3WLIA 2Z2XA 1E1QA 3QXJA 1JI3A 5FL7D 3CUEF 3OAAA 3TAHA 3ZHQA 2X15A 1WW2A 2FEAA 3D3WA 3R1IA 4HGRA 4MNTA 3PUHA 4F3CA 1XGKA 1T4GA 3FUTA 1XMIA 3QBJA 2VRBA 2BLLA 3IQXA 1I5EA 2CDAA 1YB2A 3RU2A 1W47A 3CVUA 4DC9A 4J75A 1UDAA 3I8OA 3M1YA 2G71A 3RAEC 3F9IA 3TTWA 5KTPA 2HSJA 3RB8A 5CM8B 1GJRA 1A27A 1E1NA 2CWDA 2P78A 3E61A 1RZVA 3EW9A 3OMLA 1CY2A 1RKBA 1XXLA 1KAHA 2MYPA 5DHFA 2BBSA 2WYHA 4N3BA 4XD7D 5KSOA 2G06A 4TVOA 3EZGA 1EVYA 1OREA 1QYRA 3GLKA 1V3VA 3K09A 1WDMA 1Q5PA 4PZEA 2CLOB 2HWWA 3ZY5A 2JEOA 1M8KA 3H05A 3HXPA 1DG3A 5LIRA 5A4FS 5AUNB 3I73A 2ORIA 2D7DA 1AUVA 2DR3A 4GI1A 4CQLB 1YZKA 5IUKC 1QF7A 4R1QA 1JHRA 2PVSA 4BE9A 4FTWA 1RC8A 3EA5A 3GDFA 2M6LA 1RAGA 4ZC8A 2DPGA 3HUUA 3OZBA 3D7SA 5LA6B 4RTMA 4IIVA 1BVYF 3Q3GE 2DXIA 2WWYA 1HH4A 1GQRA 2ZT8A 5EZYA 3D2CA 3HUTA 3I01A 3C15C 5EJ8A 4N47A 1U90A 1WXDA 4JL6A 3EPKA 4MGIR 4JOCA 1V8ZA 2GHRA 3PD7A 3QVKA 2LCFA 2CNOA 2BD0A 2G04A 2YZKA 2AJCA 5ES3A 4WESB 3ORQA 1DP4A 1RWOA 3I6MA 4UEJA 1KI8A 4RL4A 1M8FA 3DKPA 5K20A 3P9XA 2VYND 1MQ8B 3EF1A 5KJFA 4N0PA 2ZDGA 5CLIA 5IC5A 4YJKA 3PE4A 2OB2A 1NXVA 3O2NA 3WYDA 1U3TA 4MWDA 4DJEC 2C5SA 4BDSA 1IEQA 5KDDA 5DTQA 3IIMA 1J99A 1EXMA 1Z6AA 2GYYA 1QHYA 2CNWD 2JCVA 3E05A 2I4NA 3FAZA 3MSCA 1WG8A 3H5IA 4I1YA 2DFLA 2D1TA 4JLSA 2NQ8A 4K9DA 1O94C 3Q7RA 4NI5A 3I4LA 3R3UA 3AM1A 1E9CA 4GIBA 4B2YA 4KAAA 1NKVA 2HB6A 2PEZA 3L7NA 3I2GA 4MW1A 3GX1A 3V4VB 4KREA 2GN4A 2J48A 4YRPA 4ZFNA 1BS2A 3AU8A 2CJYA 2BFCA 5DT9A 1ZW1A 3ZD9A 3QKTA 4BKPA 3O4FA 3SEZA 3U5ZB 2H7YA 4BQPA 3IX7A 1SOWA 1NIPA 3II6X 4Y7CA 1LC0A 2WFLA 4PX3A 5KOIA 1NSFA 1Z07A 1XJWA 1AIPA 1RADA 2VPQA 4U2EA 5EP2A 5EQDA 2J33A 3GOQA 3IBFA 3EF3A 2EZTA 3EUFA 3PTZA 4G2NA 4UXHA 5B7GA 1SCDA 2AG1A 2PCLA 1YZYA 3GARA 4BXOA 1Y4DE 3AB3A 3B51X 4R3WA 4WKNA 1VCNA 3RS9A 4AO6A 3C3PA 1N32B 3WC4A 5DNVA 3HUDA 3UT5B 1IQPA 2OHHA 