5EKDA

Human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
327
Chain Sequence
KKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of Mg2+ATP Enhances Inhibition of Human Mitochondrial Tryptophanyl-tRNA Synthetase by Indolmycin
rcsb
source organism Homo sapiens
molecule tags Ligase/antibiotic
molecule keywords Tryptophan--tRNA ligase, mitochondrial
total genus 110
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 5ekdA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5ekdA01
2CV2A 1VBNA 4J76A 4PBSA 1GAXA 1KQOA 2JANA 3MLBA 1QQTA 5IJXA 3IVCA 4NX2A 3Q4GA 4R2LA 1X8XA 5LFAA 2CV0A 4GRIA 1J1ZA 1YUNA 4MVCA 1XJQA 1O96B 4MWBA 3ZUGA 1FFYA 4ZCPA 2I1LA 1WKBA 3FDXA 3UK2A 1O5TA 4MULA 4KR9A 3K32A 3NBAA 1J1UA 4EFKA 4EG3A 4NAUA 3TZEA 3LCJA 1NZJA 2QUHA 3KT6A 1YIAA 1OWNA 1J70A 4PY2A 3UMVA 3CLTD 3AIIA 3BL5A 2CUZA 3QTTA 5IHXA 3PNVA 3SP1A 4X0EA 5TEVA 1PFWA 1NI5A 2CT8A 3D6UA 3L93A 4WNYA 3VGJA 1H3NA 2QJFA 3H9CA 2CSXA 1EJ2A 2IJGX 3X1KA 4CQNA 3NV7A 1NUPA 4I6GA 3X1MA 1M8PA 3F3MA 4UZEA 2YXNA 1PFUA 1OD6A 5DEOA 1JMVA 1LI5A 2QJOA 1J20A 4P2BA 1JEEA 1CT9A 2GM3A 3N05A 3AG6A 3A2KA 1NYLA 1O0CA 2DPLA 3ZXSA 3SZGA 1WXIA 4ZT3A 2RE8A 1WQ3A 4MVWA 1OBCA 2VTBA 1OWPA 4KR6A 5KCMA 4MUGA 2QTMA 2AZXA 3TQOA 1VL2A 2EL7A 2A1UA 1QU3A 4R2MA 2YWCA 3FNRA 2X1MA 2EJCA 5J59A 1D2RA 5K0TA 1PG0A 2A1TR 4G5YA 4RUKA 4DLPA 3CVXA 1G8FA 4XFJA 4A91A 1KH2A 4EG1A 1JZSA 3SYTA 3CVUA 2HGZA 3U1VA 1N1DA 4MUNA 4ARIA 4U8HA 2CYAA 1IHOA 1G8GA 2QTNA 3A4IA 1JZQA 1LI7A 1K4MA 5J58A 2A1UB 3IH5A 1U3CA 4NDAA 1Q15A 1MAUA 4EG6A 3ILVA 1H1TA 2JAXA 4OJMX 1N77A 3CLSD 1RQGA 2PZ8A 3CVWA 4EF6A 3ZJVA 1WY5A 3NBKA 1NURA 1XNHA 5TS2A 1XNGA 3UY4A 1PG2A 2DXIA 1KH3A 5F23A 4KKVA 3A04A 2O8VA 1A8HA 2XRYA 5K0SA 5HUHA 2PXHA 3MUEA 3A05A 2OQ2A 1YULA 4FZJA 1GTSA 2Z3VA 2AKEA 1IH8A 4ZCRA 1M8JA 2NZ2A 1MOPA 3KFLA 1IQRA 2V0CA 1SURA 4MW6A 2GOYA 1KP3A 2J08A 3SZ3A 3HL4A 3INNA 3ND6A 2CYBA 2R5WA 1GZUA 2BYTA 1YIDA 1KQPA 1O6BA 1K92A 5HUJA 1Q19A 3CLRD 2QUKA 2B7LA 1N75A 4DDKA 1UFVA 4U63A 2J4DA 1YUMA 3E27A 2D54A 5H16A 3Q10A 4TS1A 1COZA 1TYDE 2AG6A 1Y42X 1IVSA 4KR7A 1NUQA 1T6XA 3ZIUA 3AFHA 3L92A 3TS1A 4L2IB 1JIKA 1QRUA 1GTRA 3TNJA 2DEUA 1O95D 3K9WA 3VU8A 1KP2A 1G59A 5JBNA 3HZRA 1VBMA 4J75A 1O97C 1MJHA 4MAFA 4EG8A 3PRHA 2YWBA 4ZT5A 1JIIA 1IQUA 1M8FA 1N2IA 1K97A 5KHAA 1GPMA 3FY4A 4PBTA 2A84A 4MW2A 1T9GS 4ZT4A 2WB2A 1U7XA 4DDHA 1J21A 1IQ0A 1NUUA 3FH0A 3H97A 3N8HA 4CDMA 3HV0A 2A88A 3ZGZA 4ZT7A 4Q93A 1EXDA 1EUQA 1JGTA 4MUEA 3QE4A 1NSYA 4XSVA 3X1JA 4YP6A 1EFVB 1QJCA 1IFXA 3IMCA 4DJAA 1EFPA 3GLVA 3CLSC 3IVXA 3MXTA 1O97D 3D6VA 3OTWA 1O0BA 1NP7A 4YP5A 2J5BA 3IOEA 3IDFA 3ND7A 5H7XA 4NAHA 1OWMA 3H9BA 2DUMA 1PFVA 1MAWA 3FG9A 2CYCA 2WSIA 2XRZA 3ZJUA 1ZJWA 4MW5A 4ZT2A 1T6YA 1LW7A 2JA2A 2X3FA 2A4MA 3G59A 3ELBA 2Z09A 1O94C 4ZCSA 3ZXIA 3G5AA 4MUFA 4QREA 3KT0A 5DASA 2O5RA 3COYA 1XNJA 3IMGA 2RD2A 4I6EA 4EG7A 4MWCA 3IOBA 5EKDA 3ISJA 2QJTA 3FI0A 1P7PA 3CA8A 4NATA 3DPIA 3PXUA 1TFUA 3CLRC 4K0RA 1YI8A 2C5SA 3DV2A 1Q77A 4HJXA 2YY5A 1J09A 2E0IA 1IRXA 3SEZA 1R6XA 1G8HA 4NZPA 4S1OA 4XFDA 1U0BB 4R0NA 3GUZA 4F4HA 2PFSA 4DDMA 1QTQA 4YMIA 4EG5A 4HJRA 3RFFA 4EGAA 1MB2A 2DLCX 3N9IA 3TZLA 1O95C 4YBRA 3MLAA 1F7VA 1GLNA 2D13A 3COWA 2OV4A 1T9GR 1TYCA 2H2AA 3AG5A 3FETA 4G5FA 1JIJA 4AQ7A 1KKUA 3IVGA 4MLPA 2A86A 5AHWA 4WSOA 4DE5A 3P0IA 2QUIA 1EFVA 4H3SA 1ZH6A 2TS1A 1T6ZA 3TQIA 1WZ2A 5TEWA 4MQ6A 1WXGA 2VXOA 3VRHA 3IMEA 1R6TA 4QBTA 3Q12A 3IODA 3RJZA 1O94D 1U7DA 1EFPB 2J09A 2Z08A 4HK4A 4ND6A 1WXHA 3OP1A 5LM3A 2IELA 2J07A 4BWVA 4OUDA 3FIUA 2HMAA 1U3DA 1ZH0A 4ZCQA 4ND7A 3N2YA 1V47A 1N2HA 1WOYA 3P52A 3KT8A 4E1AA 3SDBA 1VBKA 1M8KA 3HMQA 3AKZA 3HFJA 1V8FA 3C8ZA 2IP1A 2PZAA 1F7UA 3FHJA 1N2JA 2PG3A 1DNPA 4MW7A 4OUDB 4ARCA 1N2BA 3RHSA 1QRSA 4MW9A 2DR2A 4PBRA 4I6JA 4JXXA 1EE1A 1EUYA 3LE8A 5BNZA 2ZP1A 3GMIA 1I6MA 4EG4A 2X1LA 1O96A 1M83A 1JECA 2E18A 4MW0A 1NUSA 1MBZA 4JXZA 1N2OA 5J5AA 4L2IA 1ILEA 4JFAA 1FYDA 4ZCTA 3DO8A 3CVYA 1N2EA 1PFYA 3RK1A 1WQ4A 5FO0A 3CLUD 4MWEA 1Q11A 2VTBB 4ZT6A 3MMXA 4U7JA 1H3FA 3CVVA 1JEDA 2A7XA 4G6ZA 3IUBA 1OWLA 1H3EA 2X0KA 3DLAA 2DERA 1K4KA 3COZA 3QTBA 3AL0C 3ZJTA 2E89A 4MUHA 1S4MA 1QNFA 4YP7A 2BTEA 4DNXA 1BS2A 2QUJA 1KH1A 4K03A 2PIDA 3P0HA 1N3LA 4GU5A 4MW1A 4MVXA 1KAMA 1F4LA 1MRZA 3UOWA 2WQ7A 1TYBE 2H29A 5KWVA 1F9AA 3I05A 1M8GA 2E21A 1KQNA 1B6TA 1KORA 3IUEA 1QRTA 3COVA 4F3RA 3UC5A 3H05A 1KAQA 1OWOA 4CT0A 2A1TS 4MUJA 4HPWA 1WJGA 4JYZA 3HGMA 1N78A 4UZFA 3KT3A 3M5WA 1GN8A 3RBAA 2WQ6A 1I6LA 3CR8A 1WXFA 4AS1A 3IOCA 3ND5A 5FNZA 2GKSA 5HG0A 2CV1A 1ULHA 2QTRA 1N2GA 4QRDA 2D5BA 1MB9A 4CDNA 1JILA 3CLTC 3LOQA 4KPUB 1OBHA 1ZUNA 1M1ZA 4MUIA 1TYAE 5DB4A 1QU2A 3G6KA 2ZUFA 1JHDA 5DK4A 5FO1A 1NUTA 2ZUEA 3RK0A 1X6VA 2G36A 3SEQA 1I2DA 1KR2A 4KPUA 5LLTA 2PZBA 1R6UA 1MC1A 3PNBA 1TEZA 2DETA 2HZ7A 3CLUC 4Q16A 4MVYA 3PNYA 2V0GA 5TGTA 2CFOA 1TQ8A 3P0JA 4RPIA 3JXEA 3S3TA 4JZYA 1WXEA 4MWDA 3FOCA 2NSYA 4MW4A 3H99A 3FWKA 1HYBA 1I6KA 1VLHA 4MUKA
chains in the Genus database with same CATH superfamily
