5EKDA

Human mitochondrial tryptophanyl-trna synthetase bound by indolmycin and mn*atp.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
327
Chain Sequence
KKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan--tRNA ligase, mitochondrial
publication title Binding of Mg2+ATP Enhances Inhibition of Human Mitochondrial Tryptophanyl-tRNA Synthetase by Indolmycin
rcsb
source organism Homo sapiens
molecule tags Ligase/antibiotic
total genus 110
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 5ekdA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 5ekdA01
2CYBA 2J5BA 4BWVA 1I6LA 1YI8A 1XNGA 3MLAA 2X0KA 1LI7A 1JIJA 1O5TA 2PIDA 3PRHA 3A05A 5F23A 1R6XA 1G8FA 4NZPA 3K9WA 1QJCA 2A4MA 3QTTA 3ZGZA 3RK0A 2IJGX 1H3FA 2X3FA 4DE5A 1EUYA 1K97A 1N1DA 1LW7A 2OV4A 3UC5A 1NI5A 2WQ6A 1WQ3A 3IVGA 4MUGA 1O97C 1NUSA 2QJOA 3ELBA 1H3EA 2PZ8A 1MAWA 1KQOA 3CLSD 4I6GA 1ZUNA 5J59A 4ZCSA 3N8HA 5LFAA 5J5AA 1M8PA 4WNYA 3AIIA 1U0BB 3RK1A 3LE8A 4QRDA 2QUHA 4MW6A 1NUPA 1KAMA 4KPUB 5AHWA 1XNHA 1F7UA 1TYBE 1KQPA 1YIDA 4OUDB 4GU5A 4MWEA 4KR9A 4EFKA 1OWNA 4CT0A 4Q16A 4MUIA 3IH5A 4ARCA 2CUZA 4EF6A 1YULA 1X6VA 1JZSA 4YMIA 4MW7A 2X1LA 3ZUGA 3LCJA 4A91A 3N9IA 3KFLA 2DR2A 3IOBA 1MBZA 3FOCA 1IQ0A 3G6KA 4KR7A 2G36A 2ZUFA 5DASA 3X1KA 2IP1A 1EFPA 1MB2A 5KCMA 4MVXA 1GZUA 1U3CA 2PXHA 4DJAA 2JANA 2E21A 4G5YA 2XRZA 1QRTA 4JZYA 4HJXA 1OWMA 2GOYA 2PZAA 4U63A 2QTNA 3PNBA 2JA2A 1OD6A 2QTMA 2GM3A 3HGMA 3CLRD 2J08A 3CLUC 2CV0A 4R2LA 4HPWA 1PG0A 3TQOA 5IJXA 1EFVB 1GTRA 1WOYA 3P0JA 4JYZA 2V0GA 1WZ2A 2VTBA 1TYAE 2YXNA 3MMXA 4EG8A 3SYTA 1O6BA 4E1AA 1U3DA 4R2MA 4J75A 2HZ7A 1IFXA 3G5AA 3HV0A 4ZT7A 1N2JA 5KHAA 1PFYA 3Q12A 1QRSA 1NURA 1BS2A 1M1ZA 5KWVA 3KT0A 4TS1A 1GTSA 1COZA 2DUMA 2Z3VA 4ZT4A 3FI0A 3CVYA 1IQUA 1KP3A 4P2BA 3DV2A 1MB9A 4YP7A 2E89A 4L2IB 5LM3A 4HK4A 1JMVA 3P0IA 3IODA 3UOWA 5IHXA 2PZBA 1VBNA 3SZ3A 4CDMA 1N77A 3PNYA 1JIIA 1WY5A 2CYCA 2AZXA 5TS2A 1TQ8A 3GLVA 2HGZA 4EG4A 2HMAA 1K92A 3LOQA 3H99A 1YUMA 4U7JA 1MRZA 4NDAA 4MUEA 4MWBA 3K32A 1O96A 3A2KA 2PFSA 1ILEA 1J1ZA 3DLAA 5TEWA 1KP2A 1JGTA 1OBHA 2XRYA 3H97A 2TS1A 1M8JA 3FY4A 2WB2A 2YWCA 4ZCQA 1WKBA 3VU8A 1J20A 1GAXA 1NP7A 1OWLA 1MJHA 1M83A 4JFAA 1OBCA 1TFUA 2QTRA 4MW2A 3DPIA 1VL2A 5H16A 1WQ4A 4RUKA 1WJGA 3Q10A 1J21A 4EGAA 3IMCA 4DDHA 1M8GA 2IELA 1HYBA 1KKUA 4MW1A 4ZCPA 3UK2A 1IQRA 1D2RA 3COWA 3ZXIA 1G59A 3VGJA 1WXHA 1SURA 4ZT2A 1KH2A 4ND7A 4F4HA 4MAFA 3ND6A 2DPLA 1T9GS 2J07A 1J70A 1ZH0A 3COYA 3IOEA 2ZUEA 1Q15A 2CFOA 2QJFA 2AG6A 4AS1A 3CVXA 3PXUA 5FO0A 2B7LA 1KR2A 3UMVA 4YP6A 1JILA 4MUNA 3IVXA 1K4MA 3ND5A 1N78A 3CLRC 3Q4GA 4GRIA 3NV7A 1H1TA 4WSOA 4PBTA 1KAQA 1OWPA 3IMEA 2DETA 1KH3A 2DXIA 4X0EA 1DNPA 3AG6A 4R0NA 1J1UA 3FETA 2C5SA 1I6KA 3AFHA 1F7VA 2O5RA 1O97D 2Z09A 4K0RA 1M8KA 4S1OA 2A1TR 2WSIA 1VBMA 1T6ZA 4MWCA 3VRHA 2YWBA 2CYAA 1V8FA 1NUUA 1R6TA 2A1UA 2RD2A 1NSYA 4G6ZA 5LLTA 2CV2A 1N2EA 4EG3A 2AKEA 1NZJA 2EL7A 1K4KA 1O94D 5EKDA 3C8ZA 3H9CA 3MXTA 3OP1A 2NZ2A 3FNRA 2QUKA 2WQ7A 1EFPB 1O95C 5J58A 1YUNA 1N2GA 2BTEA 4H3SA 5FNZA 3RJZA 2J4DA 4YP5A 1MOPA 3FH0A 1VBKA 4MW5A 4ZT3A 3CVUA 3CVVA 3COZA 4ZCTA 3ISJA 1WXGA 1N3LA 4Q93A 1JEEA 4K03A 3QE4A 2GKSA 3L92A 3M5WA 4MVWA 5HUJA 1Q77A 3X1JA 3N2YA 4EG5A 1EXDA 4I6EA 3P0HA 1QU3A 2X1MA 3CLSC 1IHOA 1GLNA 3G59A 1JECA 2DERA 2VTBB 2O8VA 1TEZA 1N2OA 5TGTA 5K0TA 4PBSA 1TYDE 4NX2A 4MVCA 5HUHA 3PNVA 2OQ2A 2CV1A 1MC1A 2QUIA 1NYLA 4EG1A 4MVYA 3COVA 3AKZA 2RE8A 4EG6A 3TZLA 4MW0A 3MLBA 1N75A 1EE1A 4JXXA 4PBRA 1YIAA 3DO8A 4YBRA 3AL0C 1QRUA 2D13A 1PFVA 1M8FA 3SDBA 3NBKA 1ZH6A 3A4IA 1O0BA 1JIKA 1RQGA 4NAHA 3KT8A 3HMQA 2EJCA 4CDNA 4ZT5A 3RBAA 3NBAA 1JEDA 2QJTA 1JZQA 1QU2A 1FFYA 2H29A 3KT3A 3KT6A 1PFUA 2A7XA 1S4MA 1IH8A 3AG5A 5K0SA 2Z08A 3D6UA 1T6YA 1O96B 3U1VA 1Y42X 4MUHA 4KPUA 4U8HA 5DEOA 1N2IA 4CQNA 5DB4A 3ND7A 1OWOA 1TYCA 4XFJA 2E18A 3A04A 3UY4A 1IRXA 1O0CA 3SEZA 4J76A 1JHDA 3P52A 4OUDA 3SP1A 4MUJA 4MW4A 3FWKA 3IMGA 1PFWA 1PG2A 3GMIA 3JXEA 3INNA 1U7XA 4HJRA 3ZJVA 1LI5A 3RHSA 3CLTD 1F4LA 3IVCA 1X8XA 2V0CA 3X1MA 1I6MA 1O94C 3CA8A 4FZJA 4ARIA 4MQ6A 2PG3A 1Q19A 1U7DA 1MAUA 4DLPA 1EJ2A 1GPMA 1NUTA 1J09A 3MUEA 3RFFA 5BNZA 1QQTA 2I1LA 3FG9A 2CSXA 1UFVA 3ZJUA 1R6UA 1QNFA 2ZP1A 3D6VA 2D54A 3HZRA 1CT9A 1KORA 4UZEA 1Q11A 3FIUA 3E27A 3HFJA 4MUFA 4ND6A 1KQNA 2D5BA 1I2DA 4AQ7A 3TQIA 1ULHA 4QBTA 4JXZA 1XNJA 2NSYA 3FHJA 2H2AA 4MWDA 4KKVA 4MULA 3BL5A 4ZT6A 3I05A 1GN8A 4NAUA 4UZFA 3N05A 3FDXA 5H7XA 1F9AA 2YY5A 4MW9A 1N2BA 3ILVA 4I6JA 2BYTA 1EFVA 2CT8A 2VXOA 3CR8A 3L93A 3H05A 3IUBA 3IUEA 4EG7A 4ZCRA 1NUQA 5JBNA 3SEQA 1WXEA 1QTQA 3SZGA 4MUKA 2R5WA 1P7PA 4DNXA 1ZJWA 4MLPA 2A88A 5DK4A 1N2HA 1WXIA 2DEUA 2A1UB 1G8HA 4F3RA 3TS1A 3OTWA 3QTBA 4DDKA 1IVSA 1B6TA 1XJQA 3F3MA 1A8HA 3S3TA 1V47A 4XSVA 1T9GR 3HL4A 4L2IA 3TZEA 2QUJA 4PY2A 1KH1A 4XFDA 1T6XA 3ZJTA 3IOCA 4KR6A 1H3NA 3IDFA 5FO1A 2A84A 2J09A 3H9BA 1G8GA 4RPIA 1WXFA 3TNJA 4NATA 4G5FA 3ZXSA 3ZIUA 4OJMX 3CVWA 4DDMA 2E0IA 5HG0A 3CLTC 2DLCX 3CLUD 5TEVA 1FYDA 2A86A 1VLHA 2A1TS 4QREA 2JAXA 1O95D 3GUZA 1EUQA
chains in the Genus database with same CATH superfamily