3HRKA 3P0FA 1TC1A 1JDZA 2PANA 3LW8A 3UA3A 3ZOKA 4C0LA 2GMWA 1VIMA 4XXHA 2BJWA 3MB5A 4DJAA 1DC5A 5F52A 1E4YA 1ENZA 1TYEB 5LN1A 4LA4A 4TROA 2V3CC 4GEGA 2WF9A 4KH0A 1L9XA 5F78A 4OHYA 1W59A 1WIWA 1EIWA 5ALNA 4DV6B 3EVCA 3TRIA 1JXMA 1UMKA 5CDUA 10MHA 1UBNA 2PTGA 3CNHA 1SCUB 4UARA 3C0KA 2JH3A 2K7FA 1GDTA 3COVA 1Y98A 1SC6A 2PKXA 4RTJA 3DO6A 1V25A 3Q12A 2Q4BA 5DTRA 4MW9A 4X20B 2OV1A 1EZZA 1Q0LA 4PLYA 1QQAA 4KX3A 2G63A 3F71A 2GZDA 3RSHA 5EVJA 4FWIB 2R8ZA 3I5MA 2OSVA 4W5OA 1WU7A 2C1EA 4JBHA 1BN6A 4JOBA 4NU5A 4WA8A 3UFXB 3ZS9A 5CEJA 2O07A 1OWPA 4I36A 4YJFB 3FYDA 1KOFA 4LNUB 2W58A 4R2KA 4XX0B 1YQTA 4NCBA 5C80A 7ADHA 1XLUA 1TCBA 2B36A 1ZOSA 2FX3A 4L57A 3REOA 1Q50A 4OU5A 5JWOA 4E21A 1JVNA 4RBNA 2OGWA 3WSVA 2B2XA 2J6BA 4KK3A 4NP6A 5HR5A 1DRVA 1O08A 4NU0A 3MWLA 1PQYA 4UUBA 3FFAA 1C3JA 3SJUA 5CVCA 4HUJA 5AW2A 3DFFA 2Z6UA 2PTHA 2GJ8A 1VA4A 1XWIA 4FBMA 3I09A 3MJRA 4PCAA 2IPOA 3M6LA 3KQHA 1INLA 3JYOA 4EYOA 2LXNA 1YI1A 4PO1A 3FPFA 2VZLA 2V3WA 5AP9A 1CVRA 4YUWA 3TTYA 3MCZA 4INOA 2HJGA 4MR7B 3NTLA 3I5AA 4NIMA 3WNZA 2EP8A 3A0UA 1Z25A 4XUEA 3DB2A 1SUSA 3R0XA 3RIHA 3ZWVA 5EJAA 1Q95A 5BN3A 5C0OE 3AETA 3TQTA 5HWSA 3ECCA 4IFBA 2I4TA 1JWLA 1NHGA 2POCA 3N2KB 3EXG1 1RC1A 3CLSD 1IPEA 3HKEB 2Z9DA 3EFOA 1UJ4A 3ODGA 3O2QB 4IVNA 3BHMA 3A2KA 1Q11A 3B1WA 1KJQA 2NYUA 3C3YA 4EW1A 1Z3IX 3VSCA 4WZBA 1F8XA 5CNIA 3DMRA 1YNOA 1RQLA 1E94E 1SO8A 2F9MA 3GVXA 5EUMA 1TK2A 4P4TA 3L7KA 2P3LA 5EJGA 5T6MA 3CLRD 2CWWA 1OFHA 2AN4A 1G3MA 2BDEA 1YFZA 2Y99A 3QBVA 4JR2A 4BVBA 4BHTA 3OM0A 3KC2A 3O74A 2XB6A 4RELA 2Q0XA 1TZBA 5LQUA 4EFNA 2IH2A 4R9VA 3SFVA 1PR6A 1OBFO 1VYVA 4CF6A 4RKEA 4AO8A 2C8JA 1PGPA 1SC4A 4G24A 3DE6X 3LIIA 3RYFA 1H2XA 1P2TA 2AG6A 4G0XA 4R6XA 4XWYA 4N76A 1EVIA 1AQ6A 3B82A 2IYQA 2Z04A 4JUFA 3HJAA 4Z8YA 4KR3A 5IVIA 1YZVA 5JAUA 5AXDA 2WC1A 2RGRA 