5EKNA

Crystal structure of mapk13 complex with inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
350
structure length
336
Chain Sequence
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title First comprehensive structural and biophysical analysis of MAPK13 inhibitors targeting DFG-in and DFG-out binding modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 13
total genus 99
structure length 336
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5eknA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5eknA01
2UZTA 4NU1A 2VTSA 1VR2A 2BAQA 3QD4A 4XLVA 4PF4A 3R1SA 4UMQA 3LJ2A 3C50A 4QMZA 2VWYA 5E91A 5IEYA 5J87A 3DPKA 1YRPA 3R71A 5TOZA 5L6OA 3R7GA 3AT2A 3BLRA 3GBZA 5CYIA 4C02A 4HGTA 3BU3A 3A2CA 4IC8A 3MDYA 5DMZA 4EK8A 4EHGA 4M8TA 2UW9A 3VWAA 3NLBA 3BYMA 4AQCA 3RAIA 4FVRA 5KO1A 4S33A 4J8NA 5KMLA 3PA5A 3FLNC 2CNVA 4GJ3A 3FDNA 4IADA 3DZOA 4I4FA 4IB5A 3QRKA 3P86A 5GJFA 1I44A 1XH7A 4PMMA 1M17A 4O1OA 2E9VA 5FTQA 3B2WA 3FMKA 4FKWA 3MY0A 5M4UA 4ZMFA 5LQFA 3GCVA 1R39A 3PXYA 3W10A 2CCHA 4EJNA 4BVUA 3PSBA 2O8YA 4OBPA 4TRLA 4CFXA 1MRUA 2OJJA 3NNUA 5IUIA 2CNUA 2Y0AA 4YHFA 3CD3A 4UN0C 2RG5A 4TNDA 2QG5A 2GNJA 5HIBA 4J7BA 3FI3A 4ZLZA 4GUEA 2A19B 3D5WA 2PULA 3HAVA 3BKBA 3CTQA 1IAJA 3KXXA 2GNGA 3Q5IA 2W17A 3U4UA 5JT2A 2WGJA 4O7LA 2W05A 3QUDA 1KV1A 3LFNA 2BFYA 4FV9A 4IWPA 4PL4A 2B9IA 2Z2WA 2ZVAA 4MTAA 3EKNA 2PVJA 1W82A 5IQIA 4FG9A 4M0ZA 2UZDA 2J50A 3SOAA 3E8NA 4GL9A 2X39A 5BVEA 2BDJA 4MK0A 3PE2A 5KBRA 2ITOA 2X7FA 4E5AX 3QALE 1K3AA 3QUPA 4HZSA 5JGBA 2GHGA 3ZSGA 3F7WA 4GT4A 4JRNA 5G6VA 1WZYA 5K0XA 4M84A 3SG8A 2W1EA 1W98A 3B2TA 5LVOA 4E1ZA 5CQWA 4DFUA 4CZYB 4W8DA 2G2FA 4IFCA 2BKZA 4R5SA 3CCNA 4GIHA 4IX3A 1XWSA 4X2KA 3FYJX 3VBXA 5IU2A 3MPAA 4G16A 4QMNA 4OAUC 3W32A 2CN5A 2YM4A 3H0ZA 4EOSA 4Q2AA 3NIEA 5TT7A 3ORIA 4KBCA 4PQNA 1JSTA 2GNHA 2WPAA 4YJVA 2YACA 3A7IA 2BROA 5GZ9A 2W7XA 4F0GA 4HVGA 4FZAB 3Q96A 3OF0A 4AG8A 5IA0A 2VTRA 2IZRA 1YWVA 4BDEA 5CEKA 3RZBA 1ZZLA 1QCFA 1OL7A 2PYWA 2WQEA 3RMFA 3TNHA 3IO7A 1UU7A 1U4DA 2C3LA 4AOJA 4PX6A 5BMSA 4EI4A 2VWXA 3KK9A 4R78A 5EM6A 3ZFMA 2WO6A 4IM0A 1UNLA 1STCE 5C8KA 3U6JA 5DBXA 4CRSA 3TUBA 3KK8A 2VTTA 3OTVA 1XH8A 1JVPP 4PNKA 4FL2A 5LMAA 3GT8A 3U51A 4R3PA 3ZOSA 4X3FB 4G2FA 4EORA 4LMUA 5BVFA 4BKZA 2BALA 2WEVA 3R8VA 4Z3VA 3SOCA 3G51A 3QQFA 4DFNA 5LVPA 3UOJA 3LMIA 2JKMA 3P7AA 3HV3A 3OUNB 3SXRA 5BYLA 4AX8A 3G6HA 4O7ZA 4QMWA 1FBNA 3NVKI 5EDRA 4XG6A 3FLYA 4R6VA 3RCJA 4BDAA 4WNKA 4AN3A 2E9UA 3A99A 3PA4A 4Y46A 4G9RA 3QCYA 2IVTA 3AC4A 3COHA 5D12A 2FO0A 3AQVA 1GY3A 4RWJA 3C9WA 4LGDA 3FV8A 2V0DA 4QPSA 1KSWA 4U3YA 4C61A 3KU2A 3FPQA 2YERA 5E8UA 1OIYA 2C4GA 3QBNA 5HO8A 5KCVA 3WI6A 2QCSA 4PDPA 5HVKA 3KQ7A 1PW2A 3MV5A 3KGAA 4ACCA 3BPRA 5M08A 4FNWA 3BBWA 4XHKB 5TF9A 1BUHA 3LIJA 3UMWA 2V7OA 1GNGA 3IW4A 2GS2A 3G33A 3POZA 4PTCA 4PPCA 3AC2A 4IEBA 5FEDA 5C27A 3ALNA 2YWVA 4DITA 4AE9A 1G8AA 5F9EA 2VTMA 3R9OA 5C8NA 5HIDA 3DBEA 3WYXA 5HX8A 3O0GA 3SA0A 3IGGA 4B4LA 2O2UA 5EW3A 3PVWA 3EJ1A 2O64A 3R1QA 3TZ7A 4X2NA 3WF6A 3IONA 5C03A 3C4ZA 1ZYDA 4HPUE 1J1CA 3B8QA 5D7AA 2YCFA 3MN3A 5BUJA 2DYLA 3FL5A 4Y95A 4RG0A 3QGWA 5BQ0A 4NFNA 4ZTLA 4BTJA 4CMUA 3QD2B 2P2HA 2CGUA 2C3JA 4NTSA 4QP3A 5EYMA 2JBOA 3S3IA 4TYHB 4IJPA 3WZDA 2YCQA 4KIKA 2UV2A 1HCLA 5CS6A 3REPA 5HU9A 2VNWA 3QQGA 3U6IA 4G31A 4J1RA 1RE8A 1KV2A 2PL0A 4FF8A 5IA4A 4D58A 2BRMA 3UQFA 4OGRA 4XRLA 2FB8A 2H6DA 4M69B 3VRYA 2OZOA 3ANQA 2CN8A 3GU4A 4C38A 3PXRA 3HMNA 3VF8A 4RFMA 4F99A 4FA2A 4FL1A 3PVGA 4EKLA 3OOMA 5CENA 4A06A 4OBOA 1R1WA 3DKCA 3MYGA 4B8MA 4TL0A 4Z16A 1OPKA 3GENA 3LFDA 4X2FA 4D2TA 1XKKA 3NNVA 2FVDA 3L8SA 4IZAA 4IZYA 4WOVA 3BIZA 1ATPE 3DU8A 4FKUA 4FEQA 4DE4A 2QR8A 5DOSA 2F7XE 4IZ7A 4N6YA 4FGBA 4S32A 4YZCA 3ORNA 2YZLA 2FYSA 3FC1X 3Q53A 3VIDA 5KBQA 3V6RA 4AGWA 4D4VA 2XNMA 2VN9A 1X8BA 4CQEA 2I1MA 1ZOGA 3FC2A 3A61A 4X6QC 3MH2A 2BILB 2C5NA 2JDTA 4I4EA 4TZRA 4M15A 4ACMA 4CFMA 4BZOA 4I92A 4EH9A 2GSFA 1Q3DA 2XIKA 4MQ1A 4RJ3A 4C59A 2ERKA 5IEVA 3JVSA 4KKGA 2EUFB 2B1PA 4YJTA 2YM5A 2GQRA 3MH0A 2JFMA 5LWNA 1KE5A 1GZ8A 3EL7A 3BZ3A 1IA8A 1CKIA 4IDTA 3MS9A 4L68A 3W8QA 5I5ZA 5JSMA 1PXOA 4IX4A 3QTIA 2BDFA 3ORLA 2F9GA 4C3FA 3FE3A 3HV7A 3HUBA 2QO2A 4Q5EA 4OTQA 3G0FA 3P9JA 3DDQA 3QX2A 5CY3A 4C37A 4BCQA 1XJDA 3O51A 3SHEA 2UUEA 5AV0A 3M1SA 3VW8A 4AT3A 1P2AA 5FEQA 2GDOA 2J6MA 2HW6A 2C3KA 5HU3A 2X9FA 5FBNC 4EH7A 2V22A 4RIWB 2BCJA 4ZS0A 3V8TA 4FIHA 4K9YA 1XH9A 3QA8A 3A4OX 4YLJA 2OKRA 3ZC6A 4IB3A 2PZRA 3KVWA 3GQLA 2WQMA 5FXQA 4PPBA 3HRFA 4EYJA 3N4TA 2JDOA 2X7GA 5E9EA 5AIRA 2PE1A 4DEHA 4FNXA 3UQGA 3B8RA 2WTVA 2VAGA 4CZTA 3QWKA 4GSBA 2QHNA 4IAYA 4L53A 4L7SA 3OVVA 2XM8A 1NT2A 3DQXA 3A7HA 2WB8A 3R0TA 3GFEA 2FSTX 2J9MA 2ZM4A 3PPJA 4FI1A 4YNOA 5CWZA 5EYKA 3UVRA 3R8UA 4DEAA 4YTFA 3V8WA 1DS5A 4WUNA 2R3KA 4BCFA 1OITA 4ZTNA 2QOBA 2QQ7A 3PVBA 3QYZA 4I1ZA 3W1FA 3Q9YA 3IDPA 4I24A 3R8PA 2C6MA 3KN6A 3CGFA 3FMEA 3GB2A 4HOKA 2XNBA 3EFKA 5AP2A 3NR9A 3UJGA 3F3UA 4O2PA 2W0JA 2Y8OA 3MVLA 4D55A 5LVNA 4LQMA 4QMVA 4DC2A 2CKEA 3COMA 4AFJA 2XK6A 3IW8A 3HUCA 3LFFA 4EWQA 3ZH8A 1KE7A 4E93A 4HGEA 3RPYA 4BZNA 4FK6A 4P5ZA 2GNFA 4YC3A 