3C1AA 1NF3A 1T0HB 1LVGA 1XZIA 2AOUA 4ONEA 4OXRA 2BFWA 5AUQA 4ZV7A 3TKLA 2CMKA 2AL7A 3PP8A 5HK9A 1A2QA 3SICE 4EPXA 1QAQA 4HZUA 3L8GA 1ZD4A 1VLQA 2Q4TA 2Y1FA 3GMSA 2LIPA 2CDCA 1FUYB 3GDGA 3MAJA 3QTTA 5L6LB 1US8A 2IJGX 1SIWA 2F90A 2WFMA 1H3FA 3NIWA 5M04A 2ZYTX 1FOEB 3CT6A 4DPKA 5MFPA 3FDZA 2GXAA 1E6KA 1NI5A 3E1GA 5FLEX 1R66A 3LGSA 1QHIA 2BN4A 5E6UA 1FFEA 3DEHA 4AJ9A 2BV3A 1U8YA 4CNBA 1WV1A 3VKFA 5I7OA 2WWWA 4I6GA 4AJKA 1IY2A 1UFKA 3NWPA 1CUJA 4JDUA 4B3DA 4OLJA 1XTQA 2JD2A 3UUGA 1A8IA 4HPXB 2IRWA 3H83A 1P7YA 3HYLA 4ROSA 1DADA 2CJXA 1BO6A 2IXAA 5IZ4A 1MP0A 4BGUA 1SOWA 2XMCA 4JUBA 4LNHA 4LJKA 3RFVA 3K09A 1U6JA 1M6HA 1P33A 4E5NA 4TN1A 2JGDB 2GN2A 3R8CA 1TD1A 1Z29A 4WKGA 2NZUG 1P60A 1QZZA 1DRVA 4ZK6A 3ESZA 4Z9XA 2PGDA 3AB7A 1XTIA 1C1DA 2HLHA 4PIVA 1NFQA 4IMPA 5FOQA 1H2BA 1H6AA 2BGKA 4HAUA 5IBQA 1WWKA 4NSNA 4MV4A 1AK9A 5JXJA 2V6IA 1N9GA 2QQGA 3GBSA 4RPGA 1Z8DA 2LCFA 3D6AA 3HADA 4N39A 2ZRPA 4OGLA 2VYQA 3D8UA 3WGOA 2VDUE 4LK2A 4NHOA 1KS2A 1XDGA 4ESEA 5JDCA 1TO6A 2OXTA 4TL9A 3JR7A 1X7HA 1YQQA 3W6ZA 3ORSA 1JDBB 1S3FA 3NPMA 3T3PB 5FBVB 5AKJA 1H8ED 3AZPA 1KWKA 4H4DA 4BNKA 4NS1A 3ESRA 3KWJA 4KWCA 2QTWB 1D09A 2HV9A 3MW8A 4JKIA 2FXVA 5CVCA 2A78A 4YS6A 3TTVA 4CFSA 4RTLA 3UWSA 4MO9A 1VQ1A 1KYQA 5DASA 4DG9A 2J5XA 1ZP6A 4TRRA 4ITUA 3EYAA 3F97A 2HWWA 1EFKA 2PFKA 3BFXA 1OXUA 3U5TA 1T9CA 4KO4S 3VC3A 1N0HA 5D1NA 4PEVA 2FA9A 4J0CA 5KYGA 4LY0A 3O38A 1DRJA 3QNWA 1X70A 2HRDA 2HQRA 4OQEA 4Q3BA 1MENA 4QPJC 5TX7A 2XRZA 1FK8A 2C9ZA 1BXGA 2CVPA 4QWMA 3ENNA 3ZZMA 4QPZA 2WEKA 3K9LA 3NATA 4DABA 2X41A 4MZXA 5A03A 3JATA 4TRNA 1DTEA 2CKDA 1DXYA 2P6OA 1XMVA 2GUWA 4LDRA 3U4GA 1TA9A 1YO6A 2XQKA 4ETIA 5BUZA 1OC4A 3WK4A 1I7PA 3AILA 2FR8C 4RSHA 5U9CA 1L5ZA 2NM0A 4JLMA 2XF8A 1DEAA 2Z2ZA 5IKMA 3HGTA 3G2HA 4P93A 4WVLA 3V97A 3ZWVA 2RIPA 1AS3A 2HQOA 3KTAA 3UG7A 4BU1A 2P3LA 1SM4A 3B2QA 4OQZA 2OD7A 5IULC 4WZBB 2ZPTX 4W99A 4BO5A 4YRTA 2Q21A 3AV0B 1R74A 3G2IA 4AN0A 3F5DA 1XF1A 4GL2A 4A1FA 3S28A 2CLMB 3ETHA 5DW0A 2P79A 2X76A 3MRSA 1H2XA 1HEUA 1XXHE 3TLBA 4ABYA 3P9IA 4BJ1A 2Q3HA 2BLNA 3F2VA 3WO0A 2J4FA 3WK7A 2Z2YA 4FLFA 3RUDA 3FI0A 4IVRA 4DCUA 1JA9A 1EB8A 1JDSA 1NX9A 2FEXA 2I8CA 4JLDA 1HE4A 3PUXA 4QGAA 2SCUB 4BFLA 5I47A 4US2R 5LM3A 2GK7A 3GLRA 3MBOA 1UKAA 2PSSA 2WT9A 1HORA 1SEPA 3MUNA 4JBLA 1EDOA 2VEOA 3I39X 4NDZA 1HLPA 2R47A 3L9WA 1M3SA 4HYQA 5TS2A 3WKBA 2HMAA 3C5CA 4QUAA 4XJXA 1VSUA 1ZO8A 2PN1A 1NNSA 2GF0A 4U7JA 1ZM7A 3S1LA 4EGJA 3U3OA 2IDZA 3E7DA 2NO4A 4RCVA 1UT5A 3U3MA 2O8CA 1Q7TA 3UHFA 4C14A 1X8LA 5H3LA 3S8YA 4DA8A 2ZYRA 2WB2A 1FFSA 3NDBB 1MJHA 2O5EA 1ZKMA 3C8MA 3EWSA 1GRQA 3NT5A 4IYRA 4P7KA 4PZEA 1S3IA 2HHLA 5ETJA 3RRBA 1M6WA 4O2AA 3VMFA 5EG5A 3AF0A 2BGRA 4J16C 2GKGA 2HMSA 2PQMA 3MOSA 1K5GA 4KX5A 1UJ4A 2VJMA 3DW3X 2QDXA 1H0KA 4OQXA 2JDID 2NV0A 4P08A 3VNQA 5JNWA 2R8OA 2AG8A 3JYNA 2LXNA 1JAYA 2XE7A 1P31A 5H83A 3R3XA 4KPEC 4DZZA 2NPIA 1K2VN 1WXQA 2PSEA 1LU9A 5JRDS 4LNAA 5DKFA 1ZEJA 3FCCA 5FBHA 1CVIA 4QU8A 3QM1A 2CLDX 3STUA 3PDWA 4P5PA 3VPGA 1Q84A 1P1JA 2VHJA 4LZAA 3HN2A 3A1DA 1Y4AE 1J70A 3I2JA 2WYWA 3JU3A 4KWTA 4U2CA 4P80A 4XVHA 2PJDA 1IY1A 2OVBA 1R0WA 3Q87B 1W4LA 2VFAA 3G3EA 5A6VA 1RYDA 4P3XA 3OE7D 3UMRA 4AS1A 4IQ4A 1Y9AA 3DBLB 1KR2A 3C7AA 2J6BA 4KEAA 3NANA 3H9QA 3M5CA 1UMBB 1EJ6A 3DQPA 1ES9A 1II9A 1RWNA 3O9VA 4OMFG 5EP1A 4HDKA 2NU9A 1R0XA 2ZUUA 3H2YA 4YUVA 4PBTA 1KAQA 1GY8A 3WP0A 4MQBA 3S27A 4G0ZA 2PMWB 4B8WA 5HZGA 3GJXC 3QJYA 3HWSA 1P4GA 4KI0A 4X1OA 2DXIA 3EQZA 1LK0A 2DUWA 3I9NA 5AUPB 3AERB 4RK4A 5ESXA 2J9YB 3DMHA 3DOEA 5IUKC 1XTBA 4ZYLA 3HNPA 3QYJA 2JFVA 1BCSB 1DCKA 2JCGA 5LA6F 2CXOA 4PC6A 1RKBA 4H0FA 3UB3A 4FFPA 3A9VA 4P5EA 3ST7A 4E3ZA 3L7AA 3EX7C 3LK7A 4K9QA 3LKVA 1T5DX 1LJ8A 2CSUA 1E5LA 3IHKA 4M2LA 1L1QA 2YV1A 4K6HA 4GYWA 1LV8A 2XT6A 1NQ5A 4AF7A 2FGKA 1KEUA 3BGDA 3FJ1A 5D5PA 2WIKA 5DI3B 3SGLA 1FDIA 1KYXA 2H7CA 3CMMA 1PKEA 3SFTA 4G6ZA 5D84A 5HP4A 4P53A 3LQ2A 3AK4A 3K72B 3FSJX 1XELA 1J9ZA 2WSYB 3EG5A 5KVAA 3IEIA 3NP9A 3NDIA 3K70D 3C4JA 3V5NA 5A4DA 2IEYA 2K5UA 2KM1A 4FXOA 5K6AA 5E7IA 1JLLB 4UCQA 1Z4MA 1QKJA 1OX4A 3R8XA 4XARA 3TW8B 3V4FA 4B81A 2C4UA 1YB5A 1ZGZA 2F59A 3HVUA 2JZNA 3DEYX 3EFHA 1GAEO 1WKCA 2X4GA 3ZWCA 2F4VB 3RNOA 2YFHA 4S1PA 3CVUA 4ZTUB 1QPZA 3NUZA 4EHLA 3HKBA 3PXAA 3RV3A 1N6HA 4AP9A 1QB8A 4M1MA 2DHQA 4RK5A 3ZTTA 3BJIC 4MA5A 4BS9A 3IKTA 4Z51A 1Y5RA 3F1KA 5BOVA 1I2AA 4C05A 5JCJD 1EFUA 1LDMA 2FFHA 3HI4A 2JGRA 4UBNA 1RYFA 3UH0A 1MLDA 2FN4A 3DMPA 4PFSA 4TKVA 3BXGA 1E2EA 1W87A 3HV2A 5A6SB 4Q01A 4Z7NB 3PUZA 1AKEA 3DXXA 3TAXA 2ZI9A 5HKKD 4AS2A 3QYAA 5K8JB 2BZGA 1JHYA 2P9JA 4O0LA 5BN5B 2ZRFA 4H08A 2VJAA 3AIMA 3ORQA 4CM4B 1TYDE 4MR9B 1DAHA 2TMGA 5KSPA 1Z06A 1C30A 2VAPA 3KJXA 3QWIA 2UYCA 1G6HA 1ONBA 1ONOA 1ZLXA 4CCSA 5CVTA 2CV1A 2PRKA 1LDYA 2I65A 3TLYA 2FEMA 2FN3A 3WICA 5JMTA 2Q0HA 2CLLB 2PGJA 4L4UA 3BFKA 5L7WA 4Q0MA 5A71A 4D6PA 3I6IA 5T6MA 4UHEA 1YFJA 4UE3S 3V1UA 2WABA 2PLWA 5JCOA 4ABTA 1SBIA 2PX0A 3KUUA 4L0DA 3TSOA 1RLMA 2WIAA 3W06A 2DQZA 4BEBA 4JB3A 3K0CA 3I30X 3PEFA 2H1CA 1XRLA 2HK6A 1QRUA 3G2LA 3P26A 5IABA 3WRXA 3CR3C 1Z0UA 2UVQA 4A0FA 5I51A 3KOZA 1A7KA 2BGTA 3PHHA 1SVWA 3VR6A 3K0SA 5JJLA 