1A1SA 4ENUA 3R7BA 3UPUA 1PNVA 1ZPDA 2VYFA 3R6GA 1N5LA 1YZ3A 3W4IA 5IM4A 2AQIA 3KPJA 3STTA 4BCDA 3OEYA 2H4YA 4OMDA 3DMFA 4QU5A 5ALSA 4F5EA 3C7KA 4O5OA 4QFBA 4TYPA 5EIWA 5JWRA 5JYCA 5CT9A 3CNQS 2GN0A 1RABA 3MWDB 1JR3D 1VKOA 4NYJR 3KZVA 1Y80A 3GT7A 5E1BA 4AMBA 5B1SA 2J09A 3OX3A 3T0IA 1XWWA 3G5AA 4CKBB 3DHNA 5BRNA 1EUCB 4U8HA 2X76A 2Q4TA 2YQ5A 3JRXA 2WYVA 3ETNA 4RQTA 3PR2B 4QGSA 1H8HA 1NJSA 2VKTA 4B5LA 2WKPA 1MT0A 1YIAA 4FIZA 1CUDA 4Q82A 4UHBA 5JDIA 1MZPA 3PFNA 1VE5A 2R7AA 1Q12A 1QV6A 4GLJA 1MB3A 2A5YB 3DNFA 5I9MA 5IJ9B 2O57A 4YGYA 1AQLA 4ZT6A 1SHZA 4OHBA 3KR0A 4WLEA 3WL3A 1XU4A 3KQVA 1T9AA 1BA3A 1Z28A 4JL5A 4N01A 2PHZA 1T0JB 2G8NA 3ILYA 4R1NA 3CCBA 4S24A 3SIRA 1OTYA 5DK4A 3LUKA 1NDHA 3DD5A 1RACA 1W1WA 3NHWA 4TV8B 4ZYXA 1KAQA 3CCFA 3H2GA 3SF0A 2VT7A 5M04A 4OA5A 2IHUA 4OSPA 1POXA 4C0JA 2ATEA 3NANA 4PLHA 5I48A 1JG7A 2DQKA 2PZMA 1NVTA 1NBME 1TT5A 2HBQA 3HCBA 2WP8J 2QPAA 4NL4H 4UU8A 3W7VA 3KSDO 4IIGA 2Q2WA 4X5OA 4XYGA 4F1WA 2W4IA 1H66A 5H16A 2CJXA 3U4CA 3OC0A 1ULSA 1N3LA 2J9GA 5DLYA 3QFHA 3ZE1B 2NADA 1LY1A 3UK0A 4BVFA 4EPRA 1QIJA 3QBDA 2PSDA 4D3ZA 5CT4A 3W90A 3QSGA 5A4MS 1XTUA 2P0YA 1WNTA 3A1SA 3IKMB 1MTOA 4TMKA 4M60A 2QD1A 4X6YA 4PSVA 2NAFA 2Y1CA 3BEDA 2YZGA 1U9IC 2D3TA 5DZSA 4BB0A 2PLNA 4QFMA 4RHYA 1Z2OX 4M1OA 4UHFA 1K98A 4WNAA 1XE3A 3T4XA 5KU1A 2C96A 2JKVA 3B5EA 4N0DA 3PNYA 1YZLA 1Z0FA 1ZISA 2RG7A 4I08A 4EGFA 4D6XA 1IN7A 3KL4A 4CNBA 2DPMA 1P74A 2WJIA 2YMMA 4P4SA 1Z08A 5KOJA 1O89A 4DV2B 3ICOA 3ZJYA 5ER9A 4KQWA 5AI8A 3DUWA 3L92A 2G76A 2HGZA 2XQFA 3IXMA 1LTKA 3SXPA 4BB6A 2ECOA 2EP7A 1LNQA 4D4LA 1JV2B 3RRMA 3RT9A 1QE0A 1O9BA 3AIIA 3H17A 1L5SA 5G53C 3R7SA 3KXLA 2AIRA 3GRCA 4N39A 3AYZB 3BRSA 4I9NA 3U3ZA 4O5AA 4D4IA 4IWXA 5F1OA 5KS2A 3QVSA 2G82A 4TKLA 1VJGA 4E30A 3AGQA 2ZUEA 4BLWA 3LPNA 4G37A 4X90A 1XTRA 3IO3A 4BNGA 