4FMQA 5CU4A 4DFLA 5TKDA 2Y6OA 5J5TA 1Q41A 3MPMA 4QMTA 4F4PA 2JDVA 2UZVA 3E5AA 3ATTA 2QOIA 1B6CB 5BVKA 3MWUA 4DLJA 1TQMA 2BMCA 4CLJA 3O23A 5FXSA 4HYSA 4MX9A 2WTIA 2HWPA 5I9UA 3EL8A 3R00A 3RKBA 4NYEA 2JDRA 4PL5A 4JDIA 3ZO3A 3F5XA 3NNXA 2HELA 4QTAA 2ZM3A 4ZTQA 3QA0A 5CF8A 4TPTA 3I60A 4X6RA 4UMRA 4ZTHA 5E7RA 4FUXA 2B0QA 4FEXA 4FSZA 2QO9A 2GS7A 3IOKA 4BFMA 3QL8A 5HIEA 3UNKA 3WF8A 2IZSA 4J71A 3BU5A 4QMSA 4G3EA 4IJ9A 2OG8A 4XV1A 3I0QA 4S31A 2XK9A 2IVUA 3D2IA 5CI7A 4F65A 2HW7A 2XUUA 3PY1A 2R3RA 5AAFA 2VRXA 3OCSA 5CXHA 4AGUA 4ZZOA 2YLEA 4PDSA 5EOBA 4G34A 3OCTA 4IVBA 4DG3E 3V5JA 1NVQA 2XIRA 5JFXA 3PUPA 4O0XA 3ORZA 3UYTA 1XBCA 4EUTA 3TIYA 3DAJA 5TO8A 2VTQA 2GNLA 1G3NA 2W1CA 3GU5A 2R0IA 4YNEA 5ETAA 2XKDA 3KC3A 4XG9A 3MW1A 3Q4ZA 4HCUA 4IB0A 5E1SA 4GU6A 1FGKA 3AMAA 3Q9ZA 5L6PA 4BIBA 2XRWA 1QMZA 2I0HA 2VWIA 5TR6A 3AGMA 3I5NA 1RJBA 3MA6A 4P90A 2Z02A 3VQUA 1PRYA 2GU8A 3DT1A 3NWWA 4ZSAA 5DT3A 2YAAA 4QYGA 4UBAA 2WMSA 5EM8A 5J5SA 4IFGA 1SVEA 2WD1A 2OFUA 3RAWA 1OIUA 2H96A 4O6EA 4YJRA 3PDTA 3L9PA 1YW2A 3PXFA 5GNKA 5IZFA 4CSVA 3NEWA 1IAHA 4U41A 4YPDA 5HG9A 3BCEA 1XO2B 3TACA 2F4JA 4IHPA 4JG6A 4RZVA 4JR7A 2YHVA 4BY9E 2W4KA 2W5HA 3KF7A 3PRFA 2W9FB 3ZXZA 3QAME 3DAKA 2OI4X 4GRBA 2QU5A 3DLZA 5DI1A 4DFXE 4X0MA 1G8SA 2QONA 1GIHA 2Z7QA 3QZHA 4YJSA 1IASA 4EOKA 5CAVA 2XNEA 3Q6UA 4M68A 4WHZA 5CSXA 5AADA 5K3YA 1IG1A 3D5VA 2BIYA 1LUFA 4QP7A 3G90X 3NW5A 3VW6A 4I5CA 4YLLA 3QTRA 4BI2A 5L8LA 1M7NA 4FSYA 4LL5A 3DDPA 4LG4A 5AA8A 5C26A 2HENA 2PZPA 3AT4A 1Q8TA 3Q4UA 5H3QA 2IG7A 3FXXA 5AUVA 2HY0A 4FEWA 5A4LA 3DXQA 5CAQA 2YM6A 3ODZX 1U54A 4F7LA 3C0IA 3VAPA 2IN6A 4F70A 3QTXA 5CT0A 3EN4A 3Q5ZA 3KXMA 3ZZEA 4GFMA 3Q60A 4RIYA 4MHAA 3RM6A 4YO4A 4DAWA 4U79A 4XG7A 4OLIA 2OIBA 3EQIA 1TQPA 3HMOA 4U44A 1OM1A 4QYYA 5CANA 1JBPE 5LARA 3RK7A 3TI1A 4EC9A 2XNGA 4F64A 4HZRA 2R3PA 4JAJA 1OI9A 4CG8A 2OBJA 3C1XA 2WQOA 2PE0A 5L3AA 5KMNA 4PDYA 4HVSA 3ZRKA 1R0PA 3U9NA 4ZLOA 1RDQE 3EB0A 5ANDA 4CQGA 4EQCA 2R7IA 1ZMWA 4GMYA 5E8SA 4DEBA 4RLKA 4I22A 4XUFA 1Q97A 3BE2A 3MFRA 4YJPA 3TDWA 4U3ZA 5KHWA 3RPOA 3HX4A 3IOPA 4H36A 4YZ9A 4WBBB 2C6TA 2WTWA 4GT5A 3AXWA 3EMGA 4LFIA 4IAKA 4C36A 4EH6A 2JKQA 3HDMA 3O96A 4F08A 3AMYA 1YDSE 3A8WA 3Q3BA 4FVPA 4PDOA 4XCUA 4XV3A 3W8LA 1L8TA 3ZUTA 4CZUA 1OZ1A 4DYMA 5CZHA 1CM8A 4GK4A 3AD4A 4D2WA 3ET7A 3FAAA 1NXKA 4BHNA 2RFDA 5CF6A 2A4LA 3FKOA 4JNWA 5T6KA 2B4SB 5J1WA 3CIKA 4U8ZA 3UPXA 3BYVA 4QYEA 5DFPA 4DFBA 3UP7A 5K4JA 4NCTC 4FSUA 3AC8A 4FT5A 4RZWA 2CSNA 4C3PA 1SYKA 4F7SA 4QTEA 2QU6A 3LFEA 1KWPA 3C0HA 2GHLA 4YJNA 1H0WA 4AXAA 2J2IB 5E92A 2OH4A 3K5VA 3IS5A 4MKCA 1WBNA 1UNHA 3F3TA 3TL8A 4UX9A 1U5QA 5HTIA 2R3FA 2XYUA 4E73A 1UWJA 3I1AA 2F7ZE 4O0VA 3VRZA 5IF1A 4AGDA 4U97A 1R0EA 3BELA 4AA0A 3PIXA 4CNHA 4CFFA 4BWPA 4TWPA 3Q2JA 4GVJA 3FI4A 3PRIA 3LM0A 4QP8A 4R3RA 3QD3A 3LJ1A 2WOTA 4L52A 5IPJA 3QCXA 3ZBXA 4MXCA 1UU9A 3P4KA 3TNPC 2J0MB 4PP9A 5JFVA 2OLCA 3NUYA 4FX3A 1E1VA 1DI9A 2EB3A 4YHJA 4O7YA 4L67A 5HZNA 3BU6A 4N0SA 4EH5A 2OIQA 3WF7A 1UNGA 4DH3A 5CEMA 5IH5A 4C4GA 2RSVA 1Y6BA 4KWPA 4TY1A 5BVOA 2YIYA 3VS1A 2W1ZA 3TTIA 3ZSIA 1U59A 4HCTA 2ZB0A 4B6LA 3EQRA 4LM5A 4HYHA 5HNBA 2JLDA 4QTCA 5KZ0A 3QKLA 3ZMMA 1BLXA 2F57A 5I9YA 3DZQA 3R22A 3DXNA 3V04A 2Y6MA 3KRXA 4IW0A 3KY2A 3UYSA 2X4FA 1ERKA 2B52A 2JIVA 2XJ1A 4BKJA 2Y4PA 1Q8UA 4MNFA 4XS2A 4F6WA 4QMQA 2PUPA 1Q3WA 5A46A 3UPZA 5FBOA 4E6AA 4TWOA 3FZOA 2KULA 4ASXA 3TM0A 4FR4A 2O65A 3GU7A 4EH8A 3ROCA 1ZYCA 4Z9LA 4C4FA 3L1SA 4RX9A 2OIDA 5HNGA 4ZZMA 5IQAA 2PVKA 1G5SA 4S30A 5LOHA 4D5HA 2O63A 4FV4A 4ITJA 3LFQA 3CQEA 5IUGA 5CT7A 4NFMA 4QMXA 2WTCA 2OJIA 4BF2A 2CPKE 3NUSA 2WNTA 3MPTA 4U7ZA 4RX8A 4DG0E 2ITXA 4MH7A 4KNBA 1APME 2OF2A 1GZNA 2W99B 2UZOA 1ZOEA 4W4WA 3I4BA 5FD2A 2R3JA 2VZ6A 3VUKA 4AW2A 4D5KA 5JZJA 2J90A 3BLQA 2VTPA 4EOIA 4IACA 3HP2A 1GZOA 1LR4A 3U55A 2WAJA 1OVEA 5IQEA 3UG1A 1U5RA 3O8TA 3FI8A 4GEOA 3KCKA 2PY3A 3P7BA 1XH4A 3OXZA 4U6RA 5BYZA 4IX6A 4FSMA 3VS7A 3FUPA 3O2MA 4WNMA 4MNEB 2R2PA 2RFNA 3MIYA 4YTCA 3OW3A 4FTNA 3BQRA 1UVRA 5AUWA 3ZU7A 2WIPA 2XCKA 4V0GA 4WG3A 4IZ5A 3OHTA 3F3VA 4KS8A 4BCPA 5EKOA 2IW6A 1PY5A 3ZM9A 5ANEA 1DAWA 4QTBA 4JLCA 5F94A 4EQMA 1H07A 3OEFX 4XMOA 1A06A 3HECA 1Q61A 1DI8A 4BDIA 4TYHA 1CSNA 1WAKA 1YDTE 3LXKA 3NYOA 2A27A 4FV0A 3AD5A 3LXLA 3PJ8A 1T46A 3QTSA 4FKQA 2PVYA 5AP6A 3OFMA 4ANMA 4HCVA 3GU6A 3QKKA 3VBQA 5HEZA 5DR6A 4XX9A 2V5QA 4LOQA 3VUTA 3PG1A 2C0IA 3MI9A 2VTOA 2YM8A 2PSQA 4YSMA 4ASDA 3P23A 4K18A 1MRVA 4K8AA 3PPKA 4QNAA 2HAKA 5ACBC 2X8EA 2REIA 1LEZA 3DNDA 2IZTA 2WMQA 3LFSA 5I0BA 4EHZA 3NUXA 4ENYA 3K5UA 5AUTA 2UVZA 3QZIA 2IJMA 3ZS5A 3ORMA 2BIKB 2WOUA 2QOHA 2RFSA 4HGSA 5FP6A 3UO6A 4QT1A 4AW5A 3FZSA 4X3JA 2G2IA 2HYYA 2ITZA 3FL4A 3HEGA 3LXPA 4L9IA 4D1XA 4F9CA 4JBVA 5HLWA 4O7WA 3ZONA 4E6DA 5J95A 4JT3A 4CV8A 2BPMA 2CNQA 1WFCA 4JG7A 3ZO2A 4I3ZA 3TCPA 1QPEA 3FMJA 4O0RA 5HBEA 5HHWA 1YI6A 4M67A 1SNUA 3KXZA 2UZBA 3PJ1A 4N70A 4MXYA 3LPBA 3V8SA 4MXZA 3ZSHA 3FKLA 3QRIA 3HLLA 4MXAA 4FOCA 3PWYA 3MH3A 4NW5A 4XEYA 4CKIA 4FTAA 5ETCA 5GIPE 3RHKA 4NM5A 3QTZA 4RJ8A 4DT8A 3ZDIA 4C62A 3QF9A 4K11A 4RJ7A 3UGCA 3V5LA 4BDHA 3D2KA 3COIA 3QTUA 4RX7A 