3RUPA 3DMTC 4L9SA 3T61A 4B47A 1DUSA 1UZUA 2GHTA 4EFLA 4ZOLF 2PD3A 3BGWA 3NBAA 1MORA 2QAGC 4RVUA 5E38A 4BO8A 4F6LA 2O8DA 2M6RA 1NJFA 1DJNA 1FVHA 2LE0A 4NV3A 1TA4A 1FU8A 1FLAA 1I33A 1TX4B 4ZI7A 4JODA 4LHVA 1PHPA 2ZU6A 3D6UA 4TVKA 2PNJA 1SO8A 2I1VB 5TPZA 3UJ9A 1S2OA 3M70A 4PCAA 2OC9A 5DEOA 2Z0MA 5DB4A 3HR7A 4IW3B 4ZEOA 2VAWA 2W6JD 3D0RA 4MICA 4IV5A 4AP5A 1VSQA 4IDCA 1YU6A 5KEIA 4OUKX 1Y8CA 1Q1AA 2DPMA 2ZUSA 4X6YA 3I5YA 2UUAB 1GCGA 1WCYA 1G5IA 4X6XA 3A6EA 1PSDA 2HD4A 1PG2A 3G82C 4BTVA 5KOYA 5IARA 4C0QC 5LDDC 1A7AA 3ZJVA 1LI5A 1PZEA 3DD5A 4GPEA 1PDOA 3STVA 3TGWA 3MT7A 3BBLA 4B3MB 1XQYA 3K5PA 4M0FA 4X8HA 5CPBA 3IAAA 1XEWX 2EERA 4JFRA 3UV7A 4DIKA 1HZJA 3WV4A 1G7CA 3X1MA 2EX4A 3PC4A 4WK0B 4WOKA 5L3VA 2I4IA 4WECA 5CFNA 3FYTA 2FU5C 3ISVA 4C4PA 2XF2A 1N2CB 3AW9A 5EKUA 4AT1A 5SZHB 4DLPA 3R7WA 4QUHA 7GPBA 2NO6A 1X7XB 2RAUA 1Y8QA 1J09A 1KAOA 2PV7A 3CX3A 3NWOA 5C7YA 3ENVA 3GLGA 3O92A 2V7PA 1BKYA 1V7ZA 3M82A 2NUTA 1PJSA 4EFDA 5JOQA 2UZ4A 3CUKA 4A82A 4KPFC 5AM3A 4QZVA 4K6CA 2HF2A 4ZV9A 4G3XA 2BEUA 4OOEA 1KQNA 3UFBA 2H7VA 4CG1A 4F9TA 1SKYB 5JSUA 2UZ0A 3KWLA 1GLGA 1XNJA 2NSYA 3HLYA 3UF0A 4F71A 3GPLA 3G0HA 3L8EA 1I0ZA 2GBCA 2HRZA 1BRMA 5CJJA 2IS4A 3IP5A 3JWIA 1GGEA 4PCVA 4RF3A 2YOFA 5LMZA 2A3RA 5JANA 1CYEA 2J7PA 2JFFA 1UAGA 5T4BA 2FWJA 3NAZA 5CVJA 4ZGWA 1C7QA 3PHJA 4FYJA 4ALNA 1WUKS 4S1VA 3VUFA 3H5TA 3O1HB 5H7XA 3ENQA 1MPXA 3ZGOA 1J97A 2J3DA 3L3BA 2ONCA 1XQ6A 2VRNA 3ILVA 4KZKA 4B44A 3AVVA 3WTCA 4E15A 4AJNA 5C8DA 2YL2A 1V7CA 3OIUA 4YDRA 1ZAYA 4BKOA 4R16A 3P0RA 1MA3A 1G9TA 1YRLA 2QI9C 5EUQB 1N6PA 2D5LA 3W5DA 1UWKA 2V96A 4K2HA 2JFPA 4MB2A 1P7PA 2HDHA 1DRKA 1BGWA 1A69A 4R2IA 5BNIA 1K6JA 1CIPA 1Y5MA 1QORA 3RVLA 3IT0A 2OAEA 5A7GA 3THXA 2OENG 1V8PA 1UCFA 1XIVA 3QEOA 5ADUS 3OY2A 1G8HA 1NW6A 2QN8A 1VE5A 1EZ4A 4MGZR 3S2IA 1U3UA 1L3CA 3CPJB 3VR0A 1RM4A 2DJ5A 1P81A 3M9LA 3Q0IA 3I45A 4PRKA 4R31A 4C7OA 2CC2A 5LDGA 3ZBTA 5C1IA 3JQFA 3EARA 1N1GA 1T4CB 4M1OA 2VUIB 3T5BA 5IDWA 2PH3A 1O4VA 3E3LA 3L4EA 2PUVA 3HDTA 2X8JA 5JS1A 1UDAA 2WJIA 4I99A 5F52A 5C5IA 1P4AA 2ZI3A 3LX4A 4MRAA 3WA6A 3SMQA 1CP2A 4TXNA 4RV5A 4GLJA 3G8CA 5D00A 4BL5A 5T6BA 1YR2A 1KDYA 4ESHA 4DXHA 1FSPA 4TQAA 5LOVA 2I2XB 1BXKA 4OM8A 3IP9A 2SKDA 2DFLA 3UHPA 4ZZIA 5TJ9A 3HYCA 2XX3A 5K6AC 1CUHA 3MELA 4JEIA 2LVBA 3D8SA 1AHNA 2ZSJA 1TT7A 2ZRBA 2PFGA 1PR6A 3C1OA 2O8EB 1RS0A 3H2GA 4CLDA 1JDNA 3EZ7A 5DT9A 5JG7A 1EFRD 4PU0A 3PVSA 5LN1A 1PSWA 1KA9H 1MH9A 3ZHZA 1GG9A 1I1NA 1Y9DA 2E0IA 3GJSA 3OZFA 4RM3A 4MGHA 1RYMA 3AJDA 3TZCA 2DLCX 2I6GA 3NHPA 1KJWA 4G5HA 4QX6A 3DBHA 4EJ6A 3U7FB 5FI1B 4KO8A 1UT6A 1GQYA 1HT0A 4G1VA 1RCUA 1EXVA 3CRMA 4NONA 4OMUA 3V33A 3X1ZA 1E7SA 1MH1A 1OKKA 2WILA 4REOA 821PA 2PIDA 1IN5A 1GZ6A 1XCPA 3W5UA 2ZE7A 3HCNA 3Q5DA 4C30A 3UJ6A 4GGOA 1J39A 3ZHBA 2QMYA 5FPQA 2A4MA 3HLKA 1L5OA 4Y7CA 4L1KA 1NBEA 2VYNA 3BMNB 5IZCA 10MHA 5JTTA 2B5OA 2R8XA 3P4YA 4N5NA 4MCIA 5P8WA 4OYLA 3LT5A 1PG5A 3RT7A 3T3HA 3HKDB 4JL6A 2DX7A 1Y8AA 2XUJA 3IS3A 4LYDA 1DJMA 1R0RE 2VLBA 1E1YA 3BSSA 3LGXA 3QVWA 1UMCB 4OXKA 3T15A 4AIRA 4RULA 5CT5A 1FSGA 1HDIA 3CLSD 3K9GA 3OLWA 4KQ9A 3A58B 1EIWA 1M54A 3IQEA 1ZUNA 1ACJA 3IT1A 1AVTA 2H51A 4GMFA 5JCOC 4D0NA 5LVAA 4IDNA 1Z62A 2IIBA 4PG7A 2VCYA 1QC5B 2V6MA 3G9TA 3K0CC 3QXSA 2ZRDA 2ZB8A 2QU8A 1M66A 1JFVA 2BC9A 3A7DA 2QQ5A 4FFOA 4D3XA 2B2XA 4XWKA 1E6WA 3HQ4O 1V3UA 3FCYA 4WI1A 4LWZA 3VNAA 5DHUA 4DDTA 1F0YA 1MRNA 5EP4A 3GC6A 3MFQA 4EBFA 4YR9A 2WIGA 4RYLA 1SRQA 3EK2A 3N2LA 4OUDB 5AKGA 1RE1A 1C3EA 1RD4A 2N0SA 3PNLA 3T9EA 3KVOA 1ZD2P 3RVSA 3QVKA 4YI5A 4BIMA 1TYEB 1VYUA 3G89A 4ALIA 4FFLA 4OGKA 2G07A 2VNJA 4Q24A 3RO7A 2DAPA 3RUFA 4AB1A 4L6IA 2YZGA 2V7EA 7AT1A 4MIKA 1PEAA 2WG0A 4IJ6A 4YMIA 4YWHA 5LLSA 1YZKA 3C41J 1X9HA 1E77A 3ZWPA 4DLXA 4MQFA 3VSAA 1F1BA 2OYRA 3Q9NA 4GZ3A 4ZCIA 1KMCA 3VDXA 3ZBQA 2PVPA 3BGVA 3HA3A 3FOCA 4II2A 2G76A 5EWLA 3DKIA 1W4AA 3IUJA 1GGJA 2OESA 4RESA 1WSWA 2FN9A 3VU0A 5JY6A 3HXOA 3HKEB 3NXKA 1RCFA 1MB2A 4MQ4A 6LDHA 3O4IA 5KCMA 2OTCA 2Z2KA 1L6RA 2H0QA 3H2IA 3RVDA 4OXIA 1W7AA 1ECBA 1SUPA 2X9NA 5CG2A 5FTKA 1NZFA 2B6NA 3LO5A 2QQEA 1I1QB 1Z17A 1RT9A 3ESBA 1Q14A 4I5DA 4LOKA 3ANNA 4HJXA 4UPVA 3T0GA 3TKAA 3U7JA 2Q1XA 1AUXA 3PC2A 4MV3A 2B20A 1LBTA 4AO6A 4YDQA 4IEEA 3TL2A 4AVYA 2XEDA 3OHMA 4CYMA 2LDBA 4CMAA 3NUQA 2ERXA 3EGCA 4AMZA 4FE3A 4OM7A 3O91A 3OA0A 3EQ9A 2XBLA 3W1WA 5FUXA 3WG9A 5AM0A 5A5DA 3WBJA 2GZDA 1NF8A 4Q1BA 1G9XA 1GUAA 4LHXA 2EC5A 6CHYA 3GLIB 1XMXA 3O03A 4FZRA 3FYDA 1U2DA 3FX2A 2XQFA 4YH1A 5E4JA 3WLOA 4C21A 5I4CA 1KQGA 3H16A 2OMEA 1MJNA 5SY4A 2JHCA 2FY8A 1IFXA 3C1UA 1GV0A 3GW8A 3D2BA 2ECPA 4AZ0B 3ZWXA 2PH1A 3D7MA 4OLFA 4RZSA 4DQXA 4C0HA 1JQ3A 2UAGA 4L75A 1LVUA 2R85A 3CZCA 2FFAA 4K3VA 2BGJA 3V1MA 4AZSA 3C6MA 1NLZA 4RH0A 4BNDA 4DMCA 3EVAA 4EYEA 2YHSA 1JJIA 3SM9A 4YXWD 1E4OA 1P73A 3MPUA 1JHXA 2ZR8A 4MWOA 4JOQA 1B1AA 1ZAKA 3CC8A 3P9XA 2Z6VA 2BR3A 1Y7HA 2EWVA 1RZRD 3RYCA 3I9FA 2D5AA 3I6ZA 3LD9A 3LWDA 2FFJA 1NBWB 2FPWA 3D5EA 3LHFA 2J9RA 4OMDA 1QH1A 3NM5A 1NT4A 1USVA 3AKEA 2GR9A 3A9RA 4XZ3A 3WAKA 4EUNA 4CDMA 4RLQA 16PKA 1Q1ZA 1CQWA 3OFSA 4H6PA 2DOKA 2Q50A 1QHSA 2AJDA 2I4MA 2WJ4A 1W2WB 4AM8A 