5KTTA 1Z7WA 2DZDA 3EGEA 3FYSA 2WK1A 4KTTE 2Z4SA 4BP9A 1ICIA 5EMMA 4GR4A 4ZI7A 4DM3A 3C98A 3QUQA 1H9BA 1KMHA 2C58A 2AGVA 2H4WA 3H5WA 3NHZA 1X39A 4MEJA 3ID6C 3UENA 3R0ZA 2FFAA 4YRTA 4MVCA 1N8SA 3IP9A 3IUJA 1BQEA 4WXEA 1UBGA 4RS4A 4TWJA 1R0SA 5TE9A 2HGSA 3MSCA 4N8DA 1P39A 3K15A 3Q2KA 3AZPA 1YCDA 1O5TA 1FVHA 3P71T 3UK2A 4W9MC 2NUBA 2R8EA 1E0JA 1E6LA 3INYA 1WCXA 1KIFA 4ZQHA 1JFFA 2FXVA 2H4JA 1NZJA 3ABZA 1VXRA 2QUZA 2QW0X 4IGKA 4URYR 2G9ZA 1OI4A 1W5BA 2OGWA 2C3YA 3C8HA 5DV9A 2YY6A 3G2IA 4RW0A 3N0WA 1NW9B 2DFKB 4RFSB 4M1OA 2FUNB 3QTTA 4H7HA 2IZ0A 3NP7A 3CKYA 5G3YA 1MW8X 1FNMA 2C04A 1HETA 1SQ0A 1XHFA 3LUAA 4PLWA 1I01A 2AN1A 3ABQB 3BXEA 1L5SA 3CO5A 3EOBI 4GYYA 4OA5A 4CEHA 1EJ2A 1YHZA 2H5LA 3BREA 2D4AA 2GVZC 3ORSA 2ZJZA 5LQKA 1DHRA 4RORA 4BZXA 1T25A 1P80A 4IIHA 4A8PA 3DZJA 5LPNA 1AXRA 1QCYA 2F4VB 1UXKA 1X7HA 4CTMA 4NMXB 1I5EA 2CFTA 3HKCB 3VKWA 1CS4C 1VL8A 2IOHA 2ORWA 4HDNA 4LBVA 4V3BA 3TW8A 4LF5B 2WF9A 1QIHA 1RWMA 3IILA 1C30B 1USWA 3RC9A 1I7SB 4KBYA 3CKKA 2HCTA 1OXUA 1FYVA 1E99A 4GMXA 5D5HA 2PMDA 5HOQA 1HLGA 3LFHA 3ZWAA 2ATCA 1GCGA 4F1WA 1XKTA 3L8DA 4HAZA 4YJ2F 4DMUB 1C9KA 5A6VA 2RHHA 2MINB 3IVRA 1KS2A 1M2FA 2FEPA 1QFMA 4H3VA 4D26A 1BQ4A 1MTOA 1NQOA 2VQEB 4LF7B 5HKKD 2X8JB 4EL5A 3NBYC 5LZ4A 1DIGA 3GRYA 3DT9A 2J3EA 2QHXA 1ZHHA 1XCPA 3HU1A 2A0YA 2VJMA 1UBLS 2WYWA 4BTVA 2CZGA 3MWDB 2BGIA 1Q0SA 2PNFA 3BTUA 2RGGA 1Z07A 4FR5A 2XXBA 3T5TA 1K88A 4QUJA 3HCPA 4I4TF 3WOHA 5BR7A 4HWSA 1XZGA 5K03A 2ID7A 4YNBA 2P0EA 3GB9A 3IAXA 1SHKA 1E1CA 3DE6X 3FA2A 4BBZA 4GPTA 4JOBA 3CVUA 4MUNA 5DGTA 4MDHA 3AX6A 1E7QA 1V7CA 3KD3A 4GLBA 4E30A 1SFRA 4J49A 3E84A 4KQJA 4R51A 5FV7A 3WGTA 3VMFA 1Q3KA 3CZ5A 2OTCA 4BFLA 3FTCA 1TRKA 1BA2A 3GIWA 4A2CA 1MX3A 1U3CA 2CJWB 2IXGA 3BTOA 1GLGA 1ZIOA 3BF7A 1FUIA 3C1AA 5TDHA 5BSWA 3DLBA 2QUAA 5K8JB 3WI7A 1CY7A 4OHUA 5ADVA 3QMVA 1BVUA 2PZ8A 3QQPA 5GONA 2IVFA 3N1UA 3W8FA 1W73A 2LZ0A 1XUOA 3BWBA 3WXMA 3PUWA 2CDBA 2G9UA 1GO2A 2H1WA 3DE0X 3ZCSA 1RBQA 4BLPA 1NOJA 5IJAA 621PA 2Z6AA 1CP3A 1E2UA 3GD5A 2FZCA 2H4FA 4B32A 1NJ1A 1SCQA 5BYBA 4LAFA 1DGQA 3NM6B 3GDFA 2YH2A 4AU1A 5ECGC 4EPVA 3G2PA 4HDSA 1YF3A 2G76A 3FGZA 4FZJA 4JYPA 1U1GA 4LZAA 4W63A 3EIOA 1UEIA 2AD5A 4MS1A 3C6BA 1SCDA 4Z1MD 2CUNA 2F1KA 2ETVA 1ZGGA 3N7TA 1SXJA 3M3HA 2NZVG 1NG1A 2N42A 3O9VA 3GLGA 4HYYA 3INNA 1VKJA 2DJIA 3HDQA 3LHDA 3QXGA 3C2QA 3VNVA 5FOUA 1GZUA 5GMOA 5ESRA 5H3HA 4LJKA 2HDHA 3K9QO 1OA0A 1QS0B 5KSWB 3NALA 3M4YA 3PEUA 3ZW7A 2PLRA 4AZWA 2B7LA 2ZRMA 2ZSFA 4JC5A 2HAEA 4NPHA 1ZA2A 2FW7A 4URFA 5LVAA 2HJHA 4W5OA 3ADDA 5K09A 1WD5A 1L4BA 3H1AA 4QWWA 1G6Q1 1COZA 4R41A 5DM60 1SULA 3HBMA 2AG6A 4YJKA 5CD9A 3KPUA 5COAA 5A62A 4S04A 4AY4A 2FFQA 3I09A 3HBJA 1D2HA 2FLKA 3ZBPA 4HX9A 4CL2A 2QI9F 4G36A 4QXQA 4R7GA 1IUKA 3IAS1 5J4VA 1YS1X 1LPMA 2A5LA 3R5FA 4J7UA 2GRAA 2GCIA 1N9GA 4WZZA 4DLZA 4HUTA 3TKLA 4W8GA 3FZQA 1TRHA 4HRAA 4YRSA 3R7WA 1GAWA 3DTYA 3MHPA 2FDRA 4K5QA 1C0LA 3JWIA 2JFOA 4XSGA 2XD4A 1W52X 2XMRA 1W35A 1C0KA 1ZUWA 2P9QA 4H1HA 4UUQA 1XYGA 2VDRB 4WLEA 4Z4FA 4X62B 2X5XA 2UVPB 3SC6A 4LFBB 3EC2A 5KHAA 1ZRNA 3S2UA 2PZGA 1NASA 4E6EA 4I66A 3AESA 1I3CA 1X7DA 3CEMA 4V3CA 1JKXA 3RU2A 4BMDA 2H1IA 3CURA 3E82A 2I9KA 3RC3A 1JJAA 2HOQA 3R5XA 1ZGHA 5DT2A 2WD8A 1X3SA 2ZJ1A 4L57A 4N0QA 2DYKA 1O4VA 1PD0A 4G5QA 5DNCA 4RTKA 2DT5A 3ZGZA 1G6OA 2H07A 1ILWA 2WIGA 3D1JA 3JRXA 4MQ4A 2G17A 2FNAA 4R8SA 3M6FA 3M6UA 2C1ZA 4BP3A 4FLEA 4IX9A 4YRNA 1E2EA 1GPNA 2X23A 3JYHA 1GGNA 1PJBA 2WVJA 4GE3A 5FTKA 3ITDA 3E2PA 3A1TA 4B87A 2DHRA 3PFKA 4UE6A 3BICA 2YIVX 2I0FA 1CEXA 3ZKWA 1KBOA 4ZZ0A 3G5MA 5FPKA 3ZWOA 4LC1A 3IPYA 4K9KA 3CEJA 2MYTA 1HYHA 2BCEA 1O0BA 4FYXA 3BFPA 3QVWA 4JJEA 2GF0A 3ABRB 2WM9B 5F9HA 2CDNA 1KJQA 1UZUA 2D0PB 4Q7EA 3VI3B 2IC5A 1H2EA 4WEOA 5J2UA 1QHHB 2EYQA 1XA3A 3HEBA 1X7WB 2FK7A 1QB8A 1FA9A 1QO0A 1EK1A 4WK0B 3W5JA 1PFVA 1LBSA 1QFSA 4HAXA 1MORA 1ZSYA 4JLKA 4O4JF 1CUAA 4NYMQ 3DDCA 2Y2UA 4ABTA 2IYLD 1HMYA 1DKNA 2J9FB 4RD1A 4DWWA 1E61A 2GK7A 1QIDA 3NKVA 4KIJA 2ZWMA 4PHGA 1CUEA 3JZAA 5JZSA 3UB4A 1CPYA 3Q2IA 2CHGA 1YDFA 2NUPA 1QQ7A 3TFWA 1FX1A 1OOEA 4GZMA 1NJGA 2WUEA 1N5LA 1WUIS 1G3IA 4RIFA 4BN5A 1M5RA 4L9AA 2O5RA 2I8AA 4GDFA 3WQBA 4QDJA 2RD2A 1U8TA 4XGIA 4GC5A 5JAHA 1BFUA 1QUEA 3IJRA 4KO8A 1CJTC 4NATA 3PXUA 1J8QA 1N6NA 3KDSE 4HGOA 2XAUA 1P2SA 4ZVNA 3IAM1 5IN5A 2X4DA 4I36A 4B3FX 4XJTA 4LDZA 4PX3A 2KQUA 3ESQA 1XP8A 3RIXA 3ECSA 3IP1A 4FQ7A 1RHUA 1TPYA 4DHEA 3GCWA 1WM1A 1EFTA 4KX3A 1E3SA 1JR3D 2V4UA 4UHCA 3TZLA 4Q3OA 3LLSA 2MHCA 3EDYA 1GLNA 3ILHA 2D13A 3L8YA 4WCDA 4TWBA 4KRFA 2V6MA 2W2QA 3NUZA 1X80B 3Q5EA 4ZQBA 3LM8A 2NU9B 3GROA 1A2BA 2BPOA 4FGLA 2ZOSA 4B73A 4Q1DA 2QZPA 4ALJA 2B4KA 2RHBA 5EIFA 3T12A 2YFHA 2PYDA 1SHUX 5K6RA 3M5CA 3IVGA 2Q46A 3N8DA 2OC4A 1QONA 4TT3D 2UVDA 4PZAA 2AFIB 1VJCA 1YKSA 4KLNA 4S1TA 3SLRA 5IXYA 5JSHA 5L3QA 2D0IA 5C51B 4GEKA 3MJRA 3TBHA 1W75A 1OXVA 1T6ZA 1BE8A 4AIIA 4OSEA 3R8CA 2VXOA 4HLNA 4E3WA 1SCAA 1FSSA 3IMEA 2Y76A 4JEHA 4QBTA 3T7TA 3OBIA 4YPFA 2C03A 4MKIA 4W7IA 2EKQA 4AN1A 4TKMA 1U11A 1KWGA 1MIOB 4J07A 4OVKA 4DQKA 5IBPA 2BGKA 1WTCA 2DH5A 2G0NA 3TB6A 3PRYA 5BV7A 3WLEA 4WY8A 5LM3A 2Z2KA 3DC2A 4ALLA 3TWOA 1ORVA 5DM70 4AAYA 1WU8A 3FIUA 4KRGA 1UKCA 5KDDA 1CF4A 1ZH0A 