1OL6A 2BHHA 5DYJA 4FV5A 2VWBA 1AQ1A 1PKDA 4EOOA 1H1QA 2BRGA 1J7UA 3TJCA 4MEDA 3FQHA 2X8DA 3NRMA 5D9HA 5AMNA 4ANQA 3EYGA 1JQHA 3DB6A 3ZLWA 3D7TA 3CY3A 2GFSA 4AZEA 3VUHA 2XVDA 4NH1A 1OL2A 2WXVA 3D7ZA 4BR3A 5A4EA 1JKSA 5EI6A 3GGFA 3TV4A 2BFXA 4I5MA 4HYUA 2C5YA 3SRVA 2XEYA 4ITHA 5IA2A 1FOTA 2QVSE 5AP5A 1U46A 2XZSA 4G6NA 3ZLXA 4C8BA 3QTWA 3RBWA 4U80A 2VU3A 4BCIA 4QMLA 5AJQA 2HOGA 4U42A 3FZPA 2XBAA 3SKCA 2R0UA 3VO3A 2PVNA 3HV6A 4ANSA 5JN2A 1IA9A 4YUQA 3OXIA 4RQVA 2C6LA 5DR2A 3TV6A 2X8IA 2X9EA 4EC8A 1QPJA 4WG4A 4FKJA 4TTHB 4EWHA 4G5PA 2XA4A 4JI9A 3KXHA 3EYHA 3SAYA 3TNWA 4E20A 2XKCA 2YDKA 4TYGA 5GJGA 2E9NA 3PTGA 2XH5A 1XH5A 4AU8A 3VF9A 3LMGA 2PUIA 1IRKA 3SLSA 3OD6X 3ACJA 5CAPA 2X2KA 4L42A 4X2GA 4LL0A 5EDPA 4U45A 5IQBA 3OWPA 2ETMA 3P0MA 4KKEA 5LVLA 3R2BA 4A4OA 4Y72A 4WT6A 4BDFA 4CCUA 4DGMA 5F4NA 1FMOE 2E9PA 4A4LA 1OBDA 5A4QA 3Q4CA 2Z60A 2R3HA 4F9AA 2EB2A 2ITPA 3OEZA 3R30A 1TQIA 1YWRA 1PXKA 3EQPA 3PA3A 4IANA 3EOCA 5DLSA 5CALA 4DN5A 4FV8A 3OBGA 3FZRA 4EH3A 4O2ZA 5D41A 1Y8YA 3SQQA 2JBPA 3K3IA 4LYNA 3T9IA 4YMJA 5T3QA 3H9RA 4RMZA 5HESA 3NYNA 4KRDA 5K4IA 3O8UA 5J9ZA 2DWBA 4BCOA 2YWPA 3E63A 3WILA 3SW7A 3DKFA 3H9FA 3LFCA 4FZFB 4RIXA 4F1TA 4PV0A 5LMBA 4FNYA 2DUVA 4AFEA 2JIIA 5AEPA 4O6LA 4DFZE 1MUOA 4P4CA 3UZTA 3DBFA 2Z7RA 4ZSLA 3VS6A 3DOGA 4YC8A 3WE8A 1NVSA 4EZ3A 4BB4A 5AAGA 4DA5A 4L7FA 4BTMA 3BBTB 4WSQA 3PE1A 4FTUA 5JKGA 3FXWA 4X21A 3QQLA 3UNZA 3N51A 4EZ5A 2VTNA 3PLSA 4J95A 1J91A 4HPTE 4BDJA 2WMWA 3H30A 3KMUA 1CKJA 2ZV9A 3QRJA 4FV2A 5AWMA 3CLYA 3TJDA 2C30A 5DWRA 3F2NA 2X1NA 4TYJA 3MTFA 4C4EA 4C2VA 3ZO4A 3PWDA 2XK4A 4NZWB 4MWHA 4CV9A 2CLQA 2VUWA 3NCGA 4DBXA 3AMBA 4XG2A 5FG8A 5HG7A 3DK7A 3ENMA 4ASZA 4HW7A 2ZDTA 3DK3A 3DTCA 5AR5A 2I0YA 2UVYA 3UNJA 4EYMA 4RBLA 2UZNA 4FICA 4I6BA 5HG5A 4J52A 4KBKA 2J5FA 4A9SA 4FV1A 4O81A 4AWIA 2GTMA 3GUBA 4AZSA 2YDIA 4XOYA 3H4JA 4NWMA 4E8AA 2UW6A 4YR8A 4IAIA 4KB8A 5AR2A 4YHTA 3MVHA 3ODYX 5FUTA 5DRDA 4DEDA 4E4NA 1H1PA 3L9MA 3BWJA 3DXPA 3C51A 2WELA 2G2HA 4JIAA 5DPVA 3ERKA 3R7EA 3QFVA 4L43A 4EOPA 4FTTA 5DNRA 2OH0E 2PZIA 3D15A 4I41A 2RFEA 5K5XA 5J1VA 4NJDA 3E64A 4IM2A 3FXZA 3IW6A 5IKWA 5ANKA 4O7RA 1YOJA 2VV9A 4AGCA 5L2WA 2WTKB 4FNZA 4BYIA 5M55A 1I09A 4KIKB 2OK1A 4K6ZA 5BMMA 3TTJA 1FMKA 3MIAA 2X6DA 5LJJA 2QR7A 3BHHA 4E26A 5EYDA 5EYCA 4G3FA 1XHAA 4RT7A 4FOBA 2OJFE 4MXXA 4Y73A 3R1NA 4Y5QA 3UIXA 4R7BA 4AAAA 4FT3A 4UWCA 3SVVA 4WUAA 4HNFA 1M14A 4UY9A 2W96B 2VGOA 2VNYA 4O38A 4HVDA 2ZV2A 1W83A 2KTYA 1VYZA 4JBPA 4CCBA 4BRXA 4BDBA 4PPAA 4EK5A 5IUHA 1YVJA 4BCHA 1NY3A 2VX3A 4IVCA 4C3RA 5I9WA 4F6UA 5B7VA 3ZRLA 1WBVA 2VD5A 4UMPA 3LFAA 5AFVA 3FMLA 1PKGA 5BYYA 1XBBA 3F9NA 1WVXA 3VHKA 4E5BA 2A2AA 3QC4A 3BYUA 3SG9A 4BN1A 2W5BA 2BRHA 4GS6A 4I94A 4JOAA 5FDXA 4OW8A 5L2QA 4F1OA 5AR4A 2ITWA 4FVQA 3BV3A 3HDNA 4CFUA 1T45A 3F3ZA 1H0VA 2WU7A 3LFBA 5HE3A 3RI1A 3S95A 3C13A 2X2LA 3E62A 3F6XA 4WNOA 2CLXA 4QQ5A 4AF3A 4AP7A 4ORKA 1JPAA 4L8MA 4E5WA 5HNIX 5CEIA 3WYYA 4QQCA 2JAMA 2VTJA 5I4NA 5IH4A 1MP8A 1SVGA 2FSMX 2I40A 3HA8A 4NEUA 1H25A 2XIYA 5HCYA 3E93A 2R3GA 3RTPA 4JDHA 4GT3A 3OZ6A 5C9CA 4YGAA 4I23A 4JAIA 3BI6A 4AACA 4AZVA 2YIRA 3EN7A 4BCMA 1L3RE 4C58A 2NPQA 1BYGA 2ZDUA 4FKPA 3MFSA 5JRSA 1Q8YA 2JFLA 3EN5A 3OP5A 2F49A 2FUMA 3M2WA 4GIIA 2XYNA 1SM2A 1P4OA 2YN8A 3NW7A 4MD8E 2PMLX 3K2LA 4I93A 4UWYA 5HGIA 4BZDA 3H9OA 1W0XC 3RK5A 3W16A 3JPVA 5H8BA 4GH2A 3S00A 4FTMA 3RPVA 4CVAA 3CSVA 5EQYA 4FKOA 3SX9A 3GCUA 3HGKA 2OW3A 1Z9XA 3OTUA 4UEUA 2R4BA 3DNEA 1BX6A 2H34A 4FTKA 3VBTA 4YPSA 5FGKA 5AV3A 4GVAA 2LGCA 4JQEA 4PMPA 4QP2A 3R73A 2P3GX 4DEIA 5HX6A 3R9RA 3OXTA 4FK3A 4QTDA 5HTCA 2P2IA 3F5PA 5EW9A 3L8XA 4KIOA 4RJ5A 4FTJA 2PU8A 4R1VA 3ATSA 4DGNA 1ZOHA 4JRVA 4TWNA 4A9TA 5B2KA 5E8ZA 1OMWA 1ZXEA 5LXMA 2R3NA 3CBLA 5IA1A 4BC6A 1Q5KA 2ITTA 3KCFA 3HYHA 1TVOA 3TIZA 2ITYA 3EFWA 3QQJA 4LGGA 5CU2A 3ULIA 2CGVA 4WBOA 4P2KA 5A14A 3JR1A 5M56A 3WIKA 5C4KA 5CI6A 3A7JA 1BL7A 4Q9SA 4W4VA 4D4RA 3LCDA 3FQSA 3C4XA 3OWJA 4YZBA 4NJ3A 3NW6A 4D2RA 3GOKA 5GHVA 3PIZA 4BCGA 3TDVA 3QXOA 1PMEA 1JOWB 4B0GA 3QUEA 2QI8A 4U9AA 3E3BX 4FTIA 3KXNA 1YQJA 4WIHA 2Y7JA 3NDMA 3LZBA 3NUAA 3D0EA 1REKA 2OFVA 2RKUA 4C35A 4OTWA 3D5XA 4MAOA 3PY0A 4IC7A 4UYAA 3V5TA 2X0GA 4F7JA 1XH6A 3F66A 3FQEA 3II5A 2R3OA 3ZUUA 4CMOA 5KMJA 5EHYA 3CPCA 2W1IA 3R9HA 3A4PA 1GIJA 1RW8A 2ZV8A 1JKKA 3UVPA 3EHAA 3BEGA 2HZ4A 3CPBA 4QMYA 4Z55A 2C6EA 2CMWA 3PZHA 5I3OA 3HAMA 1PJKA 3R7YA 3E7VA 5L8JA 5KKRB 3DLSA 4QP6A 4HVHA 1OIQA 4YURA 2IW8A 2W1HA 4R3CA 2FA2A 2I0EA 5EHLA 5DN3A 2OU7A 4ZSJA 2QD9A 4L6QA 2OXDA 2WMTA 5HCXA 2VTAA 5ICPA 5IMXA 2Q83A 5AUXA 4AUAA 4ONAA 5CEPA 5K0KA 4DCEA 5DRBA 2V62A 4FT9A 5JQ5A 2R5TA 2W4JA 5KKRC 4ZJIA 5I9VA 5M09A 3FY0A 4EHEA 1M2QA 2QHMA 3E87A 3MJ1A 2WEIA 3QHRA 2E9OA 3IK3A 4IAFA 3WIGA 4QYHA 1GAGA 5IA3A 4E4LA 3PSCA 2YZAA 3V6SA 3LHJA 3R04A 2VTIA 2VTLA 4OTPA 4W9WA 4EK3A 1LEWA 3FMHA 4FUYA 2XKFA 3THBA 4XP0A 3DV3A 4K1BA 2FSLX 4C33A 5HTBA 2ZM1A 4DG2E 1GJOA 4M14A 3DQWA 4IDVA 4MQ2A 5CTPA 5H8GA 5CAUA 5JFWA 1YI3A 4UZHA 2J0IA 4BI0A 4O0WA 4EH4A 4W8EA 3ACKA 4R77A 3PXKA 4QOXA 3TUCA 3EFLA 1V0PA 2RF9A 4TW9A 4I0SA 3OS3A 2C5VA 4MBJA 3E3PA 