3JQFC 5LBIA 1ATZA 4ED9A 5BSFA 4Z4FA 1M2NA 1M6VB 3HBNA 3LHKA 3HYTA 2WFLA 3E03A 4JH0A 2W6MA 4HTAA 4TWIA 5KX5A 4MI9A 2P90A 3FR8A 2PFSA 3DQZA 1J1ZA 1ILEA 5TEWA 1KP2A 3EN0A 4HMOA 2B1GA 4TWRA 4JLVA 4MQ5A 3AP2A 1WKBA 3WRYA 4GSLA 5JT1A 2VJBA 1F0NA 3T7KA 3ADCA 2DH6A 1SOUA 5B12A 2QV0A 3VI4B 1ADGA 2HX1A 4UPDA 3B36A 3BRCA 5TLSA 2WUEA 4BV9A 2XIQA 2GPJA 4RUKA 3PVCA 2RK4A 3CURA 1YASA 4PPQA 1EFHA 5JXHA 1J21A 1GWNA 1B6RA 1DE0A 4DDHA 5EEGA 4AQDA 1KKUA 4HH4A 1TCUA 1VE6A 3JZMA 1QO7A 2OE2A 2VP0A 1ZLYA 1IAQA 4Q3CA 4RPHA 4BNLA 4FC6A 1BS1A 1UKYA 4GGPA 1KZ1A 1UBUS 5KYUA 1Q0UA 4F4HA 1RSZA 4MAFA 3KJIA 4WCFA 5E0OA 1UBEA 3ZD7A 3TXAA 1ZJZA 3I0NA 1N34B 1TMOA 5L7TA 3VPAA 2O9JA 1JFLA 2PWYA 3RT9A 2ZCJA 1XE3A 1YC2A 2OYCA 1ISFA 3DHWC 4JGBA 2JI8A 1S8OA 4W1RA 1LSJA 1WCV1 2AS0A 3MS2A 4NYIQ 4OKNA 3UMYA 2F8SA 2CXNA 1J6UA 3KWMA 2FMKA 4FD2A 3E23A 1CQPA 1M2VB 1KK3A 3GJRA 3P45A 4LE0A 2FZ5A 4W82A 1SKMA 4BNGA 1HMPA 5AI0A 4MUNA 5DNEA 1RZUA 5BT8A 1AM4D 4GOKA 4ZVKA 1LK7A 5FNVF 5HBGA 5I9TA 3SF8B 5EHIA 4GRIA 3WC4A 4AWXA 2RGRA 2V0NA 3CZMA 4KN6A 1YHNA 1QONA 1M73E 3A31A 4FOPA 3GGOA 4OREX 4TS3A 5KIAA 2B9VA 4P83A 3IJEB 3GB9A 5FAXA 1DNPA 3AG6A 4HNRA 4P31A 1PCXA 3TSAA 3KQUA 5CJPA 3L4BA 2DKNA 4PRLA 1XCJA 1E60A 4DNFA 3MRVA 1ID1A 1I6KA 1ZBQA 5HFAA 2JCXA 2Q3JA 5DYIA 3ZH2A 1C0IA 1O77A 4FEYA 1S8NA 2IEZA 1IZ0A 3SYNA 2DHCA 5JAZA 4TZ0A 3R4VA 4WNIA 3FM9A 5LJIA 2PKRA 1EDBA 1LXCA 4GPAA 3JALA 1N7GA 2VSOA 3NWJA 1BFUA 2R97A 1E9DA 4NZMA 4QDTA 1QE3A 1D4FA 1U0EA 1MW9X 2G3YA 4G9BA 4NJMA 1DEKA 2JKYA 5F5NA 1TQDA 1EBUA 1K4KA 3AH8A 1R6AA 3GN1A 3SLRA 3X1YA 1DZIA 2R4TA 3JVDA 4QU0A 5ALGA 5A3SA 8LDHA 2RG1A 1XMPA 1XZLA 5AKKA 2O0HA 4MVJH 4NIMA 2QY9A 3UNXA 2Z9BA 3KB6A 1EFPB 4DSNA 1VP3A 2BTEA 1J0BA 1K68A 3O2QB 4EKYA 3IAEA 2P68A 3F46A 2IHTA 2EQ5A 2QMOA 5IC4A 4DMRA 1VBKA 4LZZA 3W04A 1E7QA 3M4ZA 4QYIA 3BGOS 4Z4EA 2FP3A 1XDWA 1W49A 1PR1A 1W36B 3WA7A 1GPWB 1H4TA 1N3LA 4F11A 4HNVA 4K03A 3MT0A 1V39A 2XLBA 2CNLA 4DNPA 3AZOA 4R68A 4RPCA 4XFKA 4UMEA 1CHNA 5DM70 1UZMA 2EHJA 3P94A 4YJ3A 3W90A 3WR5A 1U1FA 4PPNA 3HGQA 3UTDA 3DZGA 3P4UA 3K4PA 5AVTA 4YJDA 2A92A 3WDMA 3DBIA 1THMA 3H1TA 3U44A 1MT3A 2I2FA 2WKQA 5DTRA 5ILGA 2OKCA 2WAXA 5L3SA 5FA8A 4JJ8A 5HKAA 1BE0A 5HJ7A 1QV7A 2OQ2A 1IK4A 2PHZA 4XTCS 1UOPA 4XX1A 3DTYA 3SQWA 3O95A 1N8SA 3D2LA 1EXNA 5ALZA 3LJKA 5F1OA 2VBGA 1P1HA 5MN4A 4PXSA 1BDBA 3COVA 5F21A 3UC9A 3CSUA 3JD2A 3MPOA 4TLLB 5IS2A 3AKZA 1SD5A 1U2DC 5GIOE 1N75A 1QOQB 4IHJF 2ZSDA 4GQBA 3N3BC 4OOFA 1Z9BA 1ZCJA 2LWIA 2JS7A 3OECA 4EY4A 4RKEA 1EFDN 3C4VA 4GL4A 4AG3A 4CIBA 4WFIA 3RS9A 1F3LA 1ZWKA 2HO4A 2MCFA 4C6SA 1R5BA 3ANLA 3OX1A 1BH2A 4ZREA 3NMUF 4GKAA 4NAHA 3PRJA 3KT8A 4QVKA 3E9QA 3OQPA 4AECA 4UVGA 4Y2UA 1F0PA 1LZLA 1JSXA 2IYPA 3GDOA 4Y6LA 4WUVA 2IUUA 1JG7A 3CZ4A 3NEAA 3QOFA 3HY6A 5A4MS 1FFYA 5HTKA 1PFUA 3GVIA 3U7IA 5ER6A 2JGDA 3IALA 5D6OA 3NP7A 4MUHA 2G9RA 5CA1F 5KTKA 1FSSA 1UDCA 2YXBA 3V1KA 3ZY3A 5CB4B 1O0CA 1RXEA 2R6HA 1J0AA 5DTMA 2OCLA 4JNKA 1PFQA 2RHJA 1TQ4A 4HMPA 4J76A 5LYJB 4IXNA 1L5QA 1XHLA 1GNQA 2YQ4A 4BEVA 1QR6A 4PIMA 3FGPA 1K9VF 1AXRA 4MJ7A 3D4NA 3KCQA 3UWKA 1Z2CA 3GJYA 3HE3A 4E5MA 5IVIA 1UJ6A 4KMMA 1JEQB 3DF7A 3HM9A 3QF4B 1RTKA 2R48A 4ZI5A 1LBIA 1UDRA 1EE2A 2ZJ3A 3LUPA 2XB9A 5TMBA 3WRYC 3BFPA 1WD7A 4A8PA 3BHNA 1IWOA 3A4YA 3FFXA 2PS3A 1U2ZA 3G7NA 5AKEA 3DV9A 1D2AA 1K89A 3HO8A 3QSYA 5C8YA 5G53C 1VI6A 1JHMA 5EHGA 3SE7A 4V0NA 4QDXA 4TMVA 3GUHA 1GVNB 2B4QA 2GCNA 4UCFA 4WX2B 4XD2A 1EYZA 1YZYA 1I4LD 1L5HB 1KJIA 1FP1D 1YFZA 1K5HA 2DUNA 2ZT5A 5KUTA 4OX9B 3L1KA 3ZVMA 2XVMA 4GQIA 4V0SA 2Y1KA 3AR6A 3RRXA 2CXQA 4PWYA 2P4HX 4YLYA 4I50F 4JJZA 2GTPA 4XR9A 1UJ5A 1IM8A 4B3FX 4F7DA 2G82A 2VWQA 4JXZA 4O1IA 1O95A 4JP1A 1ILWA 4E30A 2XUDA 1AK2A 3G8YA 3IV9A 4IRXA 2LKCA 4WY8A 4D8YA 1F6DA 1E2FA 2D00A 3ZPXA 4R1NA 1E79D 3D6HA 1D2EA 3JASB 2JIOA 3Q7SA 2QPTA 2PSHA 1WUJS 4WCDA 4C7BA 4RVOA 4B34A 2EAUA 4Q12A 2ZS7A 4PSCA 1DDGA 3AGQA 3LF1A 5M7EA 4UDNA 4UFOA 4X91A 1Q50A 1X7GA 3H5LA 1JT2A 3JAWB 2CT8A 4C06A 3E5RA 1Q6YA 3O4RA 2W2XA 3KR0A 1EJBA 4KAFA 3IUBA 3L8HA 2O57A 3WOHA 4BMNA 1FFWA 3CF6R 2W6QA 2PGNA 1Q91A 2ZYWX 3PFWO 3GDHA 4WFKA 5DX1A 1UM8A 5JBNA 2JLAA 4ZOLB 5AJVB 4WZBA 5C3MA 1RRPA 4G1MB 4HAZA 3BRWD 4E08A 3ZGVA 2Y71A 2XCIA 5GOTA 3N86A 5HKLA 1ZC4A 4RACA 3EE6A 5BT9A 4XSGA 4JYBA 4TUYF 3JQ7B 2Q3BA 1FDSA 1B73A 1JR3A 3M4NA 5K3DA 4C4XA 1BE1A 3LUHA 4E7PA 1IVSA 3MB5A 2ZCVA 4HXEB 5EMJA 5GTDA 1DIGA 1EGVB 2Y4OA 1LSOA 4R8RA 3T3OA 4HADA 4KOAA 3EVEA 1NV9A 1T9GR 4BNIA 1HQCA 2SCUA 1V1MA 4HTFB 3TZEA 3W2IA 4QGSA 2B82A 2VF7A 1XD9A 2GCEA 3O8BA 1H3NA 2XYPA 2J9ZB 1V71A 3I32A 3RSZA 3AM1A 1N6NA 1XCBA 3K1AB 4URHA 4OATA 2PXCA 4DW8A 2CVHA 4AJ1A 3AP3A 2HNBA 2XAUA 3AJRA 1XNRB 2ZOSA 3OOWA 1T0PA 3EULA 2BTQB 3G5UA 3MJSA 3EXHB 2YV5A 2AJ8A 1ZIXA 1HQKA 2NSJA 4PR3A 5E9AA 3B8EA 5TQJA 3QE0A 3SEAA 5B7NA 2HU5A 1E4VA 1L5FA 2ZB7A 3HR4A 3WDLA 4NMMA 1M1XB 3L18A 2PH7A 3QRWA 3D54D 1SU6A 3CLTC 2GK3A 1G16A 2R3SA 3N0TA 3N70A 4JP8A 5EJGA 2EP8A 2VH1A 4PANA 1VLHA 4PN7A 3EUEA 1HOXA 3WHPA 1WSBA 3GUYA 3TW6A 4EB6A 1M2HA 5LB4A 4EMUA 4ENQA 3JRNA 1V8ZA 3GUZA 4DCVA 1JEYA 2L0XA 2O05A 3HDQA 5A02A 4ND1A 3TZBA 2I33A 