4L5YA 1G19A 4IFTA 4NECA 5BVGB 2JGDA 2HMTA 4HNQA 1KMNA 4ZYLA 3DFMA 1DWOA 4P32A 4UNPA 2FZEA 4N5MA 3DAFA 1JQ3A 1T4CA 4A9AA 2A1IA 3LVQE 1QE0A 3V32A 1GADO 4OQQA 2ZIVB 4EGCB 1G7SA 3S81A 1M1NB 5FWNA 2Q27A 2TMYA 3P9CA 2CMGA 1N2JA 4QAQA 4BQIA 4X65B 1J5EB 2I4IA 4IBOA 4OUDB 1SCUB 1JSLA 1C2YA 1L4NA 3RHSA 4UQLA 1L5KA 1BE0A 4PBRA 2GTIA 4IQ0A 5CTAA 5AXBA 4B44A 4M1SA 2HPVA 3OFNA 3PE6A 5I47A 1T43A 2RFLA 2GEUA 1RC8A 1DKMA 1E4YA 2XGSA 3NBXX 3OIDA 2WJWA 5HKAA 2OWDA 1DEXA 3RSOA 1YH3A 5T57A 4EY4A 4IV5A 1ODTC 3I5AA 3U80A 1EQ2A 5ALZA 3WSTA 6LDHA 4KN5A 4Z0TA 1DI0A 5K8TA 4CI9A 1AHIA 3NYIA 4AJNA 2VDPB 3AIMA 4NC9A 4XGKA 3WV4A 4US1R 1CDEA 3B9RA 1QKKA 4AJJA 1OXKB 4ZI2A 5JECA 4O3FA 4UUNA 1M1YE 2X2OA 1U6JA 4EI2A 2NNWB 4RVOA 3WWOA 3QY9A 5IT0A 1H2ZA 1N2EA 1RI5A 1F8GA 3CRRA 1DJOA 4QHTA 3ZDEA 4OK5A 4HCJA 2H16A 2VCHA 2JIPA 3L6EA 2B82A 4Z8YA 3ZDYB 1Z4QA 2A5GA 1M3SA 2BEUA 4U7JA 4BX3A 4EO9A 3CVJA 2JJ1A 2PT7A 5G1PA 2A7XA 3BWVA 1C3VA 5J3JA 1EJ0A 2CXXA 4ZICA 2XA1A 1PLLA 1V0JA 5JC8A 2O06A 2W6MA 1CKEA 3KSRA 4YRJA 4BLVA 1ZNYA 3EIHA 2RKWA 1EFHA 4LQCA 3WK9A 4OM8A 2O54A 2FPIA 2MSEB 3P0HA 2XSZA 2YW9A 2DU8A 3NAGA 4GU5A 4K9QA 4ZPXA 4KQEA 4QPCA 1WUJS 5TJ9A 4DFDA 5F7XA 5LL6P 4TQUS 1XALA 5HKLA 1FPQA 1XROA 5BSVA 3T5CA 2EU8A 3RT1A 1UAGA 1QYWA 2PSSA 2XKJE 3TZKA 5E4TA 4A0QA 4X8OA 3GRCA 3QA3E 3W2IA 1YU9A 3O93A 5TIIA 4RD2A 1GD1O 4TKVA 2SCUB 4UXJA 1YONA 1WABA 3TAHA 2XVZA 2I03A 1XK7A 2HCFA 1NT4A 2C0PA 2FMFA 2LE0A 1NQ5A 4BLTA 2QLMA 5J4YA 1EESA 4RHEA 2LWIA 4KXUA 4U9HS 2XD9A 2P90A 4MVJA 3B60A 1CZRA 4QQ8A 1QP7A 3FNGA 4CG2A 3KUXA 3DMRA 1XTIA 2D5CA 3HKEB 4DA8A 3BCSA 1MN6A 3C4JA 4QRDA 2IQ5A 3QE0A 4LJSA 2MOKA 4Q48A 2WV7A 2CY0A 4TMYA 4TN1A 3V97A 3ZE6A 2BI8A 1JIQA 2Q5OA 3PD7A 4MUIA 2XMSA 2Z8YA 2RARA 4AX4A 4ZYVA 5IF9A 3EZ9A 5DK4A 4BO5A 3SJAA 3LO5A 1VM6A 1OFIA 1KZGB 2J9FA 2IEAA 1CQXA 2ECPA 2FR0A 2W6JA 3C6YA 3KZ1E 3L7NA 1KR2A 4LW8A 4KN9S 5GP1A 2GHIA 2HB6A 5TMBA 1JALA 3SAJA 1WQ1R 2X9VA 2G08A 3LLMA 3EXG2 5HF6A 1TQ4A 2UZIR 3HU3A 3PZBA 4OJTA 2CF5A 2IUYA 2XSZD 3GJZA 2FMXA 5BURA 2OCBA 2Z43A 2ENWA 2FWBA 4AM8A 4KXLA 3FUCA 3M82A 4UDXX 5HJEA 4PV7A 4DR7B 5FOQA 2NXNA 4HB2A 2RBGA 5LXTA 2PRYA 3NONA 3RRYA 4JJ4A 1S2MA 4OHWA 2A7QA 2FHSA 4MA0A 4ARZB 4BB9A 3RVSA 5BYKA 2FGJA 4JQZA 3DGFC 5G0UA 3GQVA 2FWNA 1Z4MA 2J6BA 2Q4DA 3O92A 1C4XA 1FUEA 3CPJB 3DONA 1QIJA 3W1EA 1KGDA 1G20B 2WNSA 2Y1EA 4MW5A 5KOYA 1VBNA 3NGLA 4L95C 4KFRA 2BLNA 1QHSA 3JWEA 4EGFA 1F0PA 3HR8A 1QTRA 3QOYA 4V0MA 4O33A 2OPHA 2W71A 5J47A 4NX2A 2VYNA 3K4QA 2D5IA 4L1KA 4QULA 4D9BA 2CV0A 3H4TA 1A04A 3AEZA 5KYNA 5K6AC 3ILXA 3SU8A 4D9GA 4JI1B 3TLKA 2GESA 4ZCPA 3FJYA 2JFWA 4AO7A 2HJRA 3E23A 1Q50A 5I48A 3QX3A 2R4QA 5JSQA 1RWBA 4ZPJA 5CDHA 5JSUA 5LKRA 4AX8A 1XJWA 2H8KA 4XIGS 2EW2A 5EG5A 3TYXA 4PY2A 3OMWA 1KK1A 5DXJA 4QASA 1QYXA 4L9WA 1NFQA 3KU4A 3DMDA 2XVAA 2BAGA 4XXHA 3I2GA 4LCEA 4OCZA 5EQTA 2YR0A 4JLSA 2EZTA 2J0EA 2ZXEA 1YQEA 5KJFA 3ZDCA 4R68A 4CQLB 3QKSA 2Y68A 4UEQA 1GSHA 3VGJA 4HLDA 4G07A 3Q3EA 4NNOA 1F06A 4OMUA 3UICA 5DNDA 4PS1A 1Y3BE 2BFPA 1N9ZA 2I7VA 4KG7A 2ZYVX 1JSRA 3GCDA 3OX1A 4MVJH 2XUZA 1WBJB 4I6GA 4YCLA 5CVCA 1E6KA 2VDNB 4AF8A 4UHFA 3DOUA 1GCAA 2WFMA 3FD8A 4NOLA 4ND1A 4UHJA 5SYNA 4YUYA 3W5BA 1C9EA 2UYQA 5ICSA 2J7PD 2OORA 3FLEA 4EW1A 3DLHA 1OI2A 4GW3A 2C7GA 1PT9A 3L5OA 3VXKA 1G63A 3KK0A 5KO2A 4E31A 5JD4A 3UUFA 4EJSA 4FLMA 3DZIA 4Q3NA 2CNDA 1QPGA 4NR0A 5FPPA 4LWPA 4UAJA 1DCKA 5IXJA 1WQ3A 2EGUA 3T35A 1XBTA 3SHOA 1TM7E 4BO2A 4OBWA 2VTBA 1Z37A 4LSMA 2L69A 1E59A 3RRBA 3K16A 4F2HA 2NP7A 4JOCA 3AVTA 4JB8A 1U7UA 3W5SA 2NU7B 1WCIB 1V8ZA 4YGYA 1FVFA 1XKQA 4QPPA 5ERYA 1Z0KA 3E7FA 1AZWA 2HJSA 3MMSA 1HQDA 3EG5A 3K9CA 3PJGA 4Q03A 3TZQA 4ZZIA 4AF6A 2P79A 2P35A 1R4ZA 1TUIA 1P73A 2NZUG 1SA0B 1X87A 3AUSA 4M8SA 5L95A 4AUNA 4HFNA 3LX5A 1Q7EA 3T7DA 2FF7A 1MZVA 3ZWMA 5L51A 3CE6A 4DBVO 1G8FA 2XDQB 4A91A 4R9NA 4XD7A 2J9XB 2D2VA 2Z8YM 4C4XA 5LZ2A 1MB3A 3IHWA 4GP7A 4Q05A 3RTGA 1IHOA 4EL0A 1X80A 5AJXA 5EHXA 1OX4B 1W2WB 3FPHA 1PTJA 5AM2A 1JZQA 5BSMA 4N9WA 4JI7B 1J8DA 4IAOA 1HWYA 1MQ8B 3O9ZA 3OM1A 5B3KA 2DFTA 3UMBA 1J24A 4IFIA 1N77A 1UEJA 2NYRA 3JQ7B 3H4MA 1I3OA 2ZDGA 3KKLA 3TAXA 3PX2A 4DIEA 3B53X 3JYQA 5JO0A 3LIIA 3I23A 1RYZA 2E3JA 3JQCA 4QDUA 5FYQA 3WL6A 2FW9A 3HCWA 2CLIB 1SQSA 4MGEA 3IXMA 3F7MA 3NYQA 1LDEA 4KUEA 1JG4A 3Q6MA 4XM0A 3UY4A 2JIDA 1KEZA 2GZHA 4GLOA 5A06A 3H83A 3GMTA 5FNVB 5LZ5A 5L3SA 1D7AA 2O8NA 1LLUA 2QZSA 1QVVA 3MF4A 3UT5B 4YRBA 1O54A 1NXSA 1R37A 2EFCB 2GBLC 1PJAA 3TOXA 4M86A 3T5MA 4JGIA 3EK2A 3M6IA 2NU8B 1N2XA 1H2HA 3WKAA 4ZV4A 4HS4A 3UBTA 3O26A 1E7RA 1JIXA 3AOGA 4BQNA 3KTAB 3HM9A 4B43A 4D0SA 2YN0A 3QXSA 4QYIA 3W34A 1SPBS 1QB7A 1QGUA 3BMNB 4NBTA 4PF1A 2HF7A 1FTGA 3R0JA 5FPHA 2PVSA 3BZBA 3KXDA 3PI7A 4LHYA 4MSUA 4P3XA 4NBWA 3O47A 2O7VA 3OQIB 4CUKA 3DVSX 2ZE6A 5I9IA 1NWCA 1JP7A 1BXGA 1BMFD 3C3AA 2RJNA 2W2KB 1ZZEA 2B83A 2C4TA 3K1ZA 5EFOA 4PNPA 2R0QC 1CLUA 3B20A 4PXSA 4BWFB 3S4YA 3TW8B 1RXSA 2X8AA 4BEBA 5AJZA 3TLMA 4ZMRA 5JZMA 5KPDA 4FGZA 5L3ZA 5JJIA 4H60A 1B6GA 4N76A 2D2FA 4ZXFA 2VDOB 4A10A 2WIFA 3IEUA 1YR6A 3Q15C 5H16A 4TS1A 1E9RA 3PEWA 4AZ3A 1TYDE 1VE7A 3LY8A 