5EJHA

Crystal structure of nad kinase v98s mutant from listeria monocytogenes
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
263
structure length
259
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKSSYPLLKTTVKYKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NAD kinase 1 from Listeria monocytogenes: V98S mutant
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords NAD kinase 1
total genus 71
structure length 259
sequence length 263
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5ejhA02
1U0RA 2AN1A 2I1WA 5EJGA 2I2FA 3AFOA 3V8PA 5EJHA 3V7WA 1Z0UA 1Z0SA 1U0TA 5DHSA 2I2AA 3V7YA 2I2BA 1Y3IA 1Z0ZA 3V8QA 5DHUA 3V7UA 2I2DA 3V8MA 5DHPA 1SUWA 5EJIA 5EJFA 1Y3HA 1YT5A 4HAOA 2I29A 5DHQA 4DY6A 3PFNA 5DHRA 2I2CA 3V8NA 3V80A 3V8RA 5DHTA 2Q5FA
chains in the Genus database with same CATH superfamily
1K2MA 4R9PA 1DMZA 1YJMA 3OUNA 2JGRA 1J4OA 1K2NA 5C4VA 4D9VA 5DJOA 2KB3A 1J2FA 5JERA 1WLNA 1G88A 5JELA 3VZBA 1Y3IA 1ZOQA 2P1RA 4A4YA 1J4KA 3V7UA 2QV7A 5DHPA 1SUWA 3I0NA 1Y3HA 4HAOA 2AFFA 5A8IA 1J4LA 5DHQA 4DY6A 5DHRA 2JQLA 4JONA 4L02A 1UJXA 1GXCA 1QWTA 5EJFA 1MR1A 1U0RA 2AN1A 5EJGA 1K3QA 1J4PA 1MJSA 1LGPA 3V8PA 1WV3A 2EH0A 4H87A 5EJHA 3HX1A 1R21A 3DSHA 3KT9A 4QCJA 1Z0SA 1KHUA 3ELVA 3V7YA 3VA1A 1Z0ZA 3GQSA 1KHXA 3UNNA 2A0TA 1U7FB 2I2DA 3V8MA 2KB4A 2QVLA 2KFUA 3I0MA 3VA4A 1FHRA 1J4QA 2I29A 1K3JA 1YGSA 2JQIA 1MZKA 2W3OA 3UN0A 1QU5A 3T5PA 2XT9B 3V8RA 2G1LA 2PIEA 2I1WA 3AFOA 2JKDA 4A0EA 4EJQA 3PO8A 1U7VB 2I2AA 3POAA 5E50A 3DITA 4WRRA 1K3NA 1FHQA 3I6WA 1MK2A 2BONA 3HUFA 5EJIA 2FF4A 4WERA 1YT5A 3S40A 4JIVD 2CSWA 3I6UA 2JPEA 5BVIA 3PFNA 4EGXA 1U7FA 3V8NA 2BRFA 2LC1A 3A77A 3UNMA 5DHTA 4G2SA 5JEKA 3ELSA 4KU0D 2FEZA 2I2FA 5JEOA 1YJ5C 4JIWD 3GMJA 3V7WA 3VZDA 1UHTA 1Z0UA 1U0TA 5DHSA 2JQJA 3VPYA 5JEMA 2I2BA 3VZCA 3HUEA 4V24A 3UV0A 3V8QA 1U7VA 2KKLA 5DHUA 1G3GA 1DEVA 3FM8A 5JEJA 3MDBA 1DD1A 2I2CA 1LGQA 3V80A 1G6GA 3UOTA 3UMZA 2Q5FA 2XXSA
chains in the Genus database with same CATH topology
1U0RA 2AN1A 2I1WA 5EJGA 2I2FA 3AFOA 3V8PA 5EJHA 3V7WA 1Z0UA 1Z0SA 1U0TA 5DHSA 2I2AA 3V7YA 2I2BA 1Y3IA 1Z0ZA 3V8QA 5DHUA 3V7UA 2I2DA 3V8MA 5DHPA 1SUWA 5EJIA 5EJFA 1Y3HA 1YT5A 4HAOA 2I29A 5DHQA 4DY6A 3PFNA 5DHRA 2I2CA 3V8NA 3V80A 3V8RA 5DHTA 2Q5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0R A;  2AN1 A;  2I1W A;  5EJG A;  2I2F A;  3AFO A;  3V8P A;  5EJH A;  3V7W A;  1Z0U A;  1Z0S A;  1U0T A;  5DHS A;  2I2A A;  3V7Y A;  2I2B A;  1Y3I A;  1Z0Z A;  3V8Q A;  5DHU A;  3V7U A;  2I2D A;  3V8M A;  5DHP A;  1SUW A;  5EJI A;  5EJF A;  1Y3H A;  1YT5 A;  4HAO A;  2I29 A;  5DHQ A;  4DY6 A;  3PFN A;  5DHR A;  2I2C A;  3V8N A;  3V80 A;  3V8R A;  5DHT A;  2Q5F A; 