4DIOA 1X13A 1SIOA 2VPWA 5ELMA 1YQEA 4AX4A 1XO1A 3KPYA 2GK6A 5EJAA 1AKUA 2NTVA 4S05A 3A05A 5AW0A 1R6XA 4ETMA 1USGA 3G8AA 3CT4A 1FRVA 2GN1A 3NTUA 5DTQA 3RKSA 3ZI4A 1GFIA 2AYXA 2YHIB 1RPTA 3CXRA 1RRKA 4ZMRA 2YFKA 4GNRA 2XMRA 2XD4A 4ZJUA 3J7TA 1WQ3A 3MWYW 3R6WA 3CX8A 4D2IA 3QKUA 3FTDA 1NUSA 2ONKA 2WYIA 3BXOA 5JDIA 1MAWA 3WNVA 4C3VA 5A0FA 3VKVA 2ZQZA 4FEGA 2I29A 3DBLA 3TNLA 2OWDA 4PLZA 5DHTA 1QYDA 4A6EA 1A27A 1ZY2A 1MC5A 2N1MA 5ADHA 5LFAA 4G63A 5LLDA 4YRPA 3ZK9A 5SZJA 1UMBA 1TU4A 3QYFA 3T7IA 4IZOA 1GA1A 3PEEA 2GVNA 4CEJB 3C8UA 3ZEIA 2DBRA 3ZE1B 1ZSYA 5C31A 1E7MA 2CLKB 2VUSA 2CHGA 5C5DA 3AR8A 1I51A 3HJCA 3HP7A 3VH1A 5K0FA 2JHFA 3AERA 1Z4NA 4F92B 3Q40A 3EPRA 1TB4A 4GU5A 3O74A 1E0JA 1BCSA 4UCXA 1AN9A 3WFZA 1NFFA 2ZRCA 3SC2B 4J90A 1Z0ZA 1H22A 3V8NA 3V9PA 3DAPA 2C3UA 1QWSA 2WF7A 1P61B 4Q16A 4KX3A 4TM8A 4C5AA 2ZTSA 1MV8A 2H1WA 2HYDA 2JZOA 2GO1A 3I6YA 3OH8A 4M87A 1V6SA 1XKXA 4O2BF 4YMWA 4DLTA 1RI1A 3IV7A 1PJRA 2W0MA 3FZNA 2V6GA 5DI3A 2ZI6A 4AMYA 2BEJA 4P32A 2R1UA 3ZUGA 3W5JA 1MDFA 5IJ9B 1FRQA 2FQXA 2W98A 3KXPA 2XE4A 3OTHA 2DR2A 1ZVJA 1VJ5A 3BEOA 2W48A 3JTMA 4FNOA 4LSWA 5KKAA 4F45A 1HOTA 1SUCA 1CZKA 3L82B 3FF4A 1G3UA 2IYWA 1RLJA 1E2LA 3AWIA 3H5WA 1A5AB 1YC5A 4R5HA 1KC3A 1SFRA 2NXNA 2ZE6A 4F04A 1XMQB 1OAKA 2ARKA 1A98A 3E6AA 3PUWA 1G3RA 4DJ5X 4EW1A 4NYIR 5IYZF 3AYXB 3TW8A 4IKOA 3TH5A 3LX6A 2IY9A 3EAGA 3ZJ4A 1JNXX 5E6RB 2RAVA 3SMVA 3UPUA 4F06A 2XB8A 2R44A 2DP4E 4YUXA 1OWMA 1O5OA 2GXQA 4KNWA 2FUG1 2YQZA 1FX0B 3UHAA 1C1YA 4C78A 1M67A 3RUIA 4PFQA 1D03A 3S7TA 2CXSA 3JWHA 1FFXB 1T0JB 2A6PA 3Q9LA 1K6MA 3HGMA 3OF5A 3ED5A 1YBVA 4Y8VA 1AF7A 3GRKA 4I8IA 1YZVA 2VXCA 1DXHA 3WHIA 1PG0A 1W0KA 4BB0A 3U4QB 3HB5X 4YRGA 5IJXA 1CJTC 5A6SA 4OQPA 1G3IA 1KTIA 1E0AA 4UEOA 3ADKA 2VJPA 3K31A 3JVEA 5AI4A 3MMXA 5BN5A 5C4MA 4D96A 4LNUA 2WAYA 1O6BA 4E1AA 4HGYA 4MR9A 5BN3B 4KIJA 1BWPA 1XVVA 3NLLA 1RXCA 4UATA 1A2KC 1X80B 2QTCA 2P3SA 4FJ1A 4BCCA 4MYSA 2OLKA 3T7JA 5I3CA 1U9IC 3TRFA 5EQJB 3F4KA 3JD0A 1JHUA 1M72A 4IVNA 4I8DA 4BKRA 1J8QA 2PMKA 5A7FA 2NYAA 2Z3VA 1GCUA 4Q3AA 3CTMA 5AUNB 4LI3X 3F8SA 3KKNA 2BCGY 3UENA 4DCOA 2RJOA 1E20A 2YZ2A 4TL7A 1ZJYA 1ZOSA 2D8MA 2NU6B 4PLTA 3PQDA 1CYDA 1C8BA 1UBMS 2DFPA 1HF3A 1XQ9A 2AHRA 5ESDA 1TMGE 2O1EA 2VHQA 3F49S 4KPGA 5AW8A 4X7MA 2AB0A 4B3SB 1KVRA 3W4IA 1KSJA 2OZVA 4C0XA 4ZI2A 4R1UA 4NCJA 1GG2A 2C92A 3CZAA 3TNDA 3ZE0B 2ZWVA 3LL7A 4FFWA 1FU7A 3A3PA 4FYMA 1CZUA 3DXFA 1JQKA 4PLWA 4W7HA 1C1XB 2PCLA 4AXBA 3OOEA 4M0KA 1BXZA 1Q7CA 4QM7A 1KPGA 2XRYA 3V6LA 2YJNA 3FY4A 4RMIA 1SXJB 4D9GA 1LNQA 3E8XA 4KXWA 2ZM6B 1V96A 1P80A 4JLNA 4LCBA 2QWXA 2ZXUA 2YOHA 3NDRA 2AOWA 2NZ8A 3PCTA 4N40A 5LZ5A 1EZZA 3AF5A 2G0NA 2PZGA 2QTRA 4AMUA 5DNAA 5IT0A 4KE7A 4RKQA 1BW9B 3E70C 1ORVA 3KLOA 3NGLA 1Z28A 4R3NA 1F8GA 3UZUA 4FWBA 4IIYA 3CX7A 3Q10A 2VZ9A 1P45A 3GWZA 1H85A 1Y8ZA 4O4HF 3G5TA 3W6NA 2H65A 4DHWA 1C0LA 1EK6A 2C99A 4OA5A 3JRXA 4ODIA 1MB0A 5K0JA 1N2CA 1XEWY 3D4BA 2VK1A 3VFDA 1EU1A 4L7VA 3DNMA 3E05A 1X7XA 1IQPA 2CLSA 2VI5A 2XAAA 3UBMA 4Q37A 5JAHA 4JVSB 5HIKA 4N3AA 1UPUA 1G4UR 2YY6A 4U9HS 1XPUA 2X40A 3LPDA 3ECAA 1A2OA 4M8LA 4OA8A 1XB2A 1XTZA 1UWCA 5TV2A 5J23A 1XZBA 1YK0A 3TFOA 1QYVA 4PGMA 4ALKA 1V16B 4Z7JA 2B37A 4E7OA 3KKLA 4DV0B 1NIPA 4F21A 2KSQA 4D45A 2ZBRA 3GGPA 2CVQA 3CKMA 2A59A 5AVYA 1IVYA 1E1NA 2ATXA 4URWR 5JXWA 1FF9A 1NAHA 2AR9A 2I4TA 2PV0A 3OQ1A 5GGYA 3N6XA 5F78A 1SKUA 2HI0A 1P0IA 1XHEA 3WQRA 3QZUA 3KEFA 5JZ9A 3HCRA 4N01A 2BEWB 3NVDA 1SZDA 3L6EA 2XOKA 4DR2B 3KZOA 1WSAA 3S2SA 1NATA 2C7GA 1JFFB 5FBZA 4DLRA 4U7GA 4NH0A 3GK3A 1KDTA 2QRKA 2JLCA 3FLAA 3CZQA 3ZQ6A 4CMEA 3I1IA 4LEIA 1RYBA 1OZ0A 5AXAA 4C3ZA 1PZHA 2GBGA 5FYQA 2UYYA 5KTOA 4FR0A 1L9XA 2XCQA 1QG2A 2DBQA 4ECEA 4WLUA 1AMUA 1YZ3A 3IRVA 2EU8A 3F71A 3RVJA 1KBQA 3TQCA 2IBSA 4FHEA 1JKMA 1ZD5A 4EG3A 2AKEA 4BUCA 4BATA 1MJGM 1N57A 1F14A 1G5HA 1U7PA 3M9XA 3DWEX 3OAAD 1XLVA 5DWDA 2C8JA 5HF8A 4DGSA 5ALPA 1LFDB 2R1VB 3GBPA 2ZKIA 1T4CA 2B1QA 3LKDA 4KDFA 5EKTA 1RKVA 2CN1A 2RGUA 5CDGA 1IZZA 4KYUA 4PSDA 1IXKA 2JH8A 1TAUA 3LQFA 1M0TA 2JAUA 2DFTA 2HMUA 3JARB 3PGA1 4YRKA 1C9NA 2YH2A 1DX6A 2QD4A 4MGEA 4PX5A 1PWHA 5JS2A 3RRNA 4RD6A 2B6HA 2C84A 2FJPA 4BKPA 5E7QA 2YJGA 3CJTA 4YT2A 1OY1A 1ZRSA 3F67A 3TOCA 4LX0A 1N3IA 2Q4RA 3CWZA 1I3KA 1EK2A 1R0SA 4GUAA 4X64B 5CDUA 3M5WA 4QE3A 3HB7A 2X0IA 1J42A 3QU9A 4D9KA 2O8EA 4GO1A 4TN5A 3I5MA 4O4JA 5CGZA 5CVUA 4I9NA 4E2ZA 4GPTA 3K4HA 4LXQA 3T7EA 1VCOA 2YXEA 1H0SA 5C1OA 3NKFA 4J0FA 3G59A 5SYMA 4DCTA 4OQYA 3LQ4A 3OE1A 2OCGA 4L4ZA 3AZQA 4J0QA 1JECA 1NMSA 1WXDA 3QVGB 4OI2A 5LB2A 4M9XA 4B79A 1XLTA 3RAEC 5J1TB 3FUUA 1T8UA 4S2UA 4KACA 2XBUA 4G0XA 1YWGO 5TGTA 3GPIA 1Z2EA 4N4AA 3UMMA 3KUDA 1N3BA 2ETXA 3R2JA 4MVCA 3ZLJA 4EDHA 2XGJA 2NTEA 4G1UC 4DB2A 2EV9A 3WYBA 5GMOA 3H6GA 5KQLA 1ZFNA 4NU5A 3AY0A 2H1FA 1DKPA 1DO0A 1YZTA 2IEDA 1AXEA 3OEHD 4M0PA 1CLEA 3I52A 2WYVA 2HK8A 3RI3A 5FEUA 1BDMA 1GPNA 3SOPA 1YJ5A 3BMNA 4MVJA 3A10A 3RROA 3CRW1 3X1XA 3TQFA 1H4QA 1OIXA 1YIAA 1JKFA 5AICA 2WY2D 3HKDA 4L07A 3HB0A 1L7OA 1UMCA 3QJGA 3RFXA 1USWA 3U19A 1ZH6A 5J40A 5LZ9A 3A4IA 2Q4OA 5BWNA 3D7KA 1MAVA 4LC9A 2AOTB 4FMBB 4J7XA 3UAWA 