5EKQD

The structure of the bamacde subcomplex from e. coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
b'EVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title The structure of the beta-barrel assembly machinery complex.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
total genus 73
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5ekqD00
4XI9A 5DIZA 2VSNA 2J9QA 3SF4A 4GYOA 3TGOA 5CCLA 2VYIA 4JHRA 5FZRA 3TG4A 4WNFA 3QKYA 3ESKA 4A1SA 5KJKA 2I6HA 1KT1A 4I9EA 3FP3A 3PE3A 3CKCA 2LSUA 3ASDA 2PL2A 1FCHA 4G1TA 2PZIA 4G25A 2C0MA 2R5SA 2L6JA 3PE4A 5FZQA 1WAO1 2IFUA 5JJTA 2VSYA 4LEUA 1NA3A 3CK7A 5BT1A 5FT9A 1WM5A 3CK8A 4AM9A 3RKVA 4JA7A 2C0LA 3N71A 3LY7A 4J8FA 3UUXA 2GW1A 1A17A 2KCLA 3BEEA 4U07A 2HYZA 3HYMB 4HOUA 3S7DA 5A6CA 3LKUA 4G26A 2UY1B 3GZ2A 4U0UA 1IYGA 2FBNA 5C1DA 2VGYA 4UI9K 3CVNA 4CGWA 3LY8A 2ONDA 5BW8C 4AY6A 5LCWJ 5KJMA 3CK9A 1HH8A 4UQYA 3QWPA 5ARFA 3RJVA 4J8EA 4U0SA 4JL0A 2FI7A 3EDTB 4GZ3A 4G2VA 4I1AA 5EX3A 4N39A 2KATA 5BNWA 4GZ5A 2PQRA 2JLBA 4N5CA 1HXIA 3QWWA 4I2WA 3S7BA 3ZN3A 4BT9A 4EQFA 5G04J 2VGXB 3U4TA 3IEGA 4BTBA 4IN3B 5M72A 4ME2A 3OXLA 3SZ7A 2Q7FA 3K9IA 4GPKA 5G05C 1Y8MA 2KCKA 3LCAA 4UQXA 4CGVA 4AIFA 2MHKA 4HOQA 3Q49B 5FTPA 3FWVA 1KT0A 2XCBA 4G23A 5LCWC 2UY1A 1P5QA 1OUVA 3GW4A 2AVPA 4J0UA 4GA2A 2LNIA 3ASGA 2BUGA 4NQ0A 4J8DA 3U3WA 4YVOA 4HOTA 3ULQA 3S7FA 3MV3B 4H7YA 5AYWD 4KXKB 3URZA 3Q4AB 1HZ4A 3QWVA 3KAEA 4UI9J 3S7JA 4Y6WA 4WNEA 3CVQA 1B89A 2HR2A 5DBKA 4HOSA 3FFLA 4N2SA 4GCNA 3AS8A 3PDNA 4GZ6A 3ZPJA 4N3BA 4ABNA 3CV0A 5D0OD 3ASHA 3KD7A 4HORA 4JA9A 3O48A 1YA0A 2VQ2A 3TG5A 1ZU2A 2FEZA 4B94A 1W3BA 2KC7A 2Y4TA 4O6FA 4G24A 3MEKA 3UPVA 1NZNA 2UWJG 2VGXA 3RO3A 2NC9A 3QOUA 5EX0A 1ELRA 3ZHEB 3JYSA 1NA0A 1ELWA 4N2QA 2WQHA 4I9CA 5ARGA 5HQ8A 4KYOB 4UI9C 5KJLA 2KCVA 4F3VA 2XPIA 3MKRA 3CVLA 3ASFA 4YNDA 4KBQA 3Q5MA 4U04A 3GZ1A 4GA0A 3QDNA 3ZGQA 2Y4UA 