3JWPA 2OAQ1 2QZ4A 4GO1A 2BC9A 4P83A 4TSFA 3V1TC 1O9HA 4MV0A 1YZLA 1QF9A 2D1QA 2Q6VA 4HNAA 3S44A 5G4LA 4BMVA 4FBLA 4HO1X 4IJQA 4A8JB 5KJCA 5CIYA 1YCGA 4H59A 4WUVA 3TQTA 5K3SA 2OGSA 3H2KA 4I9FA 5JBNA 5KJ6A 2ZQ5A 2WF8A 1MJHA 3LECA 5J43A 1J2TA 5JVDA 2JCSA 4HY3A 1PVOA 3NTXA 1YQQA 4YO7A 4B5LA 4AMYA 1G8KA 3BRWA 2ZAYA 3SQMA 1Z5UA 3HI6A 4CLRA 3FOAA 5AJTA 4XVQA 1KZ9A 4H2DA 1W8IA 5K45A 2V1XA 4FK8A 2WYIA 1RAIA 2CLOB 3HQ4O 4MW2A 3UF0A 3BQNB 1E8MA 5JTUA 1VYUA 5LQRA 1GNQA 5HX7A 4RELA 2FN4A 2B21A 1BHO1 4PINA 3H97A 2ZTHA 4HNGA 3RKSA 3OZVA 5EZQA 1IUOA 1JAHA 3KSZO 3I0NA 3ONVA 3WGYA 1VLMA 1WRBA 5KYTA 1ZOPA 3WIVA 2WFAA 3H5VA 1JLLA 1IG0A 1X1QA 1EZZA 2QLLA 3GGSA 4ZI7B 2BFAA 3A0RB 1M1NA 3GRFA 3HDHA 3OPYA 1KDTA 1Z2CA 3AONB 4JQYA 2B6NA 1UK9A 4JROA 1M33A 3ZWKA 1H66A 1FL9A 4U6SA 4RK1A 1CUUA 4XLTA 2EFJA 1KSGA 1ZLXA 4K6MA 3AIKA 4RNDB 4RVCA 4ND8B 2JLRA 3CH5A 4JOQA 13PKA 4GFDA 2QKYA 2R48A 1JBEA 5DBIA 3ROEA 2HHJA 5KKNB 1JG1A 3GEIA 1B7GO 2UU9B 3PRKE 1VCOA 1VJ1A 3OTWA 3CZCA 4OXXA 4PG8A 4RACA 3M4NA 3U81A 4HPJB 1RRMA 2FA9A 2ZBVA 4FE4A 3TRJA 1U81A 5HDQA 2P7IA 2QM0A 3PHJA 2HJVA 4R6WA 5JJLA 5DPMA 4CG0A 3MUNA 3AR6A 1THMA 3P4YA 4GVLA 4IH4A 4ZGWA 3HDJA 2XMDA 5F12A 1SVIA 1XDZA 4X6LA 4BAUA 2I5PO 3H1FA 3K73O 1DBVO 3EZGA 2XYVA 3BJEA 4YJ3B 3I1FA 4Y6PA 5FOWA 1FCJA 1NBHA 4A8JC 2M1ZA 2B1RA 5IZ4A 4AXXA 2H1HA 2FSGA 3IAS6 3Q3VA 4HAIA 3HCEA 4EA9A 2YWEA 3RWOA 4Y2TA 5KPJA 3U44A 1N57A 1ULTA 2XB8A 2IU0A 4WHMA 3IB3A 4NCHA 4QDOA 3ROZA 2VJQA 4GI7A 4EG7A 2FG5A 2WJIA 1SXQA 4CLHA 3WMRA 2J59A 3HU2A 3IQDB 1KEWA 1SRQA 1YZQA 3C8DA 5H3CA 1W0JA 3CIOA 2X0DA 2O8DA 3F8TA 2O3TA 4HJXA 3VSCA 4EELA 3CTPA 2P4QA 3FSGD 3GT0A 4PCLA 1AQUA 3O8OB 1F8UA 1W2HA 1PJRA 2AOTA 3LXMA 4N03A 2PMBA 4D7AA 3PEYA 3QFRA 1ECGA 1P44A 2V7BA 5H68A 1MKYA 1CY0A 4NBKA 4HJRA 3RFFA 3WLMA 1L5QA 3R2JA 3N9IA 4OP2A 1H5NA 2AG0A 4PTZA 1IXZA 4R40A 3KYJB 3G89A 3ZY3A 4UCWA 2YHUA 1U3WA 1TAGA 4JLNA 3X3HA 4YV0A 4M83A 3A36A 5F2OA 4P93A 1HLFA 2J48A 4WERA 2XA2A 5KUTA 2JIRA 2EW8A 3U60B 2COEA 5I9LA 2O1XA 3AHIA 2W43A 1KKUA 1LI4A 4LQLA 2AFVA 1PGOA 3AVUA 5J4HA 1P7VA 1TADA 1CHDA 2V45A 4Z4CA 4BFYA 3GK3A 1RE1A 4F06A 2J30A 4R8RA 4C6SA 2Z56A 2QS9A 3A58B 4NU5A 4QGBA 2OR3A 5EHGA 1UMBB 5TEWA 1IHYA 1EINA 1J2UA 1WXGA 3TL6A 2HQ1A 1ZJ4A 4HDQB 4LY9A 4MAMA 4V0KA 3SXJA 2YJ5A 2AIRA 5CH3A 2POCA 1VPDA 2G3YA 3IPCA 4KWTA 3M3DA 3RCBA 3CPEA 1JEYA 2I1WA 3MS2A 2C5BA 3LO8A 1IB6A 3L0CA 4UM5A 4IDAA 3Q7TA 2Z57A 4U0JA 5FTNA 4AMZA 2VVTA 4R54A 5M29A 1TVKB 2PWBA 1UWLA 1DDIA 5KC8A 2H5IA 5JS7A 3QKRB 5IT4A 2FQYA 3COJA 4KZPA 1XT6A 1NF2A 4NS4A 2HHLA 2AMJA 4CKCA 3MM4A 2FJUA 3CYFA 4JJZA 4BKOA 1HQKA 3G85A 4FZVA 1L7PA 4OB8A 4M21A 1EJ6A 4KMOA 1P4JA 4PFSA 4LWZA 4Y9SA 1JG3A 4PSAA 2BISA 4YP9A 1UK7A 4YHHB 2UVQA 2IP1A 4ILEA 5IVHA 1IUNA 3SPXA 1SUSA 1XF9A 1QNLA 2WIJA 4MW9A 1FS6A 1XTVA 4OQ4A 4DEVA 3EWIA 3PUYA 3IL2A 4YAJA 4CMJA 4BQEA 4D8TA 3D6FA 3HRIA 5MDHA 1V6SA 3RH0A 4TWZA 4Q7QA 2ZZNA 1SN7A 3EULA 1R4NA 1TJ4A 2ZTVA 3TJZA 4MVJI 4AUEA 1BX3A 4G9BA 4P4GA 4U9UA 3L77A 3AUJB 2W4QA 2RCYA 1MPXA 2E2WA 3W3AA 4QUGA 1RRGA 3DBLA 1A5TA 1FP4A 1NMYA 1XRJA 3HRHA 5EQFA 3UXYA 3FXAA 3U3XA 5IC5A 1H6BA 3O0TA 2EARA 4DMMA 1LC0A 4EMSA 2D00A 2ZPUA 3EZXA 4E5PA 2H63A 2HLNA 1PR6A 4RF2A 1IN1A 4ZAXA 1T9BA 1TO6A 2DMRA 3EAFA 3G1TA 4I9UA 5E9WA 5FO0A 3ZE1B 3W6OA 3L0YA 4J0KA 5F7OA 2X8BA 2KX7A 3GJ7A 4G67A 3WLQA 5P8WA 1F60A 5JFGA 5C31A 4BGVA 3G6WA 3L40A 4IMJB 4G6ZA 4F7WA 3H1EA 2V7EA 3EDQA 4O4IF 5CU7A 3COZA 3KWJA 3LU1A 2W6NA 1Z12A 1YR3A 1E2GA 3GDOA 2NVUA 4N12A 1EAYA 1SZDA 1J7JA 2IHKA 3AVPA 4WFQA 1IJBA 1Z2AA 2V6BA 1R6BX 3K9GA 1J5PA 4G0YA 1PGJA 1A27A 2X5NA 2LIPA 5EIWA 4Q6BA 5I7EA 3SSOA 2F90A 1BWRA 3OD5A 2HWXA 4ETWA 2QX7A 4NY1A 2QRMA 3JAKA 5GJBA 2D8MA 2FJPA 1VJTA 1KNQA 2RI6A 3VTKA 1EWYA 4HRVA 1ENZA 3T5AA 1V2HE 4ZJPA 1Z73A 1U90A 3TZHA 4QYIB 3RBAA 4XAQA 2C4WA 4DUGA 4H31A 2HNKA 3ZK7A 1WXFA 4C0SA 3WLFA 2GBGA 4M0LA 4FN5A 4YJ3F 4BC0A 3HHPA 1KYWA 3FMPB 3SR3A 2WT4A 4BWYA 2OCXA 3Q2OA 5A5DA 3VUEA 3NTUA 1XMSA 4QUAA 4EGQA 2FZVA 2NZWA 4HQ6A 4XWWA 3QY0A 4FGSA 1VZ2A 3EOZA 3DEZA 4ZDWA 3U7QB 1TXGA 3FHOA 2ESRA 4RVSA 1LSUA 3OZBA 3JZIA 1PNOA 2EP8A 3HKDA 3LBYA 4NSNA 3SK0A 2QX9A 2DFLA 4D44A 2YJ3A 1J8VA 1T3HA 4NYJQ 4EUFA 4Q3EA 4EPRA 4ASUA 4EKYA 2PZBA 3OETA 4IDGA 2QRLA 2VDLB 1S9DA 1I51A 2Q3FA 3A1CA 2HZ7A 2WZCA 4EF4A 4XW2A 2XGJA 1RW4A 3PDWA 4GOKA 2PRZA 1GZ6A 5A9RA 4GBGA 1E1YA 1ULUA 3LCVB 5AHRA 3ICWA 3N5CA 4CKBA 3DBVO 1E63A 3AF0A 4I9NA 3G68A 4R4JA 4UNIA 2B4RO 2R96A 1YA8A 4KO2S 4GI1A 4NABA 5IEJA 4CXMA 1IN7A 3AT1A 4LXUA 1F4PA 1KAGA 1CE8A 4MW4A 1W8DA 2HT1A 1IN4A 3KALA 4GZLA 1CSEE 3U7GA 4JLUA 2C1XA 3BT7A 1RYFA 1YJXA 3H2JA 1YVEI 5DYYA 5IM4F 3M8KA 1BHQ1 4RM2A 1GAXA 4MPPA 5K05A 2BJWA 4B09A 3UAGA 3F0TA 2VDUE 1JL3A 2Y4OA 4IX1A 1XRQA 3Q4GA 3S5JA 4ROTA 4ESOA 2V8BA 1GRVA 1V3VA 4HGQA 3KXLA 4KJZA 4PSDA 5A7HA 4GRIA 4YR7A 5KTYA 2PR2A 2POQX 4PR3A 1E7WA 2O1EA 3GZ4A 3PIIA 5EHIA 4GS5A 4CTKA 4JLBA 4DLKA 2VAPA 3UIEA 3M34A 4DCUA 5T8KC 3UHAA 3EHEA 4RGQA 4LSZA 4ZALA 1R12A 4GPEA 4DCCA 4HSGA 4NOMA 3KT6A 5KVAA 1FUKA 1DE0A 4P4TA 1FQKA 2P9JA 5FWAA 4O6VA 1GEEA 3CLTD 3GRKA 2DPYA 5G4KB 2RAFA 3WMXA 