2Z56A 2C1ZA 5DYYA 4MCHA 1ID8A 3E5HA 2E1PA 3BB4A 2ZJ6A 3F98A 2ZTLA 1EESA 1QCZA 1M10A 2FHPA 1QC5A 2GUGA 4QELA 5HEKA 4BGEA 5KJ1A 3AG5A 4UU7A 3TE7A 3IDAA 1PQWA 1EHYA 3CR7A 3LGAA 1VL1A 1WDKA 3ZGXA 3UT0A 3PJEA 4X1KB 2E18A 1B0UA 1KDVA 4L74A 4O33A 4H7KA 3TDMA 1JHDA 3ZDRA 3IQIX 3HVKA 3PQ4A 4ZOAA 3HA5A 1NVKA 4OUDA 2KMLA 4EJSB 4L4SA 1O3YA 2YMQA 7ABPA 5JZMA 1SK8A 3JXEA 3INNA 1ZZGA 5JI3E 1T4GA 1ZRMA 3OFVA 1TYZA 3AYZB 3OEYA 2ECQA 1JNYA 1ZJ6A 2O1XA 2YICA 4FMDF 3ZXUB 2XT0A 2GN0A 3NBYC 4KQ6A 4G23A 1P7VA 1KI8A 3N8KA 4IJUA 2DY0A 1PZXA 4EABA 2DSTA 3FUWA 3EDRA 2Q3MA 4L5BA 5AFSA 3TG8A 2Q3EA 3G9QA 3RS5A 1M1YB 4AN4A 3ZLVA 1CCWA 1W8DA 3A2LA 1GPMA 3GARA 2BFBA 3MUEA 1GPUA 2G72A 4H6WA 3B6MA 4C0LA 1WETA 2A7QA 2VVTA 1WSDA 3HKEA 4D4HA 2OB2A 3I73A 2Q07A 1D2MA 4F3NA 2GF9A 4CL2A 2HJVA 1CUFA 4HMQA 5ALLA 1VGQA 3CEMA 2X7XA 1RRGA 3JW8A 2YZKA 3JSXA 3NAGA 2GB4A 1LRKA 3FUVA 3QFFA 3NWBA 3J7AC 3GJZA 4YCBA 1MGPA 3JS5A 3ZNPA 4CMJA 2AFRA 3OHSX 3LWNA 4MULA 4DLZA 3BL5A 3BZUA 5L8VA 2EFYA 5IC5A 5L95A 1HKHA 3EA4A 3IBFA 2FN8A 1RQPA 2YDYA 4N3CA 5AJHA 1IXRC 4FB5A 2R79A 3BFVA 3I2KA 5H5JA 2C54A 4DANA 4KLRA 4BIIA 1QLHA 3N05A 4W5QA 3ZWNA 1F9AA 3NKVA 4GSKA 4H6VA 4RTQA 5H4GA 4E2YA 4P36A 3T7TA 4UREA 3IA2A 2NIPA 2QGFA 3GJ4A 4ARBA 5JNRA 1E96A 1SBNE 5HF9A 1C7RA 1JG4A 1JLKA 1NDHA 2HLPA 3DZIA 3VR6D 5HYVA 3T0FA 3PIRA 3GLIA 4CM6A 1GIAA 1Z5VA 1QRRA 1B6SA 3WB0A 1QTQA 1L4MA 1W5SA 4KOEC 1ZMRA 1V8DA 4QARA 4Z53A 1ZA1A 4HRVA 4DNXA 1JKXA 4YRJA 3ROXA 1AH2A 4RQBA 3AHGA 3T41A 2FMHA 3N76A 1T2UA 2XUZA 3PQ3A 3GL9A 4H1HA 1HYEA 4NDNE 4TZTA 1RQNA 1A76A 2G77B 3HRIA 4XEHA 3PFGA 4MITA 4MRSA 5TPZD 1E2UA 1EP9A 3ZX5A 1PQYA 4DRXB 5CA1B 4Z4GA 3RGGA 4ZMBA 1T5IA 4Y6PA 2O0JA 3CEHA 4EKGA 4CV2A 3OKFA 2ZIGA 3W5IA 5HR5A 2WOJA 1TI7A 1LPMA 3HCPA 1YS6A 5JALA 2E4XA 1W4ZA 4KO3S 1O5IA 3WWOA 3IPYA 5A4AA 3ZDCA 4IZIA 2NO5A 3FB4A 3DVLA 3P96A 5JNSA 2VF5X 5FFFA 2HA3A 1HUQA 1JMYA 3D4LA 3JYOA 3OCWA 4QEZA 3Q1LA 3P27A 5C7OO 1X1QA 2A84A 3KJGA 1UBRS 4CTKA 5HXAA 2PQ0A 3TEMA 2J6HA 5D1HA 3M9WA 1DFIA 4OFWA 4A03A 4ER6A 4HAIA 3PKJA 1KDRA 3C3JA 1M6VA 2CMGA 1IN8A 4XLZA 3TTSA 3MQ2A 5IEBA 4C43A 3INTA 2B61A 4WBXC 3P9CA 4BNTA 5DF1A 2RC6A 2BKXA 3RSSA 2V3CC 2XDQB 3NM4A 2OZLB 2AX4A 4JD5A 3R3YA 1BVRA 1DAPA 1U8CB 2FX2A 1R3UA 3IP7A 1R8JA 3I9LA 4F38A 4YRRA 2GXUA 2W8ZA 4QOFA 2OQIA 4I50B 1E4EB 1V6CA 2A1TS 3H2SA 3KK0A 4RNCA 4PWZA 2JAXA 3IDZA 4U2FA 1MAHA 3LF2A 4EL0A 4KITB 1Y89A 2V4UA 3GD5A 1KFEB 1S2IA 3LOUA 4UUMA 4RZQA 4EA6A 3TOSA 1I6LA 2ID8A 2II6A 2ZVPX 1XNGA 3MLAA 4ZHQB 2JFNA 3H9JA 2J7PD 5FCDA 3EPLA 1E3EA 1JL3A 1ULZA 1JBEA 2GZ3A 1WTAA 5J5CA 2R4QA 3MA0A 5AUOB 4P7BA 1YAHA 2IYFA 3VTZA 1OH7A 3EXEB 3M8KA 3SD7A 1S89A 3E8MA 3RRZA 1XLTC 3KZVA 4NBTA 1SK9A 4ZYVA 5IH7A 4H7FA 4IIBA 1VE7A 2XKKA 2NT3A 1ZGCA 1DC5A 4GVLA 4JJEA 4RY2A 4BNMA 4MUGA 5GONF 2Q0SA 9MHTA 5IKPA 4EL5A 2X9GA 3HLTA 1QIGA 5LD2B 3L7LA 5ADVA 4ZJPA 2Q46A 2VYFA 3KE8A 4RFVA 2P7HA 3PFCA 4BMSA 4BO3A 1M2VA 4L95C 1D04A 3AEXA 1XVTA 3BIXA 3O21A 1JPNA 1PJZA 1ZISA 2X4DA 2VC2B 1CUEA 1TIKA 5H3HA 1XP5A 4WNYA 1Y1QA 3SF8A 3TSCA 4NFYA 1PR3A 1EVYA 2KPOA 1EHIA 4QQ8A 1FU4A 1TIBA 3ETNA 5D8DA 3UM9A 3CRVA 1OAOA 2Q49A 3HI6A 1Y9ZA 3LE8A 4GVPA 4FFVA 5CYFA 3P5BA 3FSEA 5H02A 5T8KA 5BRAA 5CDFE 4OHMA 1EX7A 2UXBB 5EZ6B 5T4FA 3OESA 1L1RA 3PNSA 4H4CA 2QG6A 5E4TA 2ECFA 2CFCA 2VNAA 2C5EA 3ISTA 1KEZA 1WZEA 1Z5NA 1ZCBA 3EY9A 4JWKA 4V2IA 5FPTA 3ROEA 3RVQA 1H69A 1RWMA 1LLFA 2AJTA 2D0OB 1YB2A 1L7BA 2O48X 3WMGA 2YYZA 4GP9A 5HW0A 2OHVA 5IFKA 4YUYA 4TSFA 1JFTA 3NQ41 4DXDA 3KBOA 1CVLA 3SVLA 3O1LA 4JUIA 1SG9A 2PGAA 4A91A 1U1DA 5KJ6A 1JX6A 1WVGA 5K3CA 1U8XX 2Z2IA 3IR7A 4FFDA 5L7YA 3IOBA 2IYXA 2QRNA 1WOMA 3KWFA 1ITZA 4JLAA 5J1SB 3MJRA 5T67A 4F56A 1Q7EA 2QZZA 1W46A 1IIBA 1P9WA 2D2EA 3IE2A 4TYMA 4U8GA 4QPCA 5JNLA 2CLIB 1EFPA 1NJSA 3NBFA 3P71T 2R87A 1URPA 3A7EA 4BE7B 4G4IA 1PEKE 4D0RA 4MWTA 5EPOA 1SCUB 1UBOS 5DMXA 1ZK0A 1L4KA 1U3GA 5AM5A 3F5SA 2QLTA 4DM4A 4G5YA 5AXCA 4EX7A 1OKKD 4TSKA 1ZONA 2GOYA 4QBIA 4C3UA 4DILA 4AY5A 4CPDA 3WKEA 2FSFA 3PNBA 4YXFA 1BOOA 2VP2A 5H82A 1C2YA 1XL0A 4J8PA 2C7VA 2VYND 2Z6AA 3UJNA 2ET6A 4EOGA 1CZOA 4UAGA 1KJQA 5ITWA 1DMRA 5E3JA 3ONNA 4R2LA 1SBQA 3B1YA 3ZVKA 4TTVA 4I1RA 1QO9A 3BD6A 5BNFA 1ARZA 1R0CA 3KAKA 1WOYA 4JAVC 1MW8X 1AKNA 2HCJB 2VL7A 2IHUA 2IXBA 2CEAA 3U0BA 2AMFA 1TZBA 2JVKA 3FFTA 4Y9SA 2P3OA 4FS3A 1AQYA 2XV1A 3RBXA 5CFRA 2GM4A 2P9EA 1L5KA 3HV0A 2G28A 2WF6A 4ZWNA 1Z08A 2W9XA 4JL5A 1LJUA 1N2JA 4ZYWA 1RYZA 2OGTA 1N6RA 2P2SA 4UULA 4W6QA 4YYEA 3A6PC 1E2KA 1VLZA 1F8XA 2CE7A 3GJ5A 1W1UA 3HKCB 2NSHA 1B76A 2G80A 2VQ6A 4BFYA 1ISMA 1LF5A 3QFSA 5KWVA 1JKJA 1SG0A 2QW1A 2XXJA 4IKEA 2XWSA 3L0CA 5HDBB 1O89A 2C0QA 5JLJA 3BWXA 4NPHA 5C5CA 1Q74A 3R5FA 2AEFA 4HI0E 4N6GA 4PC2A 3PC6A 1U0FA 2RARA 3KELA 3OICA 3OQIB 2W70A 3KKPA 5HOQA 4G84A 5LA6A 2WV7A 1MB9A 4J91A 4QJ4A 2OHIA 2VF2A 2GILA 3FTQA 3LA8A 1HX7A 4HK4A 1P2VA 2JAHA 4R9VA 3WOVA 2CHVA 1P2FA 4R2WA 4JI2B 2WTAA 5FUWA 4O2BB 4L50A 1HG1A 2NZYA 4ZVOA 2H07A 4LJYA 1SHLA 1ML4A 1T9BA 1XU7A 4NU0A 2R65A 1NBMA 3UH1A 2CDNA 1H6CA 2X2PA 3PS9A 2Z9CA 2PJRA 4N18A 3H7IA 3AXSA 2EX0A 1RI2A 2Z95A 2AQKA 3OTOB 4D56A 3H97A 