2G9UA 1XIVA 5A4AA 3NT4A 3FGNA 3ULKA 4HEQA 3X1XA 2P9EA 1KETA 1KY3A 4YRIA 2R9VA 4AO7A 3O3NB 4U7DA 3QKUA 1V43A 1NBEA 3H04A 3SDZA 1FP1D 521PA 2ZWAA 1GR1A 2DUNA 3ZKWB 3PWKA 3H2HA 5DM70 1FDSA 4G5RA 3VZQA 3G2NA 2EWVA 4I9HA 3WK8A 1GG8A 3GEDA 1T1IA 1ZAYA 3G88A 3SN6A 1P29A 2JAHA 1U3UA 3BUSA 4UE2A 1TTTA 5F3WB 3RUHA 2P9FA 2ZS8A 4TN1A 4JI8B 4YHHB 2YVUA 3PDUA 3ICCA 6PFKA 4PNZA 1T9BA 2AYYA 4UQPA 4B1FA 2HU7A 2WJPA 5F98A 4RANA 2NO6A 1GU7A 1N1MA 1NRXA 4K3VA 4K26A 4U9IS 2DPLA 3WI7A 3SNHA 3WWOA 3DL4A 4D82A 2OT3B 3K31A 3OQBA 2G17A 1XQYA 3O4HA 1T3TA 3QKIA 3MELA 4BVLA 5DBHX 2VJNA 3ENWA 2HTFA 1I2DA 4K6MA 3DL7A 5G0UA 5T8KA 1BXGB 1E0KA 3E7PA 2C78A 3Q2KA 2PMKA 2CL5A 3MYRA 1OWLA 3KJNA 3NB0A 1UQTA 3PA6A 4GS5A 5HK9A 1RNLA 1A8HA 1TEXA 4JC4A 3DW3X 1KDRA 2X8JA 4AZWA 4BVEA 1K92A 1MH1A 4OKNA 4RULA 3T5TA 1GLNA 1FU4A 2AJLI 1A2QA 2PYZA 1A97A 3IESA 2WQ6A 3JAWA 4CMKA 1C3VA 1KYZA 3MAGA 4PPQA 1GUFA 2Z6QA 1O5IA 4HHEA 4NG4A 4N7JA 3FB4A 4X61A 1N7JA 4L27A 3LM8A 4WOKA 1J7KA 1SVLA 3QPBA 4MJ7A 4ETNA 5JJIA 5AI5A 1VIDA 2BFFB 5CYOA 2DFDA 2VRCD 5AK6A 3QXXA 4M36A 1MH9A 3BJIC 1D03A 4IR7A 1TIKA 1P60A 1XZDA 2ISSD 3G23A 3BAFA 3PZBA 4BYMA 3RBZA 5MF6A 2QP9X 1FSZA 4LRTB 3AHEA 2FWRA 2GNOA 2N1MA 3I23A 4A8JA 4E09A 4J7UA 2SCUB 3MMXA 3WRYA 4AS1A 1ZK0A 1FPQA 2EF0A 2LIVA 2PXAA 3EIXA 1NZDA 2Q1SA 1M74A 3G9XA 3E5HA 3OLWA 3VMMA 1OXUA 3O03A 4OFZA 4PHFA 4PR3A 4Q4JA 5EXTA 3IVMA 2PWYA 3WS7A 1O3YA 1GKUB 1E6UA 1JL3A 2V65A 1B0ZA 4BNTA 3B20A 4DR6B 2EP5A 1X8JA 3LUDA 1EWYA 4M53A 2MYNA 2AC4A 1QC5A 3B53X 2G9RA 2PJZA 1OJ7A 2QTRA 5ADVA 2ZUFA 3HN6A 3KUXA 2WWIA 3G89A 4MVJD 1SIWA 2XE8A 4L8FA 2CN1A 4WINA 3R0ZA 3VJLA 4DIDA 2HXGA 4B8WA 3ABRB 4ALLA 3EDQA 4LOHA 1QQ6A 1XCJA 2QE7D 4JZYA 5LBIA 3FTPA 2WM3A 5CAEB 4XR4A 1A71A 3CH5A 2YV4A 3IEVA 4GXNA 1FY2A 1PUIA 2GVNA 1Z4MA 2BIFA 4WTOA 3W2HA 3QW4B 5K7SA 