3OUKA 4QMUA 5EM5A 1FINA 3ITZA 3Q04A 3UC3A 3AC5A 3ZM4A 5M4IA 5AP7A 1SVHA 3D9VA 2PUUA 3KMMA 4EUUA 4I0TA 4XH6A 4E3CA 5AV1A 4CKJA 1Y91A 2C6IA 2YIXA 4O7NA 2BZJA 2VWWA 4GFGA 4RRVA 3ID6C 3CJGA 3NMUF 1UA2A 4D9TA 1JKTA 3Q4TA 5E90A 5HICA 1ZMVA 3E92A 3V51A 3CC6A 2VO6A 3FI2A 2JIUA 2ZMDA 4RPVA 5HI2A 2IW9A 3U9CA 2EXCX 2RL5A 4NKAA 4OTRA 4WD5A 5A4TA 4PNIA 3VUDA 4ALUA 1BI8A 2QOQA 1M7QA 4UXQA 4JX7A 5HO6A 2CKPA 3AGLA 3FSKA 4H05A 5M44A 4FT0A 4FIJA 3FMMA 4GFOA 1H01A 2VO7A 4NT4A 3W2PA 5HE1A 3RJCA 3LCTA 2PZ5A 4J96A 5E8TA 3ZXTA 2FGIA 4BICA 4C2WA 4NK9A 5FEEA 4NIFB 4QMOA 3UTOA 3E8DA 3G9LX 4R8QA 2PWLA 4G3GA 3C4WA 1H28A 4FL3A 3RGFA 4A9UA 3CXWA 3T9TA 4TN6A 5IQDA 5AP1A 4EL9A 5JFSA 4DHFA 3MFUA 1V0OA 2GS6A 3KULB 4JDKA 4QQTA 1OIRA 2C5OA 4BWKA 4XJ0A 1AD5A 3I79A 5ETIA 4L3PA 1OPJA 1Z57A 5CSWA 2DS1A 5CEQA 1FQ1B 3KB7A 5L8KA 4O1PA 4H3PA 3QRUA 5JGAA 2XIXA 3BEAA 5DHJA 4FYOA 3N4VA 5M06A 5D11A 3RK9A 4IWQA 3CY2A 3NPCA 1YXVA 2YDJA 5IG1A 3L9NA 2GQGA 3PP0A 4U5JA 2ZMCA 3W2SA 3ZFYA 3S0OA 3O17A 4NTTA 3F82A 4WNPA 4C4IA 1JLUE 3LLTA 1ZY4A 3RALA 3IW5A 4K2RA 2YFXA 3F2AA 3VBYA 1WVYA 4YJUA 4RSSA 4BKYA 2PVHA 2W1GA 4KAOA 1XQZA 3R01A 4OBQA 4V0GB 4O27B 3FMNA 4ARKA 4F0FA 3FJQE 2XRUA 4O0YA 4XBUA 2WFYA 3U54A 3PJ3A 2G01A 3DAEA 3TV7A 3TT0A 5IEXA 4YJQA 2UW0A 2VO0A 3LCSA 2J0KA 2XKEA 4TNBA 4FEVA 3SGCA 2JC6A 4Y5HA 2HCKA 3LXNA 3QD0A 4RQKA 4BBMA 3I6WA 4DH5A 1S9JA 4A7CA 4USFA 4AN2A 3NIZA 2W4OA 3T3UA 4ZAUA 3A62A 2PMIA 3IDCA 4F6SA 2ZJWA 4XV9A 4YO6A 2B55A 4I5PA 2FH9A 2PMOX 4O83A 5DR9A 3VN9A 1BMKA 4WO5A 3RNIA 3T8OA 2WZJA 3UOLA 4IVAA 4AA4A 5CF4A 5CZIA 3TWJA 4EONA 1WMKA 3PP1A 2BAKA 3GC7A 3UBDA 4NW6A 4M66A 1PXNA 3BLHA 2VO3A 2C47A 4C0TA 5JZNA 3I7CA 3EIDA 5CLPA 4APPA 2OZAA 3KREA 2BKKA 2PVFA 3VBWA 4OAVB 3W18A 3JVRA 4Q9ZA 2XS0A 4IAZA 4JX3A 4EOJA 2BZKB 1JSVA 5BVDA 1LP4A 3VS2A 4IAAA 3RWQA 3RPSA 4YTHA 3HMIA 5FTGA 3PJ2A 5FM3A 3JY0A 1ZYSA 3P78A 3HMPA 4FIIA 4CXAA 2F2UA 2F2CB 4NIFA 4ZSGA 1YOMA 3DFAA 4FE2A 1U54B 1W7HA 4Y8DA 3D5UA 3I7BA 5E8WA 5F20A 4BBFA 4DH7A 3EZRA 5I9ZA 3GC0A 1PXPA 1FGIA 3GCSA 3HRCA 3MTLA 3JY9A 5B0XA 2IVSA 4D1ZA 3ZO1A 5EI2A 2ZB1A 3ELJA 5DT4A 3EQBA 1PF8A 3QQKA 3CR0A 4FSQA 4EK6A 5E1EA 2Z7LA 3DA6A 4FSRA 5DVRA 1MRYA 2YLFA 1VYWA 4L45A 5C01A 3BWFA 3Q52A 3UQCA 4FIEA 4MBLA 1OL5A 4DLIA 5KUPA 2IWIA 4NUSA 1VJYA 3VS5A 2C5XA 4X3FA 2XP2A 3R1YA 3MVJA 1ZARA 1ZYJA 1OUYA 4I6FA 4WKQA 3DY7A 5M4CA 3W2RA 4FKTA 1YXUA 4XOZA 3WARA 3ZUVA 3UO4A 2V55A 3NCZA 4RJ4A 3GU8A 4NCTA 5TE0A 4O84A 3DS6A 3D4QA 3QCSA 4RIOA 4C57A 4J53A 4L3LA 2OJGA 3FLSA 3BE9A 3ORTA 4NKSA 5EW8A 5IA5A 1FPUA 3OT8A 4MF1A 5E4HA 4F63A 1F3MC 5FWKK 4QPAA 5C1QB 2R64A 2HZNA 3IG7A 3IKAA 4PTEA 3NUPA 3ZZWA 3CGOA 3TEIA 2HK5A 2CGWA 4IQ6A 3V5WA 5HBJA 4UWBA 4ZZNA 3OWLA 3UG2A 2X2MA 3TKHA 4FIFA 4ZJVA 3MESA 3G5DA 2OGVA 1KOAA 4F9BA 1S9IA 3RAHA 5D1JA 5KMOA 5FRIA 5ACKA 2EU9A 4R1YA 3F3WA 3GXLA 3HKOA 3R9DA 2YA9A 3P79A 1KE9A 1WCCA 2NO3A 4RC3A 3R63A 5HVYA 4NM0A 4FBXA 2G9XA 2QLUA 2WQBA 3SW4A 4ANOA 3HA6A 4DEGA 5AR3A 4F0IA 3GCPA 1AGWA 2PZYA 3E8CA 3LQ5A 4HYIA 3ZEWA 4NL0A 2G1TA 1H1SA 5C8MA 4ACHA 3ZDUA 2YM3A 5J7BA 4YTIA 3FSFA 1QPCA 4DFYA 5BPYA 5IQFA 2R3IA 4A9YA 5A6NA 2J5EA 1OPLA 4BGHA 3ULZA 4FV6A 5ANIA 1NA7A 4G5JA 2PTKA 4IH8A 1PMNA 5I9XA 1FVTA 2GFCA 4ZTMA 1YKRA 3FZTA 1ZRZA 3UZPA 1H4LA 4X3FC 2XK7A 1Q24A 1ZLTA 2JGZA 2WMAA 2B9JA 3AC3A 4D2SA 4JBQA 2B9HA 4RGJA 3KA0A 3MJ2A 4HGLA 3S4QA 5F95A 3WZJA 3C7QA 4ZOGA 3CP9A 3V3VA 5M57A 3KRJA 3KEXA 3R8MA 1PYEA 5F1ZA 5J8IA 4CT2A 4FKRA 1MQ4A 3TNIA 4K0YA 1H00A 4FGRA 4RVMA 4D9UA 3ZLSA 4GKIA 4DT9A 3R6XA 3DJ5A 2P4IA 3EQGA 4GK2A 3F2RA 2OXYA 1NVRA 4ZK5A 5CNNA 5E8XA 4JDJA 1Q62A 3R7OA 1GZKA 3UODA 2I7QA 2JAVA 4PUZA 1FVRA 4UXLA 4AT5A 4ZY4A 4GW8A 3QKMA 3HZTA 4OTGA 3A8XA 3VS4A 4M97A 3SC1A 3UIMA 2WU6A 4DCAA 4AZTA 2YIWA 3W2CA 5GIOE 3LKMA 1E1XA 4HVIA 3RVGA 4LOPA 3UO5A 2Z7SA 5FQDC 4C4HA 3OMVA 4IMYA 4EQUA 4USEA 5EQEA 4IM3A 4CMTA 2ITVA 4GG7A 2R3LA 1OL1A 1JSUA 4F7NA 4JQ8A 1OB3A 4EOLA 1J7LA 4O0UA 4OTIA 5FM2A 4JS8A 4CG9A 2O5KA 3I6UA 4CTBA 5IMEA 2ETKA 5JQ8A 2C1AA 4V01A 3CKWA 1H27A 5LCJA 5IQGA 5DE2A 4WA9A 4ZP5A 1WBOA 2J51A 2QOCA 3FHRA 4LV5A 5D7VA 4MD7E 3QYWA 1HCKA 1OBGA 3ZCLA 4G6LA 3Q6WA 2HZ0A 4ENXA 1ZYLA 2JEDA 4TT7A 1UWHA 4JL9A 4BTFA 4KRCA 3I81A 3KXGA 4DH1A 4ALVA 2OZAB 2WTJA 2EXMA 5KHXA 3OCBA 4ERWA 2PPQA 3Q32A 1H24A 1UU3A 4ZXTA 3A7FA 3NS9A 5BUEA 3CE3A 3SXFA 1PHKA 3EFJA 3VUGA 1WBTA 4CRLA 4KINA 4ZSEA 2XIZA 2R3QA 3IPHA 3DJ6A 3UC4A 1JKLA 2YABA 5IISA 3SD0A 3C4CA 4ANBA 3OCGA 3GC8A 4RVKA 3IDBA 4G17A 5H9BA 2P0CA 4OR5A 5BVWA 1NW1A 2QC6A 1REJA 4RWIA 4ASEA 1KOBA 5KZIA 4CT1A 3KN5A 3TKIA 4D1SA 1TKIA 4FG7A 4FIGA 1SZMA 3EKKA 2WMXA 3BHYA 4KABA 4PRJA 4TKSA 2XNNA 5AV4A 3D83A 4TXCA 5CSHA 5BUIA 1UKHA 4FZ6A 1Y8GA 5C4LA 5FLFA 2X7OA 4D4YA 4ZS4A 2RIOA 2NNWB 2EVAA 5GINE 2C0TA 3IW7A 2OJ9A 5HD7A 3BV2A 2UW8A 5A3XA 1J3HA 2UZEA 4ITIA 2BUJA 2GMXA 3C4FA 3BX5A 2BHEA 3O8PA 3WF9A 3NUNA 5K9IA 3IGOA 3PZEA 1KE6A 4XBRA 3ORXA 3O7LB 4YC6A 3EQHA 5HG8A 2QO7A 4V05A 4D2PA 4QYFA 5L2SA 3ETAA 4G1WA 3ROYA 4M69A 4OTFA 5EOLA 1R3CA 4DTKA 3OG7A 3FPMA 4GUBA 5AIKA 3R7VA 3SXSA 5AP0A 3QU0A 4BDDA 3TZ9A 2XB7A 3PXZA 4IXPA 4GV1A 3JYAA 