4WXEA 5KKCA 3LBYA 1ISIA 2GAOA 4TT8A 5FFNA 1Q44A 4D99A 4N1AA 3LECA 4OLAA 5FBWB 2AQIA 1U5BB 5IYZB 3T4PA 4I5IA 1D1QA 4CJXA 4MA4A 4MMXB 3UYKA 5CD9A 2E6UX 2Q45A 5M2QA 1XEAA 1U94A 3SJZA 4QUGA 3CIOA 1ENPA 2A5LA 1KSHA 4UTRA 1JWBB 4BOYA 1JEQA 1KY3A 4WV3A 2VDOB 2O2ZA 2IHZA 3QF4A 1EP1B 1OILA 1DPGA 1QVAA 3PPVA 1D6SA 3ZI7A 2PO7A 3R9XB 3GFVA 2R8ZA 4KQWA 5K8VA 1TUEA 2CVOA 4CFZA 4F5ZA 4RU1A 3J81A 2O3TA 3G1TA 3AWDA 1Q92A 3GFRA 4EHDA 2ZYDA 5JZSA 1UBHS 3DH0A 1AGRA 4MTLA 4N5LA 4QG7A 4XTRA 2DPLA 4GBMA 4LWOA 3HN7A 4WZBE 5JARA 3K70B 4RKWA 2J07A 1I5EA 1UXGA 2Q6OA 2QXYA 3H19A 3PQFA 1L5HA 2HA0A 4OY3A 1VIAA 3L0OA 5DCLA 1U6KA 3RW9A 2JKVA 2BFFB 2UDPA 3K53A 5D01A 5JDCC 5BO5A 4D4KA 2GT1A 2ZUEA 5HM6A 4P7JA 3W34A 5ARCA 3WGTA 4BV3A 1GTVA 3AR2A 5G02A 1A9XB 3ASVA 3UMVA 4RVDA 1J8VA 4Q9NA 4MKXA 4CTOA 3FWYA 4CM8A 3KYDB 3HCOA 5IBRA 5EIXA 5CLLA 1UF9A 2BZSA 1JQLB 2FW9A 2JGKA 3FPFA 1C50A 3H9UA 4NWIA 3JASA 4QASA 4RABA 4WASA 4TLAA 5DM2A 4C01A 3LQRA 3CCFA 4D92A 1IHXA 2ZRNA 4M22A 3REGA 2XOEA 2QNIA 2OXFA 4H6XA 4LJ6A 1B74A 1NBOA 1RWXA 1KJZA 2XHZA 2ZWMA 5LSAA 1ZSNA 3JAWA 1QKKA 3JD1A 3FCAA 1FUUA 2C9MA 3KSUA 4UKDA 4EBBA 2RH8A 4WEOA 3TI9A 1OAOC 3L0PA 4ZOLA 4K0RA 4KU4A 4S1OA 1M8KA 5T8KC 2DPGA 4OHVA 4KIWA 2A9JA 3T5DA 3AI7A 4XM2A 4E5KA 4MWCA 3GOHA 1D2HA 4MHSA 4OBXA 3OQ6A 4HGZA 1G17A 3SAJA 5AVOA 3W4KA 5ICMA 1B14A 2ECKA 4J4BA 1Q20A 1FPQA 4BMOB 2PKEA 3F96A 4HH3C 3V2IA 3WQSB 1Z6GA 3GUCA 2C4WA 5ERGB 4B6SA 5EKDA 1I3LA 3FPCA 3Q3VA 5BYJA 5J47A 3R7DA 5FBLB 2A30A 4B4VA 3S81A 1J99A 1C3VA 2XA1A 4WJLA 1G8JA 3HWRA 4ILKA 3U0VA 3UN1A 4EPVA 2XGOA 3GNLA 4TLCA 3N8GA 1F2TB 2O1WA 2IY8A 4HTFA 4IM7A 4EA7A 2HA2A 2J0UA 1U7ZA 2ZVQX 3Q7RA 2TMYA 2ZR0A 1IJFA 5H81A 3L4JA 4O4HB 1OUMA 2W6ID 3I83A 3K1AA 3WHKA 4I5GA 1QK3A 4KNVA 1FLVA 1MIOA 4NBVA 2ZWPA 1CJSA 1ODLA 1TU3A 1WXGA 2OKGA 4INZA 4Q1AA 2PRIA 2BTQA 3SBOA 2XYGA 3EXHA 4WGFA 3L92A 2PSFA 2VT2A 2MSCB 3EXAA 1RJGA 4A1OA 3FTPA 3X1JA 5JQWA 3KL4A 1R4AA 1VRVA 4D9JA 3GH3A 4WEQA 5CITA 1Y7IA 3NTQA 2XQIA 4GBGA 2RI1A 1Q6ZA 4ZAVA 4CCWA 1ZD3A 3ZHUA 4OCZA 3RRFA 1GLNA 3WFIA 5F4ZA 2IZOA 1I2BA 2NG1A 1QM5A 3BRQA 4K26A 1JDZA 2FH5B 2F3QA 1EJ0A 2O8VA 3E2PA 2FPLA 1UDWA 3GELA 4RXMA 4JI1B 4B3TB 1YHYA 3QA9A 2C8LA 2EJUA 4D4GA 1XQWA 4BJ3A 3FI9A 3PQCA 1QYWA 1NMXA 3HB9A 3QLTA 1VCHA 3E58A 3JRWA 4MPTA 4D9NA 2C7OA 2JFHA 1N1EA 1W30A 3LUAA 2C0PA 4CR6A 1GGFA 4EKEA 4JYMA 5CLHA 4C2AA 1PK8A 4GOXA 2O5CA 4OD0A 1E2IA 5EIBC 1TM4E 2HQBA 3GFFA 2OPBA 4TXHA 3KZNA 1JSZA 3B5IA 3WK6A 4IINA 1SC4A 2HU8A 2YZMA 3RU9A 1U3FA 1ESMA 2YHIA 3LZ6A 2YNMA 5FD8A 2V7BA 3HCAA 3IEXA 2XYVA 4RX1A 5GVSA 4CXMA 5LMUB 1XWIA 2PKQO 3N2NA 1GZDA 1T29A 3THWB 1RRCA 3SDBA 2E3JA 4E1BA 4B5LA 3TQSA 4IF6A 4GLLA 5ESRA 2WPNA 3RWOA 1SQGA 4HFJA 2RAFA 4ZT5A 5ALFA 2VPTA 1JEDA 4AWBA 2F67A 4BFVA 3VMMA 1VE3A 3KT3A 5KU1A 2GWHA 4Q3OA 1QS0B 4YAWA 1CULC 5K0SA 2MIIA 4CEJA 2DE0X 2P2CA 1EAMA 5BWMA 1KAGA 1R7RA 2VWHA 4EHFA 2GF2A 3ND9A 5CNIA 4J1NA 2EX1A 2HRCA 1M2KA 2BDEA 3FLEA 5BP7A 4JUCA 2VPZA 4WL0A 4RHTA 3MOIA 1B8UA 2BEKA 4IVPA 2OXIA 4BNFA 4LF9B 1EH5A 3SC2A 1Y0BA 1QVWA 3M33A 3BIFA 4HUQA 5DLDA 3I4CA 1NLUA 3CLTD 2DPXA 1UWLA 2CZGA 1EWTA 1LS6A 1D3AA 1W5FA 2HEIA 2B83A 4IGIA 4BNVA 3O2SB 1ONPA 3VTFA 1XMOB 3G2KA 3H18A 4GXQA 4S3MA 4FZJA 4DBLE 4ETNA 1E6MA 3WYFA 2VZEA 4ARIA 1HDCA 3JQ8B 4R3WA 2A9VA 3OSZA 3R5KA 1NV8A 3TN7A 3VR4A 3CTPA 5CDSA 4QHTA 4GYJA 3URKA 5BMVF 1CR2A 2J3IA 4D46A 1XLWA 2VQFB 2CSXA 1L7VC 2W2QA 4ZEVA 4TVBA 5EHNA 2O8DB 1J0EA 5FBQB 2AZMA 1ND6A 1HPLA 1SXIA 3KDPA 1WDMA 4W5WA 3W8EA 4NXMB 2AUTA 1RFGE 4UZEA 1L7DA 1PJ2A 4UNNA 1R9JA 4LF6B 4EM6A 4O3FA 3Q8MA 4KTTE 5E6RA 4QBTA 4QT4A 4GM4A 5D3MB 5LQDA 2HJGA 2HNAA 3RVNA 4KKVA 5D3KA 3WGQA 1QE5A 4TL8A 1R6DA 4ICIA 1FX0A 4MO2A 3PG5A 2OSVA 3RC1A 3T3EA 1NJ5A 1JRLA 2FWRA 5JY1A 5IMSA 1BROA 4HH1A 1FFXA 1IUOA 2DWQA 3NHZA 3HBJA 1YB6A 3STHA 3A3OA 2RHWA 3T1OA 2GPSA 3U4QA 1REQB 3HUDA 4FOOA 5JJBA 3LW7A 3ZH9B 3PZRA 4HWOA 3EIUA 5CT6A 3FYCA 3GFGA 2BF4A 1U4SA 3Q3HA 3Q88A 4S0ZA 3DONA 4XLTA 5HQJA 2JBAB 1JIUA 4IJKA 4JZKA 1Q0RA 3AEKB 4K28A 5IJ0A 5IN4A 1X80A 1N6OA 4O3MA 3JD4A 4NE2A 4LJRA 1N2HA 1Q0LA 1V9SA 1YR3A 2IPNA 2R84A 5CU7A 4OJTA 4EJ2A 1OFTA 1Q1BA 1NW9B 2PWZA 1T8WA 3GEDA 2I3BA 1P2TA 3L8FA 2BRUA 3H11B 1C9YA 2PO5A 4JVLA 5L3RA 1GKYA 1HM5A 2X8LA 2RHGB 4L73A 5M3BA 4V0RA 2I71A 3L8CA 4EYKA 1SG6A 4CKCA 2ZJOA 3TZHA 4UTPA 4XSVA 2VJOA 1RADA 4Z2AA 2NU6A 4BP9A 3R9WA 4KKXB 4PY2A 4XFDA 4B4DA 3U09A 4GS5A 1N2CE 2UVPB 2FPOA 3FMFA 3OX2A 2OHXA 2RGNA 2GXSA 4KN8A 4L9AA 3SM3A 4F3CA 3AL3A 4KXXA 1GUBA 2BGIA 621PA 3L1UA 4ANFA 4AQYB 1JTEA 3MSXA 1NOJA 1MC8A 1C1XA 3EDOA 4QOSA 5B57C 1KIFA 2H9YA 4MGKR 4DLUA 3IUPA 5DBIA 5ENDA 4UEWA 2FZKA 4AO8A 5KINB 1SXJA 1JR4A 1SKYE 2BY4A 1XYYA 3IOMA 3ZCXA 2ZWOA 3N39C 2OFOA 4J2HA 1XRSB 1EG7A 4LJSA 5HG0A 3WKAA 4AU1A 4N76A 2G71A 2QTLA 1RR6A 3V80A 2AQ8A 1BW9A 2DMRA 2EKBA 5BURA 2HZBA 5JAPA 3EXHC 4XCXA 4XOUA 1O95D 3AF4A 5FPYA 4BLPA 1L7RA 3UAYA 3GFOA 1JN0A 3K0AB 1FMLA 4XVRA 4AIIA 1DV1A 5CLIA 1YI8A 1GSOA 4GC5A 4FOSA 3LX8A 4PLPA 5G0TA 5F76A 4V03A 1N25A 2HNKA 4G4GA 4RCZA 5K1ZA 3T5CA 3W2TA 1GYPA 4MP6A 5IVKA 2RHHA 1G8FA 1UR5A 4S12A 2QP9X 4PZAA 4GXTA 