4Z3OA 1U9ZA 2VHZA 2YOHA 5BUSA 1USGA 1W36D 4DPKA 3UMFA 3IJ5A 5IULC 1WVIA 5B2ZA 2SCUA 1MFPA 2QYHA 3EYAA 2JGLA 4FJ2A 3VU1A 2ACWA 1JEYB 2PTHA 4Z3KA 5BPHA 5GV8A 2PEZA 3O8QB 4DQXA 5ENZA 2OXIA 5EN4A 1TCCA 2BR4A 1KI7A 1RVDA 1NV9A 5IEBA 4ERNA 1J6UA 4X97A 4B79A 1LPNA 2XHEA 1U1IA 1A9QA 2P4HX 1W9MA 3DG9A 5M04A 2JLBA 2W42A 3E5RA 5TY0A 3PVCA 3U16A 1RI4A 4BMSA 5FOXA 4F5ZA 4ZJZA 4ZYWA 5LD2C 1Z62A 4NWIA 4RSMA 4P2BA 1QZXA 1Z8HA 1ZVMA 3NTLA 1Q0HA 2GM3A 2X86A 5FX2A 1Y7TA 2YWXA 4E2YA 2UZAA 10MHA 2Y1CA 4H7DA 3KQMA 1OC2A 3VZPA 1VP9A 1VJRA 4ZVVA 3EXEA 4Z9XA 4BEWA 3VYTB 4O2LA 4BDTA 1H94A 1WXIA 4OK6A 1UFRA 3NIBA 2FG6C 3UA3A 3PNSA 2H1FA 4Q1BA 4F2GA 3VTAA 3PXEA 4WMLA 5BT8A 1P0QA 4IKOA 1R0RE 1TAQA 4MWOA 1WZCA 4H7KA 4KZKA 1SELA 4KMSA 2G1KA 4XIIA 5EZYA 1I94B 1NN1A 2A1UA 1OGYA 1ID1A 2Q3DA 1P91A 4YI3A 2FUG1 4FSHA 5KDLA 2AOTB 5FBWB 3CF4A 4MUAA 3PU6A 1GNRA 4ZQFA 2CL6X 5IAJA 5JZ9A 1KE1A 1Z47A 2ODEA 3DE7X 3HPRA 5KOJA 1G2OA 4TMKA 3RJMA 4XH9B 2PGAA 2EV9A 2H2FA 2JRLA 3CVXA 4DV3B 1FFBA 2NO0A 2I6SA 1JDZA 4N7JA 1E79D 2P78A 2FUEA 4H4EA 2EQAA 3M9LA 1AB5A 4ECEA 5E7JA 2WI8A 5JD6A 5EJ2A 4CMAA 4L0MA 1S6YA 5JQGB 3TQSA 5C8XA 1DTWB 2IK8A 3ILVA 5AK4A 4I2NA 4DPMA 1UKYA 1H6CA 3ORQA 5I5EA 5L9AA 3I04M 4IKPA 2PVPA 4U7PB 1XTBA 3UK6A 4B8ZA 3JD1A 1YBMA 1U0LA 5GIOE 4IO0A 1DL5A 4TSFD 4YXWD 4MR8A 4U5QA 5JI3E 3RYHB 2Z8ZA 1IBCA 5JRJA 1ZR2A 3E3AA 2Y8EA 1CDZA 2R8RA 3GC6A 3G0GA 4KKVA 1R74A 1KC1A 3MRVA 3V7NA 3PBKA 5A1TA 4Z4QA 1DWUA 1ZK4A 4AK9A 2E37A 4OD0A 3PQ7A 3EQZA 3DD1A 5BW8A 1Y3AA 3GT4A 5JS8A 4KDCA 3OOWA 3U44B 4QUBA 2YVLA 5AXCA 1KPHA 4Y1RB 1MOPA 3BE6A 2P68A 1P62B 2X19A 3ESRA 1Y5RA 2PWAA 5EXDA 2AC4A 1Z2OX 4GLJA 1R6DA 1NNI1 3AFMA 3SOPA 1H2RS 1DPGA 3SZ3A 1VIMA 2HWKA 3DF7A 4RO0A 3UVEA 1ORTA 4W5NA 3HVUA 4WBNF 1P61B 2GCOB 4EHHA 1LBTA 1E2FA 2ZRFA 4EB0A 1IDOA 3JD2A 2F9MA 3QXHA 4XPIB 4RHYA 4B83A 1I7DA 1J97A 2HA0A 3C39A 3DAOA 5CJ2A 5IAOA 1BD4A 4LG1A 2MYUA 2QE7A 2O8CB 4AKHA 1Z5WA 4Z2AA 2VXBA 5EHNA 1M2WA 3PTLA 1N75A 3E48A 5AH0A 2OQVA 3X1DA 2QWXA 2LPMA 3IMFA 3M2PA 1Z8NA 4BBPA 4KSBA 2R5NA 3OLYA 5AVRA 2O7RA 2RB5A 4LUCA 5DISB 1OTHA 2VJCA 1GPBA 1OJLA 2XE6A 1FVOA 2XIQA 2FSUA 3AWIA 3B7WA 4FYIA 4UBKA 2YW2A 3GGPA 4J94A 5DI3B 5FL3A 4YXWA 4D8VA 2GI4A 1Y6FA 3AFHA 2DQSA 3DVLA 1XTQA 3AFNA 3L92A 4IIXA 4M9QA 3UZUA 4C7XA 1QF7A 1VHTA 3B1XA 3OE1A 1OT3A 1YO6A 3UKOA 5GIPE 4L7QA 2I67A 4CKXA 1TO1E 3B1YA 1NFFA 3TINA 3HXMA 1G59A 4QATA 1VKOA 4BO9A 5AM4A 3NAZA 2SBTA 5MGBA 1RRPA 4HNAB 4L5JA 4DF3A 2QTVA 3UO8B 2IIPA 1CRQA 4LQDA 4EHKA 4O4LA 3QQ5A 1Z56C 4N7MA 4F4IA 4B3MB 4AS3A 5D6NA 3NCHA 1JEAA 3FGNA 4X54A 4BQFA 2ZUDA 5CFQA 4ARZA 3W5CA 1EI9A 3RD5A 1SD2A 1CUXA 2ECOA 5DTEA 1ZOLA 2ZYIA 3CFYA 3N6XA 4GSKA 4JI6B 2M1XA 3SDSA 2C9ZA 5D87A 1IQ0A 1USUA 4HEQA 2XQKA 3P9YA 5JLAA 2CKDA 1JYEA 1YR9A 1C4WA 5LKAA 1M6HA 1UC8A 2FR8A 3ZI4A 4Y1FA 5L7WA 4WY2A 3THXB 1V25A 2ZITA 1OB5A 3QE4A 3JQQA 4AIRA 3R6GA 5CFNA 4KIGA 5D2CA 4IHJB 4K6GA 4NJOA 4EBBA 4DCNA 4KO3S 3I4FA 1KYTA 3FW1A 2ORVA 4LV6A 4M0FA 1X94A 1MJNA 2XUDA 4PC6A 3ZHUA 2I3DA 5AO9A 1JBKA 2QRZA 2QORA 3JQAB 5CLLA 5I9MA 3WLTA 4DJAA 1EFPA 2VQ3A 3FOFC 2NW6A 1DSSG 1UP6A 2GHQA 4RTPA 3OQVA 4G1MB 3UUEA 3ZV4A 2NXEA 3QKWA 1X9HA 3QEMA 4R1OA 3IE0A 4D9KA 3HG7A 3FPEA 1BTOA 4ALKA 2C92A 1NP7A 3O4GA 1TCBA 1HY3A 4RTJA 3B2NA 1XD2B 2R4UA 3S0JA 5C46F 3O84A 3H2ZA 1TU3A 4IJWA 3TIIA 2OXCA 1NLZA 3DL4A 2G0TA 4BRSA 1SC9A 4LBZA 4IQ4A 3IOEA 4JWKA 4Y2JA 5L7YA 1S2GA 3LY5A 4FR2A 5BR1A 4B7ZA 4LRQA 4M9ZA 2OM6A 3CM0A 1D6MA 1CZLA 1QIIA 4WACA 5DLQC 1DLJA 2I1VB 1NG9A 4NI5A 1WE2A 3ECAA 3ESYA 5ALDA 5C1IA 4ZT2A 5EIHA 1P6XA 2G04A 5ETJA 3H5NA 4TS3A 4II3A 3T94A 4LZPA 3DQPA 4WOKA 1ONNA 5A4FS 1GUBA 4RMJA 2XT0A 3KL2A 4QFBA 4YFVA 2VPWA 3IIMA 3K5PA 4REQA 4ENPA 1U3GA 3IEKA 4MQBA 4ZU1X 4Z1MA 1Y1KE 5A7GA 5IYZB 1DO2A 3JPYA 3DPIA 2VRBA 2ACKA 5DHTA 1MO6A 1KHTA 1JDBB 2CLEB 5T67A 1SKAA 1LDBA 3WTCA 3ICQB 2A78A 1JPUA 3DPSA 2CEAA 1DEAA 4YCBA 4YPOA 2ECKA 4EJMA 2ERYA 1MP0A 4Y0NA 3N2NA 3UJ7A 1A4RA 1Z68A 4L74A 5GVSA 3K0EA 3GNLA 4R0NA 3GUZA 3AKEA 3B5JA 4E4YA 4DDMA 4J0CA 5B2FA 2QK4A 1GM5A 4FDTA 4N5LA 4QNRA 4UREA 1O95C 5E3JA 1O08A 1OAKA 3GJTA 4ZRNA 3QEAZ 4YMWA 1BFDA 4AYWA 5G2OA 4UOQA 1HF3A 1E8DA 1G21B 2GM4A 3GN1A 3V7UA 3O5AA 4CIBA 4A6DA 2X13A 1Q7GA 5A7FA 2GA8A 1SB9A 1ECCA 1MLDA 5A3QA 2UUBB 3O3NB 5TXGA 4EHJA 1XP5A 3SHFA 2PGJA 1MB4A 4BB0A 1O7JA 4BLUA 1EH5A 3G02A 1CF9A 2YZ7A 3DQQA 2M9MA 2ZRLA 3IT2A 4H6PA 3P0IA 2YVAA 1Q0LA 2FWRA 1XLTA 2JFUA 2KE5A 4I9GA 4CIVA 3ZVMA 2GUWA 4WKOA 4ZEWA 1NKSA 4HLQB 2PUFA 4JYAB 1C2TA 1ZFNA 5J4KA 4LYJA 5EA2A 3UYKA 4WNIA 3BWEA 4M53A 3RHZA 1FYWA 3CN7A 3HVKA 3W77A 5CLQA 5KYXA 1FDUA 3CJRA 1YZTA 1T8WA 3IODA 8AT1A 1FFGA 3UV7A 2W37A 1U7DA 1RBZA 2VHVA 4KWEA 4LXGA 5I4BA 1ESCA 1K5DA 4N5IX 4YCAA 4A2PA 2BP7A 1JH9A 4BXOA 4IG9A 4K9LA 4HTFB 5F4BA 1E98A 1A2QA 5LQDA 2JLWA 2C57A 3OBBA 2I7XA 2QN7A 2AK3A 2W4IA 1D1TA 2IY7A 2O7QA 4JBNA 1MEEA 1NWHA 5H1YA 2IH5A 5DJ5A 1WUYA 1F6DA 4J16C 2QR5A 2FAXA 4LYGA 4B0OA 2BFFA 4I4TA 4X6UA 4DSUA 2AH5A 1AUPA 2SNIE 2ZVQX 3I9MA 4XOIA 2PUBA 3BMQA 3FYUC 3OUZA 1P7CA 2CJPA 1LSJA 2FMKA 4AW9A 4E70A 3AP3A 5GOTA 4EZEA 3LG2A 2F9LA 3K70D 