4N3AA 2LSVA 5FZSA 4Y6CA 1ZBPA 4NRHB 4W9RA 3CKBA 2OOEA 4N3CA 4WNGA 1PC2A 2XGSA 2XEVA 1KLXA 2V5FA 3ZFWA 3UQ3A 4AY5A 3OXFA 3LPZA 4GYWA 3AS5A 2XGMA 4I2ZA 4BWRA 3MA5A 3LY9A 3OXGA 5D0QD 5CHEE 3TAXA 3KS2A 3GYZA 3AS4A 4GYYA 4I17A 2P58C 2IF4A 3Q47B 2XCCA 5G04C 3NF1A 3E4BA 2DBAA 3WXXA 3R9AB 4RG6A 3ZHEA 4BTAA 5EKQD 1IHGA 2YHCA 2XGOA 4WNDA 5FJYA 5CCMA 4GCOA 2HO1A 1QZ2A 5G05J 2FO7A 4XI0A 4H7XA 4XIFA 4WUYA 1TJCA 4CDRA 1E96B 3MV2B 3VTXA 4APOA 2PQNA 5HI7A 4UQZA 2E2EA 3LYAA 2FF4A 3RO2A 4GA1A 5JJ7A 5JJ6A 3Q15A 3RU0A 1QQEA 2YQ8A 3RIBA 5A7DB 3CEQA 2C2LA 3VTYA 1XNFA 2QFCA 4RG9A 4BT8A 4YVQC 2WPVA 5KJNA 3CVPA 4U0ZA
chains in the Genus database with same CATH superfamily
5DIZA 1D8EA 2P9UG 3S2AA 2BKKB 1KZOA 5FQ7A 4JHRA 3C72A 2DZNA 2F37A 3FU5A 4CRWA 3V79K 4I9EA 2YNQA 4K5BA 5AJLA 3U64A 3PE3A 2DWZA 3ASDA 4A55A 3RSEG 3BQOA 1TYQG 1OY3D 1UW4B 2C0MA 4I1MA 4DX2A 2R5SA 4K5AB 2R2LA 3UIOC 5ANLA 3UMVA 3CK7A 2GGFA 1U3CA 5EDSA 5AQ9A 1HS6A 2ZISA 4FP7A 2Y0BG 3FUJA 3TWVA 4GMLA 3N71A 4C0MA 3LY7A 3W9FA 3CQGB 4J8FA 3OAWA 4YDWA 4FA6A 2KCLA 1PAQA 3B13A 4QFVA 1LTXA 5A6CA 2UY1B 1X5BA 3IHVA 2PNNA 2BEDA 3Q7FA 5T8IA 4GZDA 4GMJA 4MRUA 4XZ4A 4HRLA 3APFA 3CK9A 4V3IA 5KBAA 3U66A 3MKQA 4ZFHA 3PVLA 3SFZA 4U0SA 5AQAA 4FC8A 3CVUA 2EINE 4N39A 4I6EA 1JPLA 3FTZA 5CEDB 4E6HA 2JLBA 3KEZA 3NOCD 4Z68A 1BPOA 3I4RB 3KSLA 4DX1A 3ZYMA 3MKQB 4BT9A 4EQFA 3KSQA 4BESA 4ANUA 3IEGA 4ME2A 2LXMA 3OXLA 2Q7FA 1EDUA 4F53A 3SGHA 3LEWA 3RRUA 2KCKA 3ABLE 2X6KA 3BG1B 2WXIA 3P2BA 4CGVA 2IJGX 3B7BA 2XCBA 4G23A 2GRQB 3FUIA 3CHPA 1OXJA 4FJZA 1NP7A 4GTVA 2FULA 3AU4A 4HRNA 3V2OA 3X2QE 4WWPA 1HFAA 1EF1C 1N4PA 1UN8A 2LNIA 5ITZF 4HOTA 2LO6A 4F1PA 5AYWD 2QY7A 3FU0A 3QWVA 1D9SA 3ZYLA 4FHJA 5HS0A 2F8XK 2V0PA 3CVQA 4WNEA 5AQBA 4ILIA 1N4RA 4U95D 3PEVB 4PS8A 4GCNA 4HLEA 3JUIA 2H6GA 3JQ0A 4N3BA 3CV0A 5D0OD 4PUCA 1MYOA 4EBAG 2R03A 2VQ2A 2WXLA 4HQDA 2QYJA 1W3BA 2KC7A 4PH4B 