1KE1A 2FXIA 2ID7A 3D5TA 4OHRA 2X3FA 3DEZA 5KDDA 1LI4A 4H7PA 3OJLA 3AHJA 4F3TA 1GHTA 1WAMA 4IDDA 2G5GX 3IDQA 4KFTA 2VQSA 1RQRA 2OCXA 2YDXA 4LQ4A 3ELBA 4B84A 3ZOZA 3M6WA 2FLWA 2AXEA 2Z43A 1KQOA 1TQ2A 2EOAA 2VPPA 2YRWA 1X7DA 3QPDA 4KMSA 4HEQA 3GFSA 1V16A 5J59A 4HWGA 1G4AE 2GCGA 2JLRA 3BKWA 3TLKA 5CCBA 1FVOA 5IAKA 1YQXA 2QG4A 3CNNA 3GLHB 5ITSA 7MHTA 3IVAA 2O2DA 3ACDA 4EMSA 1VJCA 4K9MA 3GJ3A 5T64A 1PD0A 4BAZA 2IP4A 1JR3D 5ECDA 2OC4A 2QUBA 1E3IA 1XD2B 4Y7DA 2DBYA 3TLJA 3X2FA 3OZGA 1A72A 1SVMA 3GGJA 4B33A 3ICEA 1J2JA 5AHWA 3A3KA 1ORWA 3GG9A 4OYRA 3O4VA 2OECA 4BNUA 4MQEB 3EZ2A 1TD9A 1UQRA 2RMKA 5B6PA 5T7BA 5K05A 2BEWA 1KQPA 2Q99A 5J4KA 1UIMA 4OXXA 1Q5PA 2G4LA 3BF8A 3EBOA 2RAPA 1LV7A 1N5MA 4JSRA 1JFFA 1CUIA 5K09A 1DBPA 4Z54A 4IXMA 4JUAA 4TQ9A 2VNKA 3IXQA 1K8QA 5LBTA 1QCDA 2ATVA 1Z75A 3PFKA 1DLJA 3ZYZA 3CBQA 4G86A 3HVHA 4F0JA 1CLUA 2UUBB 2E48A 3ZE6A 4ER5A 1WB4A 3PRYA 4H17A 4W5HA 4N0DA 1BOFA 3HUEA 3JZFA 4FMPA 5FPKA 1E3QA 3AR3A 1CTQA 2CLHB 1D8AA 1UPBA 2R1VA 2WT8A 1N33B 1EEHA 1PS0A 3Q98A 4AJOA 2W22A 5K8UA 3Q3JB 3I5AA 1M2GA 1I1OA 5EE5B 3RSFA 3TE6A 4OHPA 2GEFA 2RBKA 4P98A 3JARA 5HK8A 2A5YB 4QSHA 1U3CA 2EQAA 4ZVVA 3TNFA 1NVMB 3EIHA 3Q2KA 1JDTA 1SR8A 1T3HA 4H2DA 1GPAA 4HUJA 1XA0A 4MVJE 3C4QA 1U5AA 1CP3A 3IEUA 5A9SB 1CF4A 1E69A 2WZBA 1NRIA 3K1JA 3PC8C 3PFIA 5TNXA 2V7XA 3FPHA 2KBEA 3LUJA 4GKBA 2RCYA 2Y0PA 2FRDA 4WXMA 4NQZA 2ZYHA 4WZZA 3A1UA 2XZOA 4JEHA 1B26A 2GM3A 4RIHA 1F8UA 3G0DA 3H2ZA 1HYGA 2P6RA 1EDDA 4JENA 4JI8B 1J2TA 5EC8A 2FPIB 5GONB 2QLMA 5KVSA 2FFQA 2XHEA 3DZHA 3VHRA 1H4SA 2IBMA 1SBCA 1YS2X 1HH4A 3H65A 3ZWMA 4YY3B 3BMOB 3QVGA 1NG1A 2VZ8A 2PUGA 1NRXA 1PR4A 3IC5A 1GT91 4LY3A 5KSYA 2Y9MB 3NIDB 2WNSA 5FQOA 4LV6A 3PCRB 4ISBA 4ARSA 3OM8A 4ZIRB 3HB1A 3KE9A 5G4KA 4RGVA 3R44A 2IU0A 1ZIOA 4ZPXA 2E6KA 5LMCA 1TFRA 4KXFB 5LKRA 3LW8A 2D1QA 2RGEA 4JT4A 3C6BA 3IUNA 3E82A 4LK3A 4D3FA 4HDMB 4B3RB 2Q5JA 1G64A 3DZFA 4H7HA 4QBKA 4Q9IA 5TARA 3QX3A 4NYJQ 1VLLA 3ZDYB 2HMTA 3NDPA 4EK9A 2GPAA 3DDOA 2ZWAA 4HO1X 2ZIXB 2G5PA 1NVVQ 3OM1A 3EMVA 4YIKA 4Z8XA 5FTWA 3DZJA 1RXSA 3JWPA 2HGSA 3ZWOA 5HCNA 3SSNA 2JAQA 1RKXA 1GL7A 1KJJA 4L2IB 1PJ4A 2PSJA 4HEJA 2GBFA 1GU1A 2QZ4A 3KD3A 4X90A 5JAIA 2ENUA 3BORA 2CF5A 2BRUC 1ZN2A 2AOTA 2JLSA 3OPNA 3RF7A 1XEFA 2Q1WA 2ZSUA 3AUFA 4BKUA 5KC8A 1F4VA 2JCYA 6PFKA 1Z6TA 1C2TA 3AHIA 5J3JA 2OK8A 4H3KB 1KEKA 1NXWA 1U9CA 2YIJA 3AFIA 3MMZA 2FMUA 2HF9A 3PXCX 4H15A 4US1R 2BKAA 2XJ4A 2CZCA 4U7TB 4MWBA 4F1KA 5K01A 4TXMA 3K32A 1V5FA 1DAKA 3FTNA 2DHEA 2QTZA 1P4RA 1EI9A 5I9MA 4X94A 3QU4A 4BKQA 4PZCA 4X1KA 1SD1A 5J43A 2VJYA 2RGNC 3GN2A 5DW3A 3D6JA 3N2IA 5JATA 2GAFA 1TTQB 4D8TA 4EJSA 5HDQA 2I2BA 1KKLA 2AGVA 1DKUA 3DPIA 3UJPA 3UK1A 1X87A 1TTTA 2PCJA 3OF3A 5KYYB 2R62A 3G2OA 1KHTA 1I24A 1BMDA 1UKCA 2JEYA 4KODA 1SN7A 2CL5A 3QPUA 4MUBA 2NPOA 2JARA 3K92A 4CUJA 2BFDB 1SXJC 4OXYA 1WNTA 2H06A 3NASA 5IBPA 2FLVA 3WLSA 1J23A 1HA3A 3T3MB 4NCXA 4JJFA 1JAZA 3GRCA 4DSUA 3BZBA 4JQSA 3QI2A 1GFSA 4M4SA 3ZU4A 3NIBA 2ZBDA 4BVEA 3GLIE 3ULKA 4DMGA 4KQXA 4QFBA 1FE8A 4HXFB 4BLOA 5B30A 5EQTA 2E82A 4V1CB 1W0KD 2MMCA 4NNOA 4N82A 4MKGA 4Q3EA 3U3KA 5JFGA 2FPPB 4QULA 4HDCA 1CJKC 2PR2A 3GRYA 1V45E 2L69A 1JIQA 1RRVA 4PNPA 3BWYA 4Y2TA 5FR1A 1TZKA 2SBTA 2QJFA 5K8CA 5JHGB 2HN9A 4X00A 5E3IA 5LP6B 2VDWB 1VOTA 3EOAI 2C83A 4I2VA 1G20B 1JILA 4UBOA 3SXJA 3HBLA 3WL7A 3JYHA 1EQAA 4HLNA 1MGOA 3KP1A 2JLXA 4P4UA 4D9EA 1CF9A 1NLMA 3M3DA 1DS6A 5C1BA 3ZDDA 3LDFA 2DHRA 4PN3A 1KY4A 2VTVA 1W76A 1PRYA 2BUCA 2NV6A 4IHJA 2WWXA 4BWGA 5AW1A 1LS1A 1CEYA 2XYHA 1Z12A 5KTPA 2I34A 3LY8A 1K8XB 4D9MA 5BXYA 3N59A 2IODA 3P0FA 1E1LA 4R0MA 1G63A 4BLWA 1YJ8A 1H0HA 2IYOA 3JR3A 2GDZA 4RZUA 3FPAA 5JV5A 4Y2JA 5BV8A 1XZKA 3E7XA 5K3SA 3ZDZB 2IQ5A 2WVAA 3GMDA 4Z0PA 1NMQA 1GG5A 1NXTA 1B8VA 1VBMA 2NGRA 3H86A 4Y2GA 4A8JA 2I87A 1FTGA 3UMGA 3VRHA 4RTRA 2Q5HA 3IAM1 2CYAA 2A33A 3MWKA 1C9MA 2PA0A 3SKVA 1MOQA 2Q9CA 2VHVA 4B2IA 3T35A 2EVWX 2R2AA 4EHNA 3L0DA 1QHYA 3A6LA 2Z2XA 5LLTA 1I0LA 2YUIA 4DRXA 5CA1A 1MUUA 3TR5A 3H9CA 2C0CA 3IPLA 3MJFA 3R0XA 4QEKA 4FKZA 4KSCA 4KREA 3BWVA 2BH2A 3GGSA 4M21A 3AVUA 4DTIA 4TWZA 4WXYB 3BHMA 2OOSA 3UGQA 2AJCA 3HEMA 2MINB 1RJ9A 2Y77A 3OEEA 1KDZA 1W1WA 2CNWD 4PHCA 5K03A 1ZUD1 2J0SA 4YLEA 1A9OA 4IHQA 4KRGA 3FH0A 3R7LA 4B71A 5HNKA 1IPHA 1LY1A 3RYIB 1DAFA 2D1RA 2MSKA 3CBGA 4YRSA 2CY0A 4C5BA 2FQYA 1Q3KA 1SPXA 4ZYYA 3G0CA 4ZDIA 1FNMA 1QIIA 4CQMB 2GKSA 5C4IA 4B87A 1DKNA 2MSWA 4C6TB 9LDBA 2BGLA 2PKXA 4TLDA 2XDQA 3ANYB 4OXQA 2Q1TA 2OZLA 3M81A 4GKJB 3VAYA 3ZDBA 2BAGA 1IHYA 3INRA 1DQRA 1TM1E 1UEXC 2QTAA 3OIFA 3TX6A 1A2BA 3OQHA 2IE0A 5DRYA 4FW8A 4QDOA 4I50A 1E4EA 3KC2A 3RRYA 3K4QA 3L7MA 2ZJ5A 2VQEB 5BVHB 1NHGA 1Y3BE 4O0MA 1JQEA 2BJHA 3HS3A 3U4DA 2ZR9A 3GGDA 4V1CI 1NQUA 5BV7A 1YVRA 2D3WA 3R0JA 3K71B 2HK7A 4IG9A 3HL0A 4BUJA 3P19A 1BMQA 1IBKB 5AK3A 1MHTA 1CUUA 5TQ2B 1SELA 1YRBA 2A8YA 4P4SA 4EA9A 1DCTA 3MC1A 1YGYA 4W9RA 3EXEA 4M1ZA 3U49A 3E4DA 3TJRA 3P1JA 2GESA 2APJA 4I1SA 1WW2A 4R2HA 5F2KA 5FWAA 1HLDA 4EFMA 1ORRA 2CJYA 2WYOA 3LXXA 3AKYA 3MT9A 4P1ZA 3RYHB 3W1EA 3F2IA 3SJCA 4DV4B 4WOPA 2R6DA 1Z88A 1U8ZA 2OCBA 4Y2PA 3R74A 3ZG6A