4DG5A 4L15A 3LPMA 1L9KA 3PJEA 3T95A 4QICA 1J1IA 4MJLA 5HMLA 4LJ4A 1KDYA 3PR2B 3V4PB 4RNCA 5CXSA 3LK7A 3QK7A 5FLKA 4G4JA 5REQA 2NYUA 1XDWA 4OQLA 3EJWA 3EASA 3OZEA 3ADCA 1FP6A 2YHSA 1Z3CA 2BHLA 1NNLA 1FNCA 1YBHA 1COWD 2KB0A 1DC4A 1VPLA 3DJFA 3MMPA 6PFKA 1VL0A 4P3NA 4IG4A 1RRVA 4A73A 3BD8A 4KQXA 1QO0D 1CD5A 1M67A 3G1WA 1ILEA 3ENNA 4I1PA 3JQEA 3WP1B 4FONA 4HXGA 4LOLA 4LYHA 5EEGA 5HA5A 1K7XB 3LNTA 2P8JA 3AKCA 1R64A 1T5SA 2JHCA 1G2PA 1XAIA 2JIBA 3C4QA 1Q11A 3QIAA 2QTGA 3GVPA 1GYPA 1K27A 1NNEA 1S8NA 1WZIA 5FLXA 1YHYA 4PLHA 2JCBA 5EY5B 4NEGA 5F77A 2W2OA 3IDAA 4Q9AA 2DBVO 1OBVA 3HP4A 3PEVA 4LX0A 1YMUA 3DLAA 3O8QA 3AJEA 3AF1A 4BUJA 1ZN9A 5JMPA 4KXYA 3ZK8A 1RI3A 3DE1X 1T2DA 2O2XA 3MMNA 4PCUA 1HSOA 4OL0A 1YVRA 5H81A 2WPDA 5JH7A 3AHHA 3TN7A 3TQFA 2QMHA 3KVYA 3TXAA 2FFHA 1W4ZA 2Q5HA 4KQHA 1NBIA 2E7ZA 4LVNA 3FF4A 5EJ4A 4R84A 1QGAA 4K6CA 2UUCB 3R5TA 2ZWPA 2X4IA 2DWCA 3RT7A 3UW1A 4MVJM 2PXAA 3VU0A 1BU5A 4NV1A 4DREA 2Y1FA 3VH4A 4L27A 1MPTA 3G23A 3GLFE 5G0WA 2R11A 1TM1E 1YHNA 1I9CA 2J3LA 2VP6A 2ZJ4A 5IX8A 3FWNA 3IUQA 4OHOA 1ENPA 5FPTA 4B6QA 2AUNA 4RPCA 1A9XA 4MQFB 4F4DA 2X3UA 3M5WA 4LXQA 3NAQA 1G5RA 3N2LA 5BN5A 2VHYA 4MUYA 4O4HA 3IKMB 1HDZA 1ZAKA 2PL5A 4TVKA 3LPLA 4ENUA 2XCIA 3ZHCA 4TZ6A 1W0CA 4D80A 2QMYA 3PGJA 4KACA 1EFCA 4EUKA 5E6UB 3LOQA 3KZOA 2RSLA 3NOOA 3N3BC 2ZUFA 5BUCA 1WW2A 1CRWG 4BN0A 1MRNA 1RYBA 5DHQA 4LOKA 4A3SA 2Q99A 2CL0X 5C8DA 2IS1A 1WEKA 2PQMA 3VNSA 4CE6A 4DT1A 5CBPA 2C2OA 3AOEA 5IHPA 4RESA 3A1DA 1KEEA 4ENWA 3EDMA 4JT8A 2PE5A 3VZBA 1MC1A 3IEXA 3OQ6A 3QJ5A 2WPDD 5T4BA 3K6SB 1DBPA 1DTWA 2DETA 1DG1G 2ZT8A 3IS3A 4RDIA 4P4SA 2NVWA 4REQB 5ARBA 1X2BA 3DXXA 1TMGE 2OZPA 4P08A 3WKDA 4K1XA 2DPMA 1L5MA 2ZM5A 1P75A 4F3TA 2BKUA 3JXEA 3HBFA 1XZPA 3AESB 3NNSA 5K99A 1JEQA 2ZS7A 1QRRA 3T99A 3FOCA 1WF3A 1OLUB 4TL6A 2G67A 1O9GA 4PZ0A 4RXMA 1XZEA 2HF9A 3BIWA 4FHEA 4UKDA 3V4FA 2XWPA 1H69A 2GNPA 2OZEA 1QP8A 5AW5A 1WV1A 1NRXA 2OBFA 5EKTA 3RBZA 4KFTA 4A0HA 5IJXA 1VMKA 2HA2A 3T3HA 1R5BA 1SCBA 1ATIA 4V38A 2CCGA 2PANA 2MJLA 5AD1A 3HJAA 4B75A 3EDCA 5E8RA 3SHWA 2DWPA 2H2HA 4KLCA 1Z82A 4HB4A 5H8WA 1BS9A 1Z6QA 3OPVA 3FYDA 3WLKX 4IIJB 4DIKA 3GQBA 1YTUA 3ZLJA 4DNOA 2ISCA 4EG3A 2QXUA 3RC1A 5IT9A 4WBSA 3WGMA 3BS4A 1NJSA 4ITUA 3H9QA 2Q9UA 2JKYA 1B42A 1E3TA 4YACA 2JLAA 6AT1A 1JV2B 1WDLA 3JSXA 4FMPA 1JFTA 4RGVA 2EDAA 3OI7A 4CPDA 2IYSA 4P0QB 1H2BA 4HB0A 4FYJA 1X7WA 3PNVA 4BQOA 3A70A 2AG1A 2FP4B 3GLQA 1PKEA 3I12A 4EEXA 2HA6A 1DQZA 2XGOA 5ULLA 2ZANA 1YE8A 1QIKA 4GGOA 3GDHA 3UV3A 3X1KA 5L3RA 3VR4H 2P6PA 1Y37A 2JGAA 3FB1A 4H7EA 4RA6B 1W94A 2B98A 4NONA 2ZYRA 4V2IA 3IKVA 3FNQA 5GPBA 5EJ5A 3TSYA 5JD5A 2JCYA 4MI3A 4D56A 3FTQA 3ZD9A 2ACEA 3BTSA 4W1SA 5DEOA 3PHIA 4I4TB 3GOHA 1BDBA 1K1EA 4Y6RA 5FP0A 4F60A 2QTVB 4QBKA 5CLIA 1J4AA 1ZK2A 2UZ1A 1Z0ZA 4U0KA 2ADFA 4Y30A 3WTBA 3K2EA 4DLLA 4DRZA 3RYCB 4ILKA 3OJ0A 3DDHA 4EATA 4FFDA 4O08A 1E92A 3DLIA 5B57C 2VK2A 5K9ZA 2D1YA 1XGKA 4L51A 1V26A 1BEUB 1E32A 4C0JA 1W5TA 1OWPA 1Z0JA 4HWGA 1JR4A 1ZGJA 1IIBA 1RKVA 3UWPA 1P1HA 2SHKA 4MVJD 2RMKA 3PDHA 4OXQA 3IERA 1Y3CE 5EKXA 3OLWA 3ROQA 1WF6A 4UDNA 1ICEA 2Q3LA 1EUDB 1IAQA 4YRFA 5KKCA 4WT7A 5JQGA 2X0RA 1IY8A 1C7ZA 1K68A 2VG8A 4K8RB 1NVUQ 5GGYA 5KHOC 1RFGE 2PMEA 1GZ5A 4I08A 3S1AB 5DZSA 3D4LA 4N7RA 3ZTTA 4JSRA 5K0FA 1AGNA 3RT9A 1BO6A 3VNUA 3SM9A 1B74A 4HEA1 4U5XA 4FKMA 3U49A 3HXOA 3H5LA 5DBFA 1NZFA 1WBBA 3K0FB 3GT3A 3JARB 3JRWA 1W9HA 2HWYA 1A69A 5FLEX 2JK0A 3KP1A 1FMFA 2HIGA 5ITZB 5JNWA 2GEKA 2V74B 1SMKA 4AECA 4DQDA 3WK6A 5D3KA 1OGJA 3O31A 1BVYF 3BDAA 4P92A 3AERA 1YZFA 1EGQA 1NMQA 3I4LA 4C06A 1I5RA 2DRIA 1V5IA 3CLSD 3RTEA 4EK9A 1JXAA 4X1IA 1QCCA 4X66B 1TA4A 1E5TA 5ER6A 1YCFA 3ZJVA 1BEZA 2BHSA 1KZ7B 1YQDA 1XNGA 2F48A 4UAVA 1JKJB 3EPLA 3QVXA 1OVMA 2XB6A 2XKKA 5HFAA 4CLOB 1B73A 4RMGA 1E4EB 2WHYA 1GGHA 4N48A 2WF7A 3KKQA 5GM1A 1ZMXA 3LBNA 5CVTA 2LBPA 3NVMB 1CJSA 2CVZA 2R9VA 1QYRA 4C76A 4E5DA 5C1BA 5L4SA 2QAJA 5TSDA 2ISSD 5JI2E 4QBFA 4JP8A 5EIOA 4E33A 4IUDS 2BFDA 3ONFA 1Z6TA 3QPDA 4HDKA 4RPGA 4S1PA 1KC3A 1OX5A 2LGJA 5LMCA 3FCSB 1JPNA 4J7XA 1GITA 1I3NA 3LC0A 4LYYA 2FDCA 3EAGA 1LB1B 1D6JA 1LS1A 1SUFA 2OO7A 2YDXA 3K6KA 3LQ4A 4MB2A 2EKDA 3IXQA 3NS7A 3RG8A 4JI5B 4NCBA 1AY0A 3E9RA 1D5WA 1XVVA 2EQBA 1V39A 2O23A 2CYBA 1PT5A 3VI4B 3G7UA 1QH1B 4TMTA 2WOOA 1HTTA 1YB1A 1NVXQ 3HLKA 5K6TA 2XRMA 3IIIA 3MCTA 4G09A 4QUKA 4WZBB 1D0IA 1M73E 3EMBA 3OY2A 5MHTA 1UDWA 3WWEA 2MR6A 3KZCA 1KVTA 1JHRA 2CB9A 5F5XA 1C8BA 1QDUA 3DEFA 3FVRA 4QJ3A 1IBKB 2C00A 1EBUA 2WU4A 4RIHA 1W87A 4AL4A 1T13A 1KAOA 1K6XA 3EZ6A 1QC5B 4QECA 3ZWQA 2YMPA 3E27A 1QYIA 2CW5A 1NC3A 1TQDA 3EA4A 2I33A 2BFNA 3ES9A 3QFHA 3QMWA 3DBIA 1XA4A 4HMQA 4RLQA 2P2CA 3QG5A 1F2UA 2VT7A 4HH4A 2IUEA 2ZPAA 2P5SA 3LCMA 2C0CA 4OH1A 4P4SB 3SKYA 4M0KA 1QRUA 2P9EA 3B5EA 4P54A 3TNJA 3VPGA 2EIHA 3ZHXA 3P94A 4EKNB 4S1VA 2HW8A 2O0LA 3LGXA 3OJXA 4EY8A 4J03A 1LLQA 3PDIB 4LGYA 3T9AA 5JD3A 3T9EA 4AZ0A 4MAFA 3W5DA 1V4NA 3ASVA 2MYNA 2VDVE 1H0HA 2IYXA 3TNLA 1ML3A 3PPYA 4ZXPA 2A0FA 1VSBA 1ZO8A 2QTHA 1FB5A 5ABPA 1VFPA 4O63O 1B8UA 3QWAA 4OHRA 1A9PA 4TUYB 4WN9A 3VVLA 3SKXA 2NACA 1AMOA 4YRKA 4HGPA 