#chains in the Genus database with same CATH topology
 1K2M A;  4R9P A;  1DMZ A;  1YJM A;  3OUN A;  2JGR A;  1J4O A;  1K2N A;  5C4V A;  4D9V A;  5DJO A;  2KB3 A;  1J2F A;  5JER A;  1WLN A;  1G88 A;  5JEL A;  3VZB A;  1Y3I A;  1ZOQ A;  2P1R A;  4A4Y A;  1J4K A;  3V7U A;  2QV7 A;  5DHP A;  1SUW A;  3I0N A;  1Y3H A;  4HAO A;  2AFF A;  5A8I A;  1J4L A;  5DHQ A;  4DY6 A;  5DHR A;  2JQL A;  4JON A;  4L02 A;  1UJX A;  1GXC A;  1QWT A;  5EJF A;  1MR1 A;  1U0R A;  2AN1 A;  5EJG A;  1K3Q A;  1J4P A;  1MJS A;  1LGP A;  3V8P A;  1WV3 A;  2EH0 A;  4H87 A;  5EJH A;  3HX1 A;  1R21 A;  3DSH A;  3KT9 A;  4QCJ A;  1Z0S A;  1KHU A;  3ELV A;  3V7Y A;  3VA1 A;  1Z0Z A;  3GQS A;  1KHX A;  3UNN A;  2A0T A;  1U7F B;  2I2D A;  3V8M A;  2KB4 A;  2QVL A;  2KFU A;  3I0M A;  3VA4 A;  1FHR A;  1J4Q A;  2I29 A;  1K3J A;  1YGS A;  2JQI A;  1MZK A;  2W3O A;  3UN0 A;  1QU5 A;  3T5P A;  2XT9 B;  3V8R A;  2G1L A;  2PIE A;  2I1W A;  3AFO A;  2JKD A;  4A0E A;  4EJQ A;  3PO8 A;  1U7V B;  2I2A A;  3POA A;  5E50 A;  3DIT A;  4WRR A;  1K3N A;  1FHQ A;  3I6W A;  1MK2 A;  2BON A;  3HUF A;  5EJI A;  2FF4 A;  4WER A;  1YT5 A;  3S40 A;  4JIV D;  2CSW A;  3I6U A;  2JPE A;  5BVI A;  3PFN A;  4EGX A;  1U7F A;  3V8N A;  2BRF A;  2LC1 A;  3A77 A;  3UNM A;  5DHT A;  4G2S A;  5JEK A;  3ELS A;  4KU0 D;  2FEZ A;  2I2F A;  5JEO A;  1YJ5 C;  4JIW D;  3GMJ A;  3V7W A;  3VZD A;  1UHT A;  1Z0U A;  1U0T A;  5DHS A;  2JQJ A;  3VPY A;  5JEM A;  2I2B A;  3VZC A;  3HUE A;  4V24 A;  3UV0 A;  3V8Q A;  1U7V A;  2KKL A;  5DHU A;  1G3G A;  1DEV A;  3FM8 A;  5JEJ A;  3MDB A;  1DD1 A;  2I2C A;  1LGQ A;  3V80 A;  1G6G A;  3UOT A;  3UMZ A;  2Q5F A;  2XXS A; 
#chains in the Genus database with same CATH homology
 1U0R A;  2AN1 A;  2I1W A;  5EJG A;  2I2F A;  3AFO A;  3V8P A;  5EJH A;  3V7W A;  1Z0U A;  1Z0S A;  1U0T A;  5DHS A;  2I2A A;  3V7Y A;  2I2B A;  1Y3I A;  1Z0Z A;  3V8Q A;  5DHU A;  3V7U A;  2I2D A;  3V8M A;  5DHP A;  1SUW A;  5EJI A;  5EJF A;  1Y3H A;  1YT5 A;  4HAO A;  2I29 A;  5DHQ A;  4DY6 A;  3PFN A;  5DHR A;  2I2C A;  3V8N A;  3V80 A;  3V8R A;  5DHT A;  2Q5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...