2Q0NA 4JVGA 1IR3A 3K54A 1RQQA 3VHEA 2ACXA 2R9SA 3DBDA 2WMVA 3A60A 3R7IA 4EBVA 3QCQA 4ANLA 3W55A 2ERZE 4BIEA 1CKPA 3DKGA 5HE0A 3RNYA 4E6CA 1OKVA 2AC3A 1BL6A 3WE4A 2OF4A 5KX8A 1YDRE 3MA3A 4FKSA 3D94A 5JK3A 4ANNA 2W1DA 3DBCA 3U8WA 3LLAA 1Q8ZA 5EHOA 5ANJA 4UV0A 3RCDA 5HLNA 2EXEA 4O7VA 5M4FA 3DTWA 3GEQA 4QNYA 3W33A 1ZAOA 4EK4A 1YXSA 4QP9A 2C69A 4FODA 1O6YA 2BR1A 4ID7A 3BYSA 1CTPE 5LMKC 5CXZA 1CMKE 2QKWB 3R9NA 3DBQA 4NSTA 2RGPA 4IWDA 4RIWA 4ZIMA 2F7EE 3R02A 5HBHA 2OXXA 4EEVA 4LGHA 3MH1A 3UE4A 3W2QA 1UKIA 4RFZA 4GU9A 2BZHB 4IVDA 3U87A 4Y85A 3GP0A 2CJMA 2UW5A 3POOA 3NNWA 4JG8A 4BIDA 5JH6A 2J0LA 2W5AA 4H1MA 2UZUE 1YI4A 4O22A 3VUIA 4N6ZA 5CU3A 3Q9WA 3F7ZA 2OSCA 5EH0A 1M2RA 3UDBA 4BGGA 2JKKA 3WOWA 5L2TA 2SRCA 3KRLA 3BHUA 2H9VA 3ZBFA 1CDKA 4E7WA 2HXQA 3G9NA 2YM7A 1FVVA 4YP8A 5HVJA 3GC9A 3N4UA 4KBAA 4N57A 5CVHA 1W84A 5AA9A 4MBIA 3BGPA 4AS0A 5LMKA 2OO8X 3PSDA 4K33A 4GJ2A 1H08A 2I6LA 2NRYA 3GOPA 3T3VA 3VQHA 4EJ7A 4A4XA 2X81A 2JKOA 3HV5A 4D2VA 1KUTA 4B99A 3GVUA 2QOFA 4RA5A 4MCVA 2P55A 3KRWA 3MGYA 4FSNA 4QQJA 5CVFA 2PE2A 5AM6A 3RPRA 4AA5A 4CEGA 5JRQA 4AOIA 2XCHA 4FEUA 4O21A 4O7SA 4BCKA 3EWHA 1URWA 4C4JA 5GZ8A 5CEOA 3FLQA 3NSZA 5A54A 4KA3A 5AUZA 2YEXA 3UIBA 5CF5A 3LCOA 3COKA 4XP2A 2AUHA 1B38A 4ACDA 3FWQA 4FSWA 5BNJA 4FT7A 2BZIB 2NRUA 3RAKA 4RVTA 4ZJJA 2YCRA 3EQCA 3E8EA 5IQCA 1GOLA 4UB7A 4GCJA 2B9FA 4QMMA 2ITNA 5DG5A 3OW4A 4OUCA 2GCDA 3PJCA 3FLZA 3EN6A 5IDPA 4FKLA 2WMRA 4DTAA 4LOOA 4CTCA 4RLLA 4H3BA 1ZMUA 5DA3A 3CEKA 4P7EA 5KMIA 4AOTA 4J99A 1PXJA 4WRSA 3G0EA 2VWUA 4BDKA 4BBEA 1F0QA 3NAYA 4L46A 4EKKA 3PG3A 2QODA 2BTSA 2HWOA 1H1WA 4JBOA 1VEBA 5AUYA 2WIHA 1OKYA 4JJRA 3QZFA 3WZKA 5CAOA 4EBWA 1URCA 3QQUA 2PK9A 4FSTA 3RZFA 3GCQA 1WBPA 3ANRA 4AW0A 3EH9A 3HL7A 4CKRA 5FXRA 3QGYA 2Y9QA 4S34A 1M2PA 3CS9A 4AZWA 4BGQA 2Z8CA 3C0GA 2BVAA 3NZ0A 3LOKA 4IBMA 3VNTA 5IQHA 3EQDA 4OTHA 4YZDA 3ENHA 3IQ7A 1Q4LA 3OY3A 2A0CX 4I6HA 5J7HA 4H1JA 4M7IA 1JAMA 3GFWA 2P33A 2WMUA 3M42A 4GK3A 3KF4A 4MXOA 3CQWA 3KL8A 5T68A 3ZHPC 2WQNA 4W9XA 3VVHA 4YBKA 5JEBA 3MB6A 2GHMA 4FV7A 4LMNA 2XNPA 2ZOQA 3NYXA 3TUDA 4HNIA 3RWPA 2X6EA 1DAYA 1WBSA 2WTKC 5AR8A 3W2OA 5ANGA 4X2JA 3DKOA 4FC0A 3F5UA 4EOQA 1KE8A 3D14A 4L01A 4ZEGA 2Q0BA 2WMBA 3PIYA 5A4CA 2CGXA 4LRKA 3JS2A 3U6HA 2PHKA 2YAKA 4OTDA 5IDNA 3DFCB 4WG5A 4XG4A 5EM7A 3VS3A 2HXLA 2IPXA 4YJOA 4IE9A 1K9AA 3FMDA 5FDPA 5I3RA 4O82A 5ETFA 1E9HA 1ZZ2A 3LCKA 4RWKA 3QLFA 4UYNA 4H39A 4O0SA 3ZTXA 5E8VA 3G2FA 4II5A 5GJDA 3HRBA 1ZWSA 5IH6A 3R83A 2BTRA 3AD6A 4BCJA 3SDJA 3ZFXA 3UP2A 5JMSA 3F61A 4KS7A 4O96A 4ERKA 3BHTA 4V04A 5HOAA 4PY1A 2CCIA 2HY81 1LPUA 3R7UA 3TN8A 3ZRMA 3TG1A 3QX4A 3UZRA 3QLGA 4PMTA 2X4ZA 4FYNA 3TNQB 1Y6AA 3HVCA 3DB8A 3E7OA 3OY1A 2XJ2A 1UU8A 3PY3A 2JDSA 5M51A 5DGZA 5DEWA 4TYIA 5CVGA 4CD0A 4BL1A 3ZLYA 5AAEA 2YIQA 4PP7A 3V5PA 5DT0A 1OECA 4XG3A 5HORA 4RVLA 5CSVA 3M11A 3V01A 3QTQA 3BGQA 1A9UA 4UMTA 5AUUA 3GNIB 2PVLA 3C5UA 4EOMA 4D28A 5AX9A 4A9RA 3S1HA 4G3DA 3F69A 5J79A 3RP9A 2W06A 5CSPA 4ZY5A 3H10A 4MF0A 1V1KA 4MWIA 3BGZA 1P5EA 2H8HA 2XM9A 4EHVA 4QRCA 4XRJA 2YITA 3KFAA 2O0UA 4AT4A 3JXWA 4DGGA 2BDWA 4L00A 3EQFA 4PMSA 3LMHA 2QOKA 4YZMA 1OUKA 3QHWA 3R2YA 3O71A 5J9LA 2PVRA 5HCZA 3CTJA 3R8ZA 3SRVB 1V0BA 3L8VA 4KD1A 4BDGA 3V5QA 2VWVA 1Q99A 3NGAA 4CLIA 1H26A 2UZLA 1P14A 2NP8A 4LRJA 2W9ZB 3NUUA 2WTDA 4B7TA 2V7AA 5L4QA 4YZNA 3GI3A 4M12A 3F88A 5L2IA 1BKXA 4BI1A 1K2PA 4YBJA 1YXTA 5DIAA 4CGAA 2Y4IB 1XR1A 3CQUA 4CYJA 4Q5HA 3TZ8A 2ZYBA 3PXQA 5G1XA 5EI8A 2VTHA 4BYJA 5K5NA 2C6DA 1QPDA 4LV8A 4DEEA 4O86A 4JQ7A 3VJOA 2GPHA 3O7LD 5CASA 4CFWA 4MD9E 3VULA 2JITA 3FBVA 3QC9A 3QWJA 1EH4A 3R28A 4FKVA 4WSYA 4OT5A 5HKMA 2FSOX 3L9LA 2Y4IC 5BVNA 4F9YA 3DJ7A 4IIRA 4LUEA 4RFYA 3UOHA 4GYIA 3A7GA 2QURA 3ORPA 5EDQA 1P4FA 2YISA 4PL3A 4B8LA 5CU0A 5EG3A 3NX8A 4JR3A 1A48A 3ZC5A 1YHVA 5A6OA 2J0JA 1JNKA 2G15A 4GYGA 4M0YA 1PMUA 1J7IA 1JWHA 3HV4A 3KVXA 4P5QA 5HQ0A 4PWNA 5BX0A 2JD5A 1OGUA 3QXPA 2UW7A 1SMHA 3BHVA 3P7CA 4FTLA 4ZY6A 4MVFA 4XG8A 1B39A 4CFVA 2GQSA 3VUMA 2IVVA 4DINA 3TXOA 1UV5A 4R7HA 3CD8A 5DH3A 2XMYA 1ZY5A 4U0IA 2C3IB 2VGPA 3P08A 4FTRA 2J4ZA 3LAUA 3Q9XA 4MYGA 5L6WL 3VBVA 4ZMEA 3OBJA 4S2ZA 4Z7GA 3DGKA 4W4XA 4TWCA 3U4WA 3MB7A 4JIKA 1ND4A 2RG6A 4Z7HA 1Q8WA 3HP5A 1YWNA 3ZYAA 5CX9A 4B9DA 5DEYA 2IO6A 4KIQA 5H2UA 3L8PA 2ONLA 3UOKA 4XV2A 3WF5A 3P1AA 3KKVA 3OROA 4W4YA 1YHWA 2PVMA 3Q2MA 3QZGA 2UZWE 2ZAZA 2WHBA 3BRBA 4QP4A 4YSJA 4GKHA 4D4SA 2UW3A 2YCSA 3PPZA 1VZOA 2PUNA 1O6LA 3WZEA 3G15A 3P5KA 3LM5A 4KUJA 2QOOA 4AW1A 2EWAA 4XNEA 3MFTA 4M13A 4FZ7A 1IEPA 4ZTRA 3ZEPA 2QOLA 4R7IA 3BQCA 2C1BA 4YLKA 2ETRA 2DQ7X 3I0OA 5D10A 3MY5A 2CDZA 4DTBA 4M3QA 4LRMA 2VWZA 4QD6A 3QQHA 4NM7A 4APCA 3FZ1A 5B2LA 5AX3A 5J9YA 1PMVA 4BCNA 4HJOA 4L3JA 1H8FA 3LQ3A 5CU6A 2ONLC 5EFQA 5KE0A 3G6GA 3HMMA 3C4EA 4AZFA 4CYIA 4C34A 3WBLA 3BYOA 4FTQA 3VS0A 1PXMA 3LQ8A 3CTHA 4F09A 2BAJA 4U81A 1PXLA 4WRGA 5HO7A 1PYXA 3PFQA 4I21A 5HE2A 2HZIA 5AM7A 3C5IA 1F5QA 5EKNA 3KRRA 4I5HA 2E2BA 3O50A 4OT6A 3OWKA 4RX5A 4IX5A 4IB1A 2ITUA 4KSQA 5KNJA 2QNJA 5B2MA 4QP1A 4UMUA 4DGLC 3MSSA 4AN9A 4MNEA 4J97A 4RIYB 4QO9A 4RIXB 2IZUA 2R7BA 3CKXA 