2CNOA 4L4ZA 4LNHA 3JYPA 4Y1EA 4BNJA 4F8YA 1UZLA 4UNQA 2HJGA 1ONOA 1ZLYA 2X9LA 5E6SB 1JXOA 4C2BA 3FH0A 3IKJA 3ODGA 3F73A 4E2WA 4Z49A 4M8NE 2BR3A 3H3XA 2REBA 3L8FA 5CEEA 1EUCB 3VNBA 2PT5A 3JD3A 1M10A 2BGJA 4IJ5A 2WU3A 4JXJA 4YDHB 1GU1A 1C7JA 2V3VA 3EHDA 3ESDA 4IIJA 3IP5A 4MKHA 4MV3A 4BVJA 5B3LA 1MFZA 1KK2A 1MABA 1TMKA 4N49A 3DAPA 4N6NA 4WWHA 3FE2A 4C21A 2GYVA 5CB0A 2JDID 4C4SA 3HEMA 1S8AA 1ZC4A 3WMEA 2O0HA 1IFXA 5KTPA 2VNJA 3H8SA 3FPCA 4PCVA 3IHKA 1QAMA 4W1QA 2V5UA 2CZCA 4KR3A 5K0BA 4MQFA 1GFIA 1WB4A 2C4UA 4PU0A 1CZNA 2X0EA 1HDYA 1ORRA 2ZPTX 1RXWA 1BMQA 4UUBA 1LNZA 1OPRA 1ZCAA 2FSFA 5EL0A 2WVAA 2HQOA 3AR2A 3GZTB 2J5BA 1B0UA 3I8OA 4RZSA 4UEKA 1QO9A 4B4VA 3OOHA 4A6EA 1R3DA 1KK3A 5JU6A 4UNRA 3SFVA 1JHOA 1PV4A 4C1BA 2X7XA 1IHXA 2V7WA 3H1TA 5KNBD 2WF6A 3GT7A 1E7YA 4I5DA 1AOXA 3LXRA 1RADA 2D7JA 2FSHA 3BDVA 1QCDA 2LKDA 4DYVA 2WG1A 3BQMB 2EG5A 4MR9B 2LW7A 1WSAA 2OZVA 4CL0A 2OCKA 3NW9A 1ZJWA 1U2ZA 2JH8A 2FFBA 3T9FA 4REOA 4J7AA 1EK0A 3C5VA 4YCNA 3ELBA 1WPQA 2J33A 3RU9A 5BRAA 3TRIA 4H15A 1LEHA 4FB5A 1DKRA 1UZNA 1PNVA 3GH3A 1EEXB 3KJXA 3S2YA 1QQBA 1CZOA 3LT1A 3VKVA 3IEIA 2VPIA 4LBWA 4PGGA 3AETB 3G5UA 2HDNB 2HRCA 4MWCA 4R05A 3MFQA 3FUTA 2HA4A 2J7KA 1P4AA 1D1PA 2CJXA 1BXRA 1ISPA 3WC4A 2CLFB 1UWKA 4G8JA 3QELA 3RKRA 3C3DA 4EHIA 2VNKA 5DWDA 2Z3WA 2QAIA 2O0MA 4IIYA 4UE2A 3FYHA 3HO8A 4BNDA 2BHRA 3DV0A 1R6XA 3A1WA 4F84A 1WDKA 1ZN8A 1YB6A 1UPAA 2R65A 1UOEA 2VJMB 2XQFA 1ESZA 3O9MA 4YUVA 1QQAA 1ND6A 1PJTA 2B1QA 3FPAA 4R31A 1D5CA 1XCMA 3DXYA 2CHUA 1SK9A 4EG5A 3UHFA 2BRUC 3IYLW 3B12A 3OLCX 1IZYA 2DR3A 2WMDA 1EU1A 3O8NA 4G26A 1SVKA 1XN4A 3WBJA 3TD2A 5LMNB 3NPMA 3NWBA 4ID3A 5FYDA 1G64A 1QKJA 4K81B 2B9VA 1FFSA 1YL6A 1TKBA 1PR3A 3QE2A 4A03A 3UMRA 5IVPA 3AI1A 4YJ2B 4AD8A 2VDKB 2ZE8A 4OOFA 1JIJA 3KOWA 3PQCA 3DCNA 5ERGB 3GQBB 4D3XA 4JLAA 5CG1A 5HRAA 4TKZA 3DOIA 3RO7A 4BNVA 3DQZA 1NBMD 2CNWD 1Q7CA 1NVVR 3GY0A 1SC6A 3D4PA 2ZAGA 1GHTA 2Q0QA 2V4MA 2PXXA 2YQZA 3HBAA 1K7YA 2WKSA 2ZYWX 3D3EA 3M49A 4KNYA 2JIZA 4AXBA 2JI8A 3PWTA 3BIOA 4M0DA 4KK4A 5DTMA 4D4KA 1EP2B 2AZMA 3BSSA 3STXA 4QOHA 1ZONA 3W2EA 2H7YA 4DCPA 1N1GA 4HDRA 5DNAA 3CNEA 3IDOA 3S7ZA 3GEHA 1FS4A 2DY0A 4G0OA 4KO4S 1M6NA 5AP9A 5EYPA 5KTNA 1T0IA 5KYXB 1J2JA 3LLCA 2C7BA 1T35A 1XMPA 3RLFA 3T3DA 5KIAA 2X9GA 4JSTA 1MB0A 2FMIA 1TI7A 4DRXB 5A4IS 4RFLA 4XCVA 1EHYA 4LXXA 4HGYA 4RZXA 2PKEA 3C8MA 2XNJA 5KSPA 3P2JA 1HG1A 3QLUC 3MK31 2RI1A 3OZIA 2QYTA 5KU7A 4G0UA 2V7XA 2PMCA 3F3SA 3AKZA 4U7TB 3THWA 4GG1A 2PMWB 1EWTA 1LRKA 2WTXA 3GFPA 5FIUA 3TI7A 2IY8A 2PZAA 4ZEOA 3W9UA 4F6CA 5HQJA 2AHOA 2AS0A 1QUFA 4Q1VA 3VOBA 1X14A 1P33A 3BHMA 5LLSA 1WXXA 3EEBA 3MIIA 3IBFA 4JVLA 1QF6A 1QXSA 3INGA 1I13A 4A8TA 1KMHB 4H35A 4Q9IA 4HN4B 1XFAA 2QX4A 5B1IA 5BNZA 2H1LA 2HH9A 2PD4A 3WDLA 4GF5A 4K9RA 2Y0PA 1I6MA 2P9FA 2RH8A 1ZK1A 4WI1A 1RRKA 2GJKA 4GVPA 1GTL1 3CUVA 4OI1A 3ZW9A 3L07A 2HADA 1JECA 1GQ2A 2FPRA 4MW0A 3TCNA 3VHLB 1ZBQA 3A7EA 1NUSA 4CM8B 1YOBA 4MP3A 4D4HA 4UOZA 1Y6JA 2ZRDA 4IOMA 1P2GA 1Z7EA 3JSAA 4IDBA 5ISMA 5KSOA 3ZEAA 1QV6A 2W2PA 4TQ9A 2YZNA 3C5HA 4GI2A 1TU0A 2ZRBA 2C2MA 4I4CA 4AMUA 5CM2Z 1GFSA 3I5YA 3Q3GE 3VVBA 2B0CA 2WLTA 3ROFA 1PQ4A 3DLTA 1DXHA 1NW5A 1RLOA 2I6GA 4KQ2A 3U62A 2ZQZA 4XTRA 2ZSIA 1FP1D 1OWLA 2DECA 3F4BA 2W2MA 4O25A 4RVUA 3K5WA 4P3KA 3TLCA 3SC2A 2IS6A 1J22A 4DM4A 5ENVA 4KGZA 4XTCS 3U1TA 5B1SA 5BQ3A 3BHNA 2QRUA 2Q3BA 5JY1A 5LQSA 3KLBA 1GY8A 2JD0A 2ZIWB 1NOIA 1Y3HA 2QP9X 4PYOA 4Y1RA 2WAYA 3UA4A 3B3FA 2WQ7A 2C9BA 3F74A 4HNRA 5EP3A 1M8GA 4TVBA 2M6RA 1X8JA 1C1XA 2C5GA 1UH5A 4L78A 3R24A 1G7CA 4O5AA 5DO9A 5JRZA 4H17A 3IEMA 2GM9A 4QLBA 3OQIA 1FS5A 1Q0ZA 1RCFA 3QUAA 4NCXA 4P7KA 4HPWA 2BVNA 2G28A 3A11A 4IVQA 2WFLB 2GJ4A 1EG2A 4XPIA 3CE9A 1GN8A 3I2IA 4QFDA 3SF8B 3T1NA 4ZO6A 2EWWA 3HFRA 2VRWA 2HSZA 3MOSA 4NU8X 1P9WA 5CYFA 4YT5A 5IKXA 3JQAA 1UJ2A 4GXRA 5K8CA 3C41J 4WNCA 3G0HA 1ISIA 2J6HA 3REFA 2G1JA 1YBAA 1Y6RA 1MD9A 4NZNA 2WMYA 4QG3A 2ORIA 3UFBA 2O3QA 1NRWA 4D9IA 1GPAA 5D01A 5K6AA 2COKA 1CIVA 3IXLA 5DNYB 2QQGA 2P65A 2PSDA 2NN3C 1PL7A 3G6KA 2RDMA 4WW0A 1U8XX 1XD2A 3KRTA 5B53A 1EB9A 4DSTA 2XOKA 3PGKA 4HDSB 2QL7A 4QJ5A 5FO1A 5BY2A 1V7QA 3I32A 4M1TA 1LLCA 1I1HA 3WXBA 4G1CA 4CN8A 5GZ3A 5DSZA 4DCGA 2XZLA 4EW3A 3DE3X 2IODA 2AUMA 4H7IA 4RQAA 3LQ2A 3AHCA 4I5GA 4R98A 1RIIA 2F4NA 3I6QA 5BVHA 3R4CA 1B26A 3OFVA 5A0TA 3F98A 2AI1A 2P41A 3WWCA 3U7QA 5TGTA 2EWMA 4YRDA 4G0QA 2QYOA 4K1LA 3UKDA 2JFHA 2O07A 1IOLA 4GBED 3ZV3A 2AG5A 1FZTA 3PA8A 3PA6A 3IO5A 3AR9A 2NV6A 4QPJC 4R3NA 1FJHA 4E3ZA 3KEMA 3JRNA 4L4UA 2AN5A 3IVMA 4ARBA 2QUBA 3T1OA 4H1WA 4BMZA 1YXMA 1WPXA 1E1NA 3UYLA 3ZIDA 2XB9A 2ONJA 4DB4A 1N3IA 1U9IC 3JQAD 4YC7A 3KSAC 3I9KA 5EVCA 3MLBA 4HDKB 3TLYA 1SUWA 3ZVKA 4XWYA 3MXOA 4CT0A 1R10A 1SKQA 2GPBA 2GPNA 3NUQA 1J1ZA 4G0ZA 4R1QA 4YJFA 3HXQA 4HAWA 4UDOA 2OKGA 2NSHA 1GA4A 4RPLA 2PX3A 1H22A 1XVTA 3LUKA 5DGIA 4P22A 3FDXA 3V9PA 3FFAA 1Q0PA 1PGQA 4ETMA 3PFHA 1SKUA 1R16A 3DPUA 5FDFA 3WYEA 1TT7A 2R8YA 2BTQB 1TX4B 4J3FA 1MX1A 4NKRA 2GPAA 3QLVC 4JZKA 1YS7A 4BE9A 3REOA 3FTEA 3KJEA 4UHBA 2AOWA 1Y8QA 3A3KA 3EUEA 1DHTA 4EY3A 4C5AA 3CRMA 3QVGA 4L4RA 1MO5A 1RWXA 1NI5A 3KPYA 3RABA 2D7DA 3NEAA 3L93A 4UUAA 2PS3A 3E9YA 3X44A 3H9CA 3OM8A 2CJYA 2RAUA 4HYEA 1ZNQO 1R5OA 3N6VA 3C1OA 3NV7A 3ZYCA 1V8OA 3Q7RA 2OHJA 2Z30A 3AUXA 4FHZA 2C94A 3IAEA 1YASA 3QE3A 4LXYA 3JTMA 5AI6A 2DHCA 4UZEA 2I3AA 3Q0TA 4CMEA 5AOBA 4ENRA 2QW1A 5UKDA 1GR1A 4CG3A 2CB0A 2B2CA 2MSLA 1MA0A 2JAPA 3P97A 4HX2A 2V54A 1KOFA 3DE2X 4FZ3A 5LDGA 5AW9A 2VP5A 1K9SA 3SZGA 1PO7A 4L8FA 1QGED 2ZW9A 3G2KA 1ZL2A 3UCEA 3VR2D 3WAKA 1Z0AA 4KEAA 4ZODA 2IYOA 3URMA 2GD6A 3TVYA 1QH8B 3IAAA 1N36B 1EIWA 1OLXA 2PYIA 2QTMA 1G41A 1P9RA 4XUCA 3WK5A 3IT0A 4BRZA 4MWGA 4P6VF 3RS8A 1SZJG 4OBEA 4EQZA 1DTSA 4QTZA 4J4HA 2GRJA 2ODTX 4FDUA 2QRPA 5C35A 1Q14A 1W581 3P27A 1T0JB 1F38A 1MABB 3WWPA 1EJBA 3JVEA 4WFIA 3SIXA 3CWCA 2GAJA 2ONCA 4IEEA 1AK1A 4M1QA 1I4TD 2ZRGA 5EZ6B 3KUDA 4TLCA 2NTJA 3HMKA 3GGCA 1BS1A 3TMKA 3V8MA 3ZTWA 4MTLA 3WG9A 4U8HA 5KX5A 2VLIA 3BWMA 2QTNA 2Q62A 3PQ4A 4R5HA 4QDZA 5SZJA 3TAUA 4F5WA 4JI2B 1ZW6A 2WNHA 3OX2A 2YBDA 4INOA 4BGUA 3JQ8B 2N0SA 4O2AF 2EVWX 2JD1A 4QO8A 5BUZA 2BI4A 2I8LA 4YT4A 3DLCA 1JDTA 1GUDA 1SUBA 1IXRC 2JAXA 4XR9A 3H3FA 1KYZA 1ZN7A 5H9VA 5D1HA 4C5CA 5D7NA 5EINA 5KOJB 1P0PA 4MRPA 3UJ9A 1BW9A 2BFDB 2IOYA 4KP7A 5E9AA 2C5FA 2V5AA 4EF6A 2DY1A 3OPQA 4G24A 3M1AA 4LPKA 4Y6QA 2VKTA 4NE7A 5H59A 4HZGA 4CR6A 4FSXA 1MJGA 2OBYA 1CQIB 3ANLA 3H2BA 2ZSKA 821PA 4XLLA 3LSYA 2GLXA 4BJ6A 4RK0A 5EMJA 4C03A 1M9NA 1YGYA 2OK7A 3TJMA 2GMWA 3VYWA 1UQTA 3VAAA 5HUHA 1YGPA 3QPWA 3WLIA 3A05A 3TLGB 2V03A 3IUMA 4B7UA 1D04A 1U0FA 4MRRA 5BN4B 4Q9DA 4IDCA 2QT1A 4FMDB 3H2IA 4QGSA 2AR7A 3SF0A 1GUZA 1M8JA 1V4VA 3LP6A 3S2EA 5JZBA 5BVGA 1N6LA 5T6BA 5BYJA 1WXQA 3NP9A 2JZCA 3MQ2A 2O8EA 2WAOA 1IMOA 3KOUA 3PVZA 4MW6A 3ZZTA 4EPTA 1QYVA 3QEOA 1N8NA 5B6IA 2R5WA 1FNNA 5P21A 3ZGYA 4HSEA 1H0SA 4PRYA 1DG3A 1P9LA 2QPAA 3JS5A 1ZICA 2ZAOA 1RI1A 4KYVA 4X41A 5EJMA 2PKQP 3UJBA 2FX5A 4X61A 3L8GA 4XEUA 1A2OA 3CLRD 4PGMA 1B15A 1NQWA 3EJ6A 5IBQA 4CFSA 2G9RA 4Q34A 3ZCTA 3C3KA 4FHCA 3E18A 3V7FA 4YXFA 4MA4A 4JBGA 3OLXA 1ZIYA 2PS0A 1ZW1A 1Y42X 5EE0A 1PYGA 2EC5A 4I1YA 4YHBA 3GX1A 3LYLA 3O94A 4LDPA 3KJQA 1LWOA 1T4MA 4OGGA 4Q66C 1RR6A 1HG0A 3S40A 2OUKA 3V3TA 4CEIA 1U7WA 4Q19A 2ZIFA 4OQEA 1JFRA 3RTCA 4WKPA 4EYQA 4HLCA 2WZBA 1QVZA 4YYZA 2IBMA 3F4LA 1W1WA 1V1MB 2YWBA 1UINA 3LI2A 3MT9A 2CNNA 2H0RA 1L2TA 3GAFA 4FEAA 4UMEA 1SUAA 4UNNA 3VSBA 4LYEA 4Z9BA 1LNSA 5DE3A 3EIUA 1XDGA 4WCVA 5EAIA 5LBTA 3HV2A 1CJBA 3OOYA 5K7SA 5JJBA 1ESNA 2TMKA 4ZAWA 5JAZA 1H2AS 3BWXA 1XIVA 4ZOAA 5JRDS 2GZ3A 3Q7IA 4OXYA 4PNHA 2GHRA 1V11A 1J0CA 3AFOA 3QWFA 1Z74A 3BCUA 4J16A 2NU6A 3M6MD 3NHYA 2A88A 3BPSA 3D81A 1I7PA 2FN9A 4D9FA 2W00A 4G5SA 2C59A 4HAOA 2GCPA 4GZ5A 5DSTA 3E6AA 2FCRA 3V4SA 2HA3A 3UT5A 2PBRA 4K6OA 2EZUA 3RANA 1MA3A 3VO8A 1A9XB 3DMTA 3LDHA 2AX3A 3X1JA 3BN3A 4M7RA 1VSTA 1NU6A 1GGMA 2FR8C 3PQFA 2XNSA 1GQRA 1EFVB 3QIVA 5H5JA 3WL3A 5AUPB 5I01A 3VA7A 2JLXA 4KUHA 3WFJA 5I7RA 5I9NA 2FN3A 2WFLA 4PO9A 3SF8A 3U9SA 1NF8A 1OAOA 2Q2QA 4IS3A 3FOZA 1O0SA 1EGAA 6REQA 1OFTA 4Q4JA 2ZB7A 4D4IA 2WHRA 1HEIA 1CLEA 1W59A 3O3OB 5EC8A 3KKOA 1UOOA 2FH5B 5F9FA 1T0PA 1VIDA 5AOCA 1NT2A 3RS5A 4MPDA 3KZVA 3ASYA 1XLWA 3IDFA 3IV7A 1UAAA 1V5FA 2A9RA 3RUDA 1PEKE 4MB6A 5JNUA 3ZYZA 3F1KA 1RPNA 1IBRA 1G8JA 3LF2A 2GJSA 1F2VA 3G8DA 3RS3A 2V98A 1CR4A 1QS0A 1T6YA 3MWGA 4UEOA 2FFRA 1GPYA 4HFRA 1D9XA 4AZVA 4DLWA 5CA1F 3EXHA 1XAHA 3LZ6A 4MYSA 2Q45A 3TSZA 3TW4A 1PWHA 2CNBA 2QXYA 1ZVVA 3BFJA 4P7JA 3LPDA 3PNOA 2HF8A 4D25A 3K09A 2Q0SA 4QJIA 5CGZA 4LN1A 3W6NA 2A9FA 4B48A 4F6LA 4G4IA 2UYCA 3GNTA 4URVR 3D64A 4JB2A 3VISA 2GJ9A 4CU5A 1DV1A 2M6LA 4FBGA 4REMA 1TD1A 5AKIA 3V4ZA 4LV5B 4CIAA 4W6QA 3T3OA 4GWKA 4HWRA 2ZTUA 3FR8A 1QORA 1BVHA 1EDBA 4LC0A 1APBA 2R6JA 3LP8A 3KU1A 1TZKA 2V9ZA 1K3FA 1P3JA 4JCCA 4QQFA 4UDYX 1VE9A 2YY5A 5KREA 3DOCA 1QHNA 1JG6A 1E9BA 2PX0A 2ZKLA 1JT2A 3EEFA 4CR7A 2XIJA 1PHPA 3NHLA 3EGVA 2VNSA 4QRIA 4NH0A 2PXCA 1GAQA 3W2FA 5KVCA 4COOA 2QTLA 3JZFA 1RJ9A 2XWBF 2Q9AA 2Y1XA 3GAZA 2HRBA 4TKVB 4X1YB 4DAEA 4LSWA 1NNUA 5KYUA 4DJEC 1NW3A 1R9JA 3GFGA 3GUVA 1T9GR 3EH2A 3N2ZB 2WWFA 5CNJA 4FILA 1WLSA 3HVRA 3VC7A 1R8QA 3KNZA 4UQPA 3TBKA 3L84A 1C8VB 3RS4A 3RSCA 3OPYI 4FHFA 5JR3A 1KI9A 1H0RA 2OHXA 3DZBA 1K3TA 5GQSA 4BV9A 1IEXA 3WRYC 1PX2A 1P1BA 4E12A 5ALHA 4NCKA 3TEJA 4CM9D 1NBEA 4UFPA 1QFJA 5CDSA 2G40A 3IDZA 4XEHA 5BSKA 2Q2NA 4CIYA 1W5FA 1ZH6A 3D54D 2B8NA 1XJ5A 4O1MA 3VSDA 3ZX4A 2UZ4A 2WWRA 1REQB 2D06A 2ZI6A 1MHPA 1RABA 1C3JA 2GN9A 4GPAA 3TPFA 1UJNA 2QSYA 3IBSA 3EVBA 3MJEA 3OIGA 3QVGB 2J9ZB 5AI8A 1Z06A 3RW9A 5B36A 4W5TA 2OBLA 4Q9NA 1RYDA 4RJJA 1QP0A 2NUTA 3WNBA 1P4SA 1UMDA 3EBOA 3RPEA 1RYNA 2Q2VA 1NBWB 3PFIA 5BN4A 3HYNA 1LPOA 5ENDA 4YMVA 2EFYA 1JG7A 2QRGA 2HMAA 1IOZA 1U3DA 3KB8A 3LXXA 5B1EA 2QL6A 3M0EA 3IGFA 4JP5A 4DLXA 2UZ1B 4RD3A 5E7MA 3F47A 3R5HA 4IHAA 2VUTA 1PUJA 3P52A 5IPFA 2ZG6A 1Y81A 1T4BA 4DEXA 3E81A 4HMOA 1YS2X 4WX2B 1D3AA 2RK3A 3O8LA 3JR3A 2RC5A 1J2RA 5BR4A 1LA2A 1ITZA 1H8ED 1QOPB 1VLLA 1Y63A 2JJYA 2SKEA 3MWLA 4OQXA 3KLMX 1UP4A 1V8FA 4G4SP 1H9CA 1WULS 4XSHA 3UMMA 3I28A 4BUZA 4ZZ3A 3N53A 4KTVE 4DUYB 2NPOA 2HREA 3VR6D 1TK2A 5HDBB 4OFBA 4RTOA 5KS2A 1FFCA