1EUYA 3VNVA 3GBSA 2H65A 4R98A 5ALGA 1N3BA 1T2EA 1J5PA 1EFVA 3ET4A 4Z0HO 4D92A 2NVUA 4KAFA 2XHZA 5AVWA 4YAFA 1DQPA 1MB9A 4GP6A 4CBVA 5HKKD 1IM2A 1UPAA 1XRMA 2C9CA 2VDWB 4L08A 3NVAA 3MLBA 5AM3A 1N2GA 4O1HA 4PTZA 1BRTA 2ATVA 3F7NA 3A28A 3B3QA 4V0OA 4JLAA 5DRYA 3V00A 1L4KA 2QSYA 4ESOA 1TYZA 3AKDA 6YASA 3L07A 1RXUA 1QFYA 3B3AA 2BM9A 2R1VA 2FDCA 4KXUA 4TTAA 3QLTA 1LPSA 2IP2A 2OFWA 2GB4A 2ZULA 3HZZA 1B43A 1EK2A 2XMSA 4CHTA 5CA0B 1AMNA 3L06A 4CR6A 3VJMA 2AJ8A 4DNFA 3U44A 5A5FA 1NXPA 4PN7A 2FFRA 3FOZA 5IDQA 5LB2A 2QSZA 1HYEA 3SSAA 1T13A 3PQ8A 1M6VB 5CLJA 2P2SA 3ER9A 3NLLA 4CMAA 4G1UC 1ZMXA 3G0IA 1IQ0A 1U2RA 1V1RB 2B8WA 1XLTA 1YR3A 1RQNA 2D3WA 2P2GA 2RB5A 1L8LA 3AM5A 3NOQA 1AD2A 1HQDA 2J9YB 1CY8A 2VC2B 3AUXA 3S40A 1E1RA 4I2NA 2X9VA 3EZ9A 3JARA 4GH5A 4B3TB 3PF9A 3DTYA 5AKXA 1WWKA 2WF7A 5B53A 2C7BA 3CT6A 4WY2A 3T06B 2IFTA 1PN3A 5JO0A 1NRJB 4K8OA 4MUYA 3SF8A 4GLBA 1E9BA 4D81A 4LZLA 3JVVA 4YMHA 1ADYA 3FHJA 4B74A 3AF2A 1D7OA 1P0MA 5TGDA 2HY7A 2J3KA 1GARA 2AN3A 1XD9A 4XWOA 4D41A 4DMUB 4XSGA 5BYAA 5JW6A 4PIPA 1PJ4A 3GZ4A 1D7AA 1XV5A 2WUVA 2XNHA 3Q3JB 3TH5A 3TR6A 2IBSA 2UXDB 4ER6A 4F3NA 3UPDA 4LRYA 2G28A 2QPOA 2X3UA 1CS4C 3ED5A 3AHJA 2TS1A 4RHFA 4W5JA 1PAUA 1R4NB 2EFEB 4Y9SA 4N03A 2V6BA 1Y8AA 2CXTA 1J0EA 3VR6A 3OETA 1KDTA 1IY8A 2IXBA 4GM4A 3TLCA 4R0MA 2CNBA 4J3JA 4X7MA 3A14A 3GFRA 1A5SB 4ARSA 1Z17A 2WSBA 1G2QA 2XLBA 1T5DX 2ZI4A 3NHPA 3NASA 1L7BA 3AWIA 3QE0A 4G5YA 3D3NA 4G81A 4GKVA 5TQ2A 1EQUA 1XMOB 1M66A 1MJ5A 1PQPA 4GM0A 3HVUA 2B5OA 3KR9A 4OU4A 5E7QA 2GF9A 2AC2A 4TYNA 4Q24A 1HE2A 2NO5A 1ZI6A 1NBOA 4B7CA 4BX2A 1GPH1 1K7FB 4ZCMA 3LY5A 1X2BA 1BQ3A 2J3EA 1PQWA 4XPIA 4MDHA 3BT7A 1B0AA 4GVPA 2FZCA 2FW7A 1F8YA 4Q3DA 3TR0A 3HDVA 3O0DA 3ZU4A 3V8RA 2VHZA 3OZEA 2JIZA 3RRBA 2I6FA 4KFUA 1PYGA 4WA7A 2YW2A 4KPYA 1C1XA 1VXRA 3DJFA 1G7CA 1GXSA 2WWHA 3LQ4A 5FTKA 4XFKA 1JMKC 4BLSA 3ND8A 5BORA 4L16A 4M0LA 2ZROA 1DHRA 1SBYA 2FZGA 3CEHA 1ODIA 2C2XA 2SNIE 1DKOA 3L1UA 5EZ5A 3HCWA 5JRZA 3THRA 2CDBA 3S99A 3TE7A 5BSMA 5C8DA 3L93A 4OHRA 4Y6SA 1OX4A 1F2VA 4ARCA 2ZTSA 3AM3A 1LQTA 4GRDA 2Q99A 1D4ZA 3AUAA 2WA1A 4TM8A 3H11A 4DANA 5B4UA 1TC2A 3Q8KA 1SBZA 3GNSA 1VMEA 2W2KA 4KGZA 1Q1QA 1AN9A 2IYPA 4MI9A 1JKMA 2E6KA 3UV6A 1T6ZA 4K5QA 1C9JA 1ZOIA 1QRUA 3VR1A 121PA 3DEFA 3TFQA 1D2NA 1WZ2A 3EDOA 4NBSA 3V1NA 3BL8A 1PO7A 2DG2A 3LXRA 2CK3A 3WLNA 1EK1A 3BORA 2CVQA 4YREA 4QX6A 2OM6A 3QU4A 2EL7A 1XFDA 4OM8A 2LIPA 3FIJA 1P62B 4OHOA 3G2IA 4BVAA 3TDKA 1SVKA 2B8JA 4CQMA 1C7JA 1G3UA 1WHTA 4KO2S 5KX5A 3I6QA 1HR0B 3M9WA 2Q2VA 3MBIA 3EIFA 1E3MA 1Z75A 4R8KA 4D80A 1N5JA 5B6IA 3MGAA 1DT3A 4YALA 4U0JA 5B7PA 5C8VA 4CQNA 1R6XA 4CKEB 1S8NA 2XUPA 2HJHA 2PXHA 3GWZA 4GAEA 2C3YA 3TMYA 1T2UA 4GE0A 3DVSX 4QTXA 5DLQC 3DE3X 2H8GA 3O8LA 5P21A 3TLXA 2IUEA 1ICEA 5KNDD 4WXMA 2WJYA 5E4JA 1OIVA 1TUEA 3UWSA 2ZVQX 2YXBA 3CZMA 2YMPA 4Y2QA 5FWYA 3H16A 4TS1A 2P41A 3CQ9A 3BDIA 5A3SA 5DBIA 1IHDA 1NQ5A 2C8VA 4ZCRA 5KKAA 5KCMA 3DL0A 3ZHYA 1Z6GA 4OHFA 3A27A 2BTQA 4EHDA 4C89A 2VJMB 2X9GA 1LX7A 2C00A 2VP6A 2ZBRA 2IIPA 4GXTA 4RTPA 4YJ3A 3ERCA 3HB4X 1W88B 4IEEA 4HXFB 3QTBA 3TIVA 5F9FA 2JLVA 4X7RA 5FULA 2VJLA 4C0QC 4XJTA 4HSGA 3BSYA 4RXUA 5TT1A 2QZ4A 2FN9A 2RAFA 3L6DA 3PC8C 3U26A 1RWKA 4TTTS 4Q9JA 3HBLA 2UAGA 3OPYA 4HDKA 4ZVLA 2HWYA 1NU8A 3DPSA 2ZYDA 3TWOA 1E6CA 1QRRA 1ZQ9A 2H59A 1DBVO 2DQYA 2JFFA 2MOKA 2WE8A 3C98A 3HDHA 2WMOB 2PUEA 1E1LA 2B9VA 1UJ5A 3SQWA 1HYHA 1LKZA 3OEED 2DAPA 5TVKA 4LRQA 4V0NA 3L7YA 1JHVA 3R7WA 5KWVA 4REOA 3GLIE 2IX3A 4DA4A 3E8XA 3ZQ4A 4KVAA 5ALPA 3A6EA 2LE0A 3RFFA 5TV2A 2YINC 4TQUS 5D2CA 2OSBA 1MNAA 3C97A 1YCGA 2HSWA 2I6QA 3O93A 3OE5A 1UZNA 1LDEA 3FSRA 4W5RA 1JGTA 2GD1O 2ZSIA 1Q0TA