1Z5MA 2AYPA 2YJRA 2W1FA 5JGDA 3FHIA 1BI7A 2QLQA 4XP3A 3LVPA 4BTKA 3TKUA 2OWBA 3CJFA 3OOGA 3H3CA 4AE6A 3GQIA 2XK3A 3PVUA 4XLIA 5LVMA 2C6KA 5CQUA 2GNIA 3MVMA 3PLAE 2QG7A 4KIPA 4ACGA 2HIWA 5CNOA 1PXIA 3AT3A 4KKHA 3FY2A 2XNOA 2WKMA 2CKQA 4XYFA 4EH2A 3RHXA 3S2PA 4O0TA 5M53A 4FTOA 1YXXA 2XJ0A 3PYYA 5AV2A 5A9UA 5M07A 1WBWA 2QKRA 4USDA 1Y57A 3FYKX 5ITAA 2B7AA 3NYVA 3WZUA 4JXFA 4X7QA 4N4SA 2B54A 4FV3A 2LAVA 1WVWA 2C0OA 4F1MA 3FLWA 5AR7A 5AP4A 5E8YA 2ITQA 1YOLA 2XK8A 2J7TA 3E88A 4O7TA 4LI5A 1H1RA 3JUHA 3NAXA 1YHSA 5HD4A 4LUDA 2VX1A 2AC5A 2VX0A 4Y83A 4YU2A 4L44A 5LWMA 1J1BA 1MQBA 3I5ZA 4E4MA 4RA4A 4RC2A 4R5YA 3IECA 5LCKA 4C7TA 3DCVA 3EZVA 5EK7A 4BDCA 4G3CA 3KULA 2BRNA 4J98A 4IWOA 2YJSA 1QL6A 1O9UA 4J8MA 1OKZA 1XBAA 5FTOA 2O3PA 3DK6A 4TYEA 4H58A 3UIUA 5HLPA 3TZMA 5GZAA 2OICA 4I20A 1W8CA 2XF0A 1GIIA 2CKOA 3AG9A 4O91A 4D0XA 2C6OA 3FKNA 3AC1A 5KMMA 3KMWA 3FEGA 4U43A 2XBJA 4ZTSA 3VC4A 5EQPA 2UW4A 2CHLA 4I6QA 1R78A 2I0VA 4U40A 2GTNA 3K3JA 5AP3A 4D0WA 4ZLYA 4GG5A 2C68A 2R3MA 3D7TB 3R21A 5H8EA 3OC1A 3ALOA 4QMPA 3F5GA 3UMXA 4NM3A 3RINA 5KMKA 2UVXA 4RC4A 3R8LA 4DBNA 5FP5A 4FKIA 4G6OA 2XEZA 3LE6A 3LJ0A 4H3QA 3MY1A 4FZDB 4G9CA 3AOXA 3SV0A 4DH8A 3UVQA 4RJ6A 4FG8A 4PTGA 4E4XA 4UALA 4BHZA 4K77A 4DGOA 2B53A 3QRTA 4EZ7A 2ESMA 4KSPA 3RM7A 2ZV7A 3HNGA 4I0RA 2A1AB 3VJNA 3N9XA 4QPMA 3MBLA 3EN9A 5ANOA 4ALWA 3NVMB 1DM2A 1SNXA 4RWLA 1HOWA 4F9WA 4BWXA 2BRBA 4CFNA 3LW0A 1M52A 4UZDA 4A07A 2PMNX 4DF3A 4FTCA 4E6QA 3H0YA 3ORKA 1OKWA 4FKGA 3OT3A 1O6KA
chains in the Genus database with same CATH superfamily
2UZTA 4NU1A 2VTSA 1VR2A 2BAQA 3QD4A 4XLVA 4PF4A 3R1SA 4UMQA 3LJ2A 3C50A 4QMZA 2VWYA 5E91A 5IEYA 5J87A 3DPKA 1YRPA 3R71A 5TOZA 5L6OA 3R7GA 3AT2A 3BLRA 3GBZA 5CYIA 4C02A 4HGTA 3BU3A 3A2CA 4IC8A 3MDYA 5DMZA 4EK8A 4EHGA 4M8TA 2UW9A 3VWAA 3NLBA 3BYMA 4AQCA 3RAIA 4FVRA 5KO1A 4S33A 4J8NA 5KMLA 3PA5A 3FLNC 2CNVA 4GJ3A 3FDNA 4IADA 3DZOA 4I4FA 4IB5A 3QRKA 3P86A 5GJFA 1I44A 1XH7A 4PMMA 1M17A 4O1OA 2E9VA 5FTQA 3B2WA 3FMKA 4FKWA 3MY0A 5M4UA 4ZMFA 5LQFA 3GCVA 1R39A 3PXYA 3W10A 2CCHA 4EJNA 4BVUA 3PSBA 2O8YA 4OBPA 4TRLA 4CFXA 1MRUA 2OJJA 3NNUA 5IUIA 2CNUA 2Y0AA 4YHFA 3CD3A 4UN0C 2RG5A 4TNDA 2QG5A 2GNJA 5HIBA 4J7BA 3FI3A 4ZLZA 4GUEA 2A19B 3D5WA 2PULA 3HAVA 3BKBA 3CTQA 1IAJA 3KXXA 2GNGA 3Q5IA 2W17A 3U4UA 5JT2A 2WGJA 4O7LA 2W05A 3QUDA 1KV1A 3LFNA 2BFYA 4FV9A 4IWPA 4PL4A 2B9IA 2Z2WA 2ZVAA 4MTAA 3EKNA 2PVJA 1W82A 5IQIA 4FG9A 4M0ZA 2UZDA 2J50A 3SOAA 3E8NA 4GL9A 2X39A 5BVEA 2BDJA 4MK0A 3PE2A 5KBRA 3AKLA 2ITOA 2X7FA 4E5AX 3QALE 1K3AA 3QUPA 4HZSA 5JGBA 2GHGA 3ZSGA 1ST0A 3F7WA 4GT4A 4JRNA 5G6VA 1WZYA 5K0XA 4M84A 3SG8A 2W1EA 1W98A 3B2TA 5LVOA 4E1ZA 5CQWA 4DFUA 4CZYB 4W8DA 2G2FA 4IFCA 2BKZA 4R5SA 4AQKA 3CCNA 4GIHA 4IX3A 1XWSA 4X2KA 3FYJX 3VBXA 5IU2A 3MPAA 4G16A 4QMNA 4OAUC 3W32A 2CN5A 2YM4A 3H0ZA 4EOSA 4Q2AA 3NIEA 5TT7A 3ORIA 4KBCA 4PQNA 1JSTA 2GNHA 2WPAA 4YJVA 2YACA 3A7IA 2BROA 5GZ9A 2W7XA 4F0GA 4HVGA 4FZAB 3Q96A 3OF0A 4AG8A 5IA0A 2VTRA 2IZRA 1YWVA 4BDEA 5CEKA 3RZBA 1ZZLA 1QCFA 1OL7A 2PYWA 2WQEA 3RMFA 3TNHA 3IO7A 1UU7A 1U4DA 2C3LA 4AOJA 4PX6A 5BMSA 4EI4A 2VWXA 3KK9A 4R78A 5EM6A 3ZFMA 2WO6A 4IM0A 1UNLA 1STCE 5C8KA 3U6JA 5DBXA 4CRSA 3TUBA 3KK8A 2VTTA 3OTVA 1XH8A 1JVPP 4PNKA 4FL2A 5LMAA 3GT8A 3U51A 4R3PA 3ZOSA 4X3FB 4G2FA 4EORA 4LMUA 5BVFA 4BKZA 2BALA 2WEVA 3R8VA 4Z3VA 3SOCA 3G51A 3QQFA 4DFNA 5LVPA 3UOJA 3LMIA 2JKMA 3P7AA 3HV3A 3OUNB 3SXRA 5BYLA 4AX8A 3G6HA 4O7ZA 4QMWA 1FBNA 3NVKI 5EDRA 4XG6A 3FLYA 4R6VA 3RCJA 4BDAA 4WNKA 4AN3A 2E9UA 3A99A 3PA4A 4Y46A 4G9RA 3QCYA 2IVTA 3AC4A 3COHA 5D12A 2FO0A 3AQVA 3VONA 1GY3A 4RWJA 3C9WA 4LGDA 3FV8A 2V0DA 4QPSA 1KSWA 4U3YA 4C61A 3KU2A 3FPQA 2YERA 5E8UA 1OIYA 2C4GA 3QBNA 5HO8A 5KCVA 3WI6A 2QCSA 4PDPA 5HVKA 1G8JA 3KQ7A 1PW2A 3MV5A 3KGAA 4ACCA 3BPRA 5M08A 4FNWA 3BBWA 4XHKB 5TF9A 1BUHA 3LIJA 3UMWA 2V7OA 1GNGA 3IW4A 2GS2A 3G33A 3POZA 4PTCA 4PPCA 3AC2A 4IEBA 5FEDA 5C27A 3ALNA 2YWVA 4DITA 4AE9A 1G8AA 5F9EA 2VTMA 3R9OA 5C8NA 5HIDA 3DBEA 3WYXA 5HX8A 3O0GA 3SA0A 3IGGA 4B4LA 2O2UA 5EW3A 3PVWA 3EJ1A 2O64A 3R1QA 3TZ7A 4X2NA 3WF6A 3IONA 5C03A 3C4ZA 1ZYDA 4HPUE 1J1CA 3B8QA 5D7AA 2YCFA 3MN3A 5BUJA 2DYLA 3FL5A 4Y95A 4RG0A 3QGWA 5BQ0A 4NFNA 4ZTLA 4BTJA 4CMUA 3QD2B 2P2HA 2CGUA 2C3JA 4NTSA 4QP3A 5EYMA 2JBOA 3S3IA 4TYHB 4IJPA 3WZDA 2YCQA 4KIKA 2UV2A 1HCLA 5CS6A 3REPA 5HU9A 2VNWA 3QQGA 3U6IA 4G31A 4J1RA 1RE8A 1KV2A 2PL0A 4FF8A 5IA4A 4D58A 2BRMA 3UQFA 4OGRA 4XRLA 2FB8A 2H6DA 4M69B 3VRYA 2OZOA 3ANQA 2CN8A 3GU4A 4C38A 3PXRA 3HMNA 2NYAA 3VF8A 4RFMA 4F99A 4FA2A 4FL1A 3PVGA 4EKLA 3OOMA 5CENA 4A06A 4OBOA 1R1WA 3DKCA 3MYGA 4B8MA 4TL0A 4Z16A 1OPKA 3GENA 3LFDA 4X2FA 4D2TA 1XKKA 3NNVA 2FVDA 3L8SA 4IZAA 4IZYA 4WOVA 3BIZA 1ATPE 3DU8A 4FKUA 4FEQA 4DE4A 2QR8A 5DOSA 2F7XE 4IZ7A 4N6YA 4FGBA 4S32A 4YZCA 3ORNA 2YZLA 2FYSA 3FC1X 3Q53A 3VIDA 5KBQA 3V6RA 4AGWA 4D4VA 2XNMA 2VN9A 1X8BA 4CQEA 2I1MA 1ZOGA 3FC2A 3A61A 4X6QC 3MH2A 2BILB 2C5NA 2JDTA 4I4EA 4TZRA 4M15A 4ACMA 4CFMA 4BZOA 4I92A 4EH9A 2GSFA 3BL7A 1Q3DA 2XIKA 4MQ1A 4RJ3A 4C59A 2ERKA 5IEVA 3JVSA 4KKGA 2EUFB 2B1PA 4YJTA 2YM5A 2GQRA 3MH0A 2JFMA 5LWNA 1KE5A 1GZ8A 3EL7A 3BZ3A 1IA8A 1CKIA 4IDTA 3MS9A 4L68A 3W8QA 5I5ZA 5JSMA 4DHIB 1PXOA 4IX4A 3QTIA 2BDFA 3ORLA 2F9GA 4C3FA 3FE3A 3HV7A 3HUBA 2QO2A 4Q5EA 4OTQA 3G0FA 3P9JA 3DDQA 3QX2A 5CY3A 4C37A 4BCQA 1XJDA 3O51A 3SHEA 2UUEA 5AV0A 3M1SA 3VW8A 4AT3A 1P2AA 5FEQA 2GDOA 2J6MA 2HW6A 2C3KA 5HU3A 2X9FA 5FBNC 4EH7A 2V22A 2XALA 4RIWB 2BCJA 4ZS0A 3V8TA 4FIHA 4K9YA 1XH9A 3QA8A 3A4OX 4YLJA 2OKRA 3ZC6A 4IB3A 2PZRA 5BV3A 3KVWA 3GQLA 2WQMA 5FXQA 4PPBA 3HRFA 4EYJA 3N4TA 2JDOA 2X7GA 5E9EA 5AIRA 2PE1A 4DEHA 4AXEA 4FNXA 3UQGA 3B8RA 2WTVA 2VAGA 4CZTA 3QWKA 4GSBA 2QHNA 4IAYA 4L53A 4L7SA 3TMOA 3OVVA 2XM8A 1NT2A 3DQXA 3A7HA 2WB8A 3R0TA 3GFEA 2FSTX 2J9MA 2ZM4A 3PPJA 4FI1A 4YNOA 5CWZA 5EYKA 3UVRA 3R8UA 4DEAA 4YTFA 3V8WA 1DS5A 4WUNA 2R3KA 4BCFA 1OITA 4ZTNA 2QOBA 2QQ7A 3PVBA 3QYZA 4I1ZA 3W1FA 3Q9YA 3IDPA 4I24A 3R8PA 2C6MA 3KN6A 3CGFA 3FMEA 3GB2A 4HOKA 2XNBA 3EFKA 5AP2A 3NR9A 3UJGA 3F3UA 4O2PA 2W0JA 2Y8OA 3MVLA 4D55A 5LVNA 4LQMA 4QMVA 4DC2A 2CKEA 3COMA 4AFJA 2XK6A 3IW8A 3HUCA 3LFFA 4EWQA 3ZH8A 1KE7A 4E93A 4HGEA 3RPYA 4BZNA 4FK6A 4P5ZA 2GNFA 4YC3A 4FMQA 5CU4A 4DFLA 5TKDA 2Y6OA 5J5TA 1Q41A 3MPMA 4QMTA 4F4PA 2JDVA 2UZVA 3E5AA 3ATTA 2QOIA 1B6CB 5BVKA 3MWUA 4DLJA 1TQMA 2BMCA 4CLJA 3O23A 5FXSA 4HYSA 4MX9A 2WTIA 2HWPA 5I9UA 3EL8A 3R00A 3RKBA 4NYEA 2JDRA 4PL5A 4JDIA 3ZO3A 3F5XA 3NNXA 2HELA 4QTAA 2ZM3A 4ZTQA 3QA0A 5CF8A 4TPTA 3I60A 4X6RA 4UMRA 4ZTHA 5E7RA 4FUXA 2B0QA 4FEXA 4FSZA 2QO9A 2GS7A 3IOKA 4BFMA 3QL8A 5HIEA 3UNKA 3WF8A 2IZSA 4J71A 3BU5A 4QMSA 4G3EA 4IJ9A 2OG8A 4XV1A 3I0QA 4S31A 2XK9A 2IVUA 3D2IA 5CI7A 4F65A 2HW7A 2XUUA 3PY1A 2R3RA 5AAFA 2VRXA 3OCSA 5CXHA 4AGUA 4ZZOA 2YLEA 4PDSA 2X0OA 5EOBA 4G34A 3OCTA 4IVBA 4DG3E 3V5JA 1NVQA 2XIRA 5JFXA 3PUPA 4O0XA 3ORZA 3UYTA 1XBCA 4EUTA 3TIYA 3DAJA 5TO8A 2VTQA 2GNLA 1G3NA 2W1CA 3GU5A 2R0IA 4YNEA 5ETAA 2XKDA 3KC3A 4XG9A 3MW1A 3Q4ZA 4HCUA 4IB0A 5E1SA 4GU6A 1FGKA 3AMAA 3Q9ZA 5L6PA 4BIBA 2XRWA 1QMZA 2I0HA 2VWIA 5TR6A 3AGMA 3I5NA 1RJBA 3MA6A 4P90A 2Z02A 3VQUA 1PRYA 2GU8A 3DT1A 3NWWA 4ZSAA 5DT3A 2YAAA 4QYGA 4UBAA 2WMSA 5EM8A 5J5SA 4IFGA 1SVEA 2WD1A 2OFUA 3RAWA 1OIUA 2H96A 4O6EA 4YJRA 3PDTA 3L9PA 1YW2A 3PXFA 5GNKA 5IZFA 4CSVA 3NEWA 1IAHA 4U41A 4YPDA 5HG9A 3BCEA 1XO2B 3TACA 2F4JA 4IHPA 4JG6A 4RZVA 4JR7A 2YHVA 4BY9E 2W4KA 2W5HA 1VLRA 3KF7A 3PRFA 2W9FB 3ZXZA 3QAME 2X0PA 3DAKA 2OI4X 4GRBA 2QU5A 3DLZA 5DI1A 4DFXE 4X0MA 1G8SA 2QONA 1GIHA 2Z7QA 3QZHA 4YJSA 1IASA 4EOKA 5CAVA 2XNEA 3Q6UA 4M68A 4WHZA 5CSXA 5AADA 5K3YA 1IG1A 3D5VA 2BIYA 1LUFA 4QP7A 3G90X 3NW5A 3VW6A 4I5CA 4YLLA 3QTRA 4BI2A 5L8LA 1M7NA 4FSYA 4LL5A 3DDPA 4LG4A 5AA8A 5C26A 2HENA 2PZPA 3AT4A 1Q8TA 3Q4UA 5H3QA 2IG7A 3FXXA 5AUVA 2HY0A 4FEWA 5A4LA 3DXQA 5CAQA 2YM6A 3ODZX 1U54A 4F7LA 3C0IA 3VAPA 2IN6A 4F70A 3QTXA 5CT0A 3EN4A 3Q5ZA 3KXMA 3ZZEA 4GFMA 3Q60A 4RIYA 4MHAA 3RM6A 4YO4A 4DAWA 4U79A 4XG7A 4OLIA 2OIBA 3EQIA 1TQPA 3HMOA 4U44A 1OM1A 4QYYA 5CANA 1JBPE 5LARA 3RK7A 3TI1A 4EC9A 2XNGA 4F64A 4HZRA 2R3PA 4JAJA 1OI9A 4CG8A 2OBJA 3C1XA 2WQOA 2PE0A 5L3AA 5KMNA 4PDYA 4HVSA 3ZRKA 1TFFA 1R0PA 3U9NA 4ZLOA 1RDQE 3EB0A 5ANDA 4CQGA 4EQCA 2R7IA 1ZMWA 4GMYA 5E8SA 4DEBA 4RLKA 4I22A 4XUFA 1Q97A 3BE2A 3MFRA 4YJPA 3TDWA 4U3ZA 5KHWA 3RPOA 3HX4A 3IOPA 4H36A 4YZ9A 4WBBB 2C6TA 2WTWA 4GT5A 3AXWA 3EMGA 4LFIA 4IAKA 4C36A 4EH6A 2JKQA 3HDMA 3O96A 4F08A 3AMYA 1YDSE 3A8WA 3Q3BA 4FVPA 4PDOA 4XCUA 4XV3A 3W8LA 1L8TA 3ZUTA 4CZUA 1OZ1A 4DYMA 5CZHA 1CM8A 4GK4A 3AD4A 4D2WA 3ET7A 3FAAA 1NXKA 4BHNA 2RFDA 5CF6A 2A4LA 3FKOA 4JNWA 5T6KA 2B4SB 5J1WA 3CIKA 4U8ZA 3UPXA 3BYVA 4QYEA 5DFPA 4DFBA 3UP7A 5K4JA 4AAYA 4NCTC 4FSUA 3AC8A 4FT5A 4RZWA 2CSNA 4C3PA 1SYKA 4F7SA 4QTEA 2QU6A 3LFEA 1KWPA 3C0HA 2GHLA 4YJNA 1H0WA 4AXAA 2J2IB 5E92A 2OH4A 3K5VA 3IS5A 4MKCA 1WBNA 1UNHA 3F3TA 3TL8A 4UX9A 1U5QA 5HTIA 2R3FA 2XYUA 4E73A 1UWJA 3I1AA 2F7ZE 4O0VA 3VRZA 5IF1A 4AGDA 4U97A 1R0EA 3BELA 4AA0A 3PIXA 4CNHA 4CFFA 4BWPA 4TWPA 3Q2JA 4GVJA 3FI4A 3PRIA 3LM0A 4QP8A 4R3RA 3QD3A 3LJ1A 2WOTA 4L52A 5IPJA 3QCXA 3ZBXA 4MXCA 1UU9A 3P4KA 3TNPC 2J0MB 4PP9A 5JFVA 2OLCA 3NUYA 4FX3A 1E1VA 1DI9A 2EB3A 4YHJA 4O7YA 4L67A 5HZNA 3BU6A 4N0SA 4EH5A 2OIQA 3WF7A 1UNGA 4DH3A 5CEMA 5IH5A 4C4GA 2RSVA 1Y6BA 4KWPA 4TY1A 5BVOA 2YIYA 3VS1A 3PUFC 2W1ZA 3TTIA 3ZSIA 1U59A 4HCTA 2ZB0A 4B6LA 3EQRA 4LM5A 4HYHA 5HNBA 2JLDA 4QTCA 5KZ0A 3QKLA 3ZMMA 1BLXA 2F57A 5I9YA 3DZQA 3R22A 3DXNA 3V04A 2Y6MA 3KRXA 4IW0A 3KY2A 3UYSA 2X4FA 1ERKA 2B52A 2JIVA 2XJ1A 4BKJA 2XARA 2Y4PA 1Q8UA 4MNFA 4XS2A 4F6WA 4QMQA 4AXDA 2PUPA 1Q3WA 5A46A 3UPZA 5FBOA 4E6AA 4TWOA 3FZOA 2KULA 4ASXA 3TM0A 4FR4A 2O65A 3GU7A 4EH8A 3ROCA 1ZYCA 4Z9LA 4C4FA 3L1SA 4RX9A 2OIDA 5HNGA 4ZZMA 5IQAA 2PVKA 1G5SA 4S30A 5LOHA 4D5HA 2O63A 4FV4A 4ITJA 3LFQA 3CQEA 5IUGA 5CT7A 4NFMA 4QMXA 2WTCA 2OJIA 4BF2A 2CPKE 3NUSA 2WNTA 3MPTA 4U7ZA 4RX8A 4DG0E 2ITXA 4MH7A 4KNBA 1APME 2OF2A 1GZNA 2W99B 2UZOA 1ZOEA 4W4WA 3I4BA 5FD2A 2R3JA 2VZ6A 3VUKA 4AW2A 4D5KA 5JZJA 2J90A 3BLQA 2VTPA 4EOIA 4IACA 3HP2A 1GZOA 1LR4A 3U55A 2WAJA 1OVEA 5IQEA 3UG1A 1U5RA 3O8TA 3FI8A 4GEOA 3KCKA 2PY3A 3P7BA 1XH4A 3OXZA 4U6RA 5BYZA 4IX6A 4FSMA 3VS7A 3FUPA 3O2MA 4WNMA 4MNEB 2R2PA 2RFNA 3MIYA 4YTCA 3OW3A 4FTNA 3BQRA 1UVRA 5AUWA 3ZU7A 2WIPA 2XCKA 4V0GA 4WG3A 4IZ5A 3OHTA 3F3VA 4KS8A 4BCPA 5EKOA 2IW6A 1ST4A 1PY5A 3ZM9A 5ANEA 1DAWA 4QTBA 4JLCA 5F94A 4EQMA 1H07A 3OEFX 4XMOA 1A06A 3HECA 1Q61A 1DI8A 4BDIA 4TYHA 1CSNA 1WAKA 1YDTE 3LXKA 3NYOA 2A27A 4FV0A 3AD5A 3LXLA 3PJ8A 1T46A 3QTSA 4FKQA 2PVYA 5AP6A 3OFMA 4ANMA 4HCVA 3GU6A 3QKKA 3VBQA 5HEZA 5DR6A 4XX9A 2V5QA 4LOQA 3VUTA 3PG1A 2C0IA 3MI9A 2VTOA 2YM8A 2PSQA 4YSMA 4ASDA 3P23A 4K18A 1MRVA 4K8AA 3PPKA 4QNAA 2HAKA 5ACBC 2X8EA 2REIA 1LEZA 3DNDA 2IZTA 2WMQA 3LFSA 5I0BA 4EHZA 3NUXA 4ENYA 3K5UA 5AUTA 2UVZA 3QZIA 2IJMA 3ZS5A 3ORMA 2BIKB 2WOUA 2QOHA 2RFSA 4HGSA 5FP6A 3UO6A 4QT1A 4AW5A 3FZSA 4X3JA 2G2IA 2HYYA 2ITZA 3FL4A 3HEGA 3LXPA 4L9IA 4D1XA 4F9CA 4JBVA 5HLWA 4O7WA 3ZONA 4E6DA 5J95A 4JT3A 4CV8A 2BPMA 2CNQA 1WFCA 4JG7A 3ZO2A 4I3ZA 3TCPA 1QPEA 3FMJA 4O0RA 5HBEA 5HHWA 1YI6A 4M67A 1SNUA 3KXZA 2UZBA 3PJ1A 4N70A 4MXYA 3LPBA 3V8SA 4MXZA 3ZSHA 3FKLA 3QRIA 3HLLA 4MXAA 4FOCA 3PWYA 3MH3A 4NW5A 4XEYA 4CKIA 4FTAA 5ETCA 5GIPE 3RHKA 4NM5A 3QTZA 4RJ8A 4DT8A 3ZDIA 4C62A 3QF9A 4K11A 4RJ7A 3UGCA 3BLAA 3V5LA 4BDHA 3D2KA 3COIA 3QTUA 4RX7A 1OL6A 2BHHA 5DYJA 4FV5A 2VWBA 1AQ1A 1PKDA 4EOOA 1H1QA 2BRGA 1J7UA 3TJCA 4MEDA 3FQHA 2X8DA 3NRMA 5D9HA 5AMNA 4ANQA 3EYGA 1JQHA 3DB6A 3ZLWA 3D7TA 3CY3A 2GFSA 4AZEA 3VUHA 2XVDA 4NH1A 1OL2A 2WXVA 3D7ZA 4BR3A 5A4EA 1JKSA 5EI6A 3GGFA 3TV4A 2BFXA 4I5MA 4HYUA 2C5YA 3SRVA 2XEYA 4ITHA 5IA2A 1FOTA 2QVSE 5AP5A 1U46A 2XZSA 4G6NA 3ZLXA 4C8BA 3QTWA 3AKKA 3RBWA 4U80A 2VU3A 4BCIA 4QMLA 5AJQA 2HOGA 4U42A 3FZPA 2XBAA 3SKCA 2R0UA 3VO3A 2PVNA 3HV6A 4ANSA 5JN2A 1IA9A 4YUQA 3OXIA 4RQVA 2C6LA 5DR2A 3TV6A 4F78A 2X8IA 2X9EA 4EC8A 1QPJA 4WG4A 4FKJA 4TTHB 4EWHA 4G5PA 2XA4A 4JI9A 3KXHA 3EYHA 3SAYA 3TNWA 4E20A 2XKCA 2YDKA 4TYGA 5GJGA 2E9NA 3PTGA 2XH5A 1XH5A 4AU8A 3VF9A 3LMGA 2PUIA 1IRKA 3SLSA 3OD6X 3ACJA 5CAPA 2X2KA 4L42A 4X2GA 4LL0A 5EDPA 4U45A 5IQBA 3OWPA 2ETMA 3P0MA 4KKEA 5LVLA 3R2BA 4A4OA 4Y72A 4WT6A 4BDFA 4CCUA 4DGMA 5F4NA 1FMOE 2E9PA 4A4LA 1OBDA 5A4QA 3Q4CA 2Z60A 2R3HA 4F9AA 2EB2A 2ITPA 3OEZA 2ZFYA 3R30A 1TQIA 1YWRA 1PXKA 3EQPA 3PA3A 4IANA 3EOCA 5DLSA 5CALA 4DN5A 4FV8A 3OBGA 3FZRA 4EH3A 4O2ZA 5D41A 1Y8YA 3SQQA 2JBPA 3K3IA 4LYNA 3T9IA 4YMJA 5T3QA 3H9RA 4RMZA 5HESA 3NYNA 4KRDA 5K4IA 3O8UA 5J9ZA 2DWBA 4BCOA 2YWPA 3E63A 3WILA 3SW7A 3DKFA 3H9FA 3LFCA 4FZFB 4RIXA 4F1TA 4PV0A 5LMBA 4FNYA 2DUVA 4AFEA 2JIIA 5AEPA 4O6LA 3P5JC 4DFZE 1MUOA 4P4CA 3UZTA 3DBFA 2Z7RA 4ZSLA 3VS6A 3DOGA 4YC8A 3WE8A 1NVSA 4EZ3A 4BB4A 5AAGA 4DA5A 2AQXA 4L7FA 4BTMA 3BBTB 4WSQA 3PE1A 4FTUA 5JKGA 3FXWA 4X21A 3QQLA 3UNZA 3N51A 4EZ5A 2VTNA 3PLSA 4J95A 1J91A 4HPTE 4BDJA 2WMWA 3H30A 3KMUA 1CKJA 2ZV9A 3QRJA 4FV2A 5AWMA 3CLYA 3TJDA 2C30A 5DWRA 3F2NA 2X1NA 4TYJA 3MTFA 4C4EA 4C2VA 3ZO4A 3PWDA 2XK4A 4NZWB 4MWHA 4CV9A 2CLQA 2VUWA 3NCGA 4DBXA 3AMBA 4XG2A 5FG8A 5HG7A 3DK7A 3ENMA 4ASZA 4HW7A 2ZDTA 3DK3A 3DTCA 5AR5A 2I0YA 2UVYA 3UNJA 4EYMA 4RBLA 2UZNA 4FICA 4I6BA 5HG5A 4J52A 4KBKA 2J5FA 4A9SA 4FV1A 4O81A 4AWIA 2GTMA 3GUBA 4AZSA 2YDIA 4XOYA 3H4JA 4NWMA 4E8AA 2UW6A 4YR8A 4IAIA 4KB8A 5AR2A 4YHTA 3MVHA 3ODYX 5FUTA 5DRDA 4DEDA 4E4NA 1H1PA 3L9MA 3BWJA 3DXPA 3C51A 2WELA 2G2HA 4JIAA 5DPVA 3ERKA 3R7EA 3QFVA 4L43A 4EOPA 4FTTA 5DNRA 2OH0E 2PZIA 3D15A 4I41A 2RFEA 5K5XA 5J1VA 4NJDA 3E64A 4IM2A 3FXZA 3IW6A 5IKWA 5ANKA 4O7RA 1YOJA 3UDTA 2VV9A 4AGCA 5L2WA 2WTKB 4FNZA 4BYIA 5M55A 1I09A 4KIKB 2OK1A 4K6ZA 5BMMA 3TTJA 1FMKA 4BJJB 3MIAA 2X6DA 5LJJA 2QR7A 3BHHA 4E26A 5EYDA 5EYCA 4G3FA 1XHAA 4RT7A 4FOBA 2OJFE 4MXXA 4Y73A 3R1NA 4Y5QA 3UIXA 4R7BA 4AAAA 4FT3A 4UWCA 3SVVA 4WUAA 4HNFA 1M14A 4UY9A 2W96B 2VGOA 2VNYA 4O38A 4HVDA 2ZV2A 1W83A 2KTYA 1VYZA 4JBPA 4CCBA 4BRXA 4BDBA 4PPAA 4EK5A 5IUHA 1YVJA 4BCHA 1NY3A 2VX3A 4IVCA 4C3RA 5I9WA 4F6UA 5B7VA 3ZRLA 1WBVA 2VD5A 4UMPA 3LFAA 3W0NA 5AFVA 3FMLA 1PKGA 5BYYA 1XBBA 3F9NA 1WVXA 3VHKA 4E5BA 2A2AA 3QC4A 3BYUA 3SG9A 4BN1A 2W5BA 2BRHA 4GS6A 4I94A 4JOAA 5FDXA 4OW8A 5L2QA 4F1OA 5AR4A 2ITWA 4FVQA 3BV3A 3HDNA 4CFUA 1T45A 3F3ZA 1H0VA 2WU7A 3LFBA 5HE3A 3RI1A 3S95A 3C13A 2X2LA 3E62A 3F6XA 4WNOA 2CLXA 4QQ5A 4AF3A 4AP7A 4ORKA 1JPAA 4L8MA 4E5WA 5HNIX 5CEIA 3WYYA 4QQCA 2JAMA 2VTJA 5I4NA 5IH4A 1MP8A 1SVGA 2FSMX 2I40A 3HA8A 4NEUA 1H25A 2XIYA 5HCYA 3E93A 2R3GA 3RTPA 4JDHA 4GT3A 3OZ6A 5C9CA 4YGAA 4I23A 4JAIA 3BI6A 4AACA 4AZVA 2YIRA 3EN7A 4BCMA 1L3RE 4C58A 3UDZA 2NPQA 1BYGA 2ZDUA 4FKPA 3MFSA 5JRSA 1Q8YA 2JFLA 3EN5A 3OP5A 2F49A 2FUMA 3M2WA 4GIIA 2XYNA 1SM2A 1P4OA 2YN8A 3NW7A 4MD8E 4LV7A 2PMLX 3K2LA 4I93A 4UWYA 5HGIA 4BZDA 3H9OA 1W0XC 3RK5A 3W16A 3JPVA 5H8BA 4GH2A 3S00A 4FTMA 3RPVA 4CVAA 3CSVA 5EQYA 4FKOA 3SX9A 3GCUA 3HGKA 2OW3A 1Z9XA 3OTUA 4UEUA 2R4BA 3DNEA 1BX6A 2H34A 4FTKA 3VBTA 4YPSA 5FGKA 5AV3A 4GVAA 2LGCA 4JQEA 4PMPA 4QP2A 3R73A 2P3GX 4QDEA 4DEIA 5HX6A 3R9RA 4DHJA 3OXTA 4FK3A 4QTDA 5HTCA 2P2IA 3F5PA 5EW9A 3L8XA 4KIOA 4RJ5A 4FTJA 2PU8A 4R1VA 3ATSA 4DGNA 1ZOHA 4JRVA 4TWNA 4A9TA 5B2KA 5E8ZA 1OMWA 1ZXEA 5LXMA 2R3NA 3CBLA 5IA1A 4BC6A 1Q5KA 2ITTA 3KCFA 3HYHA 1TVOA 3TIZA 2ITYA 3EFWA 3QQJA 4LGGA 5CU2A 3ULIA 2CGVA 4WBOA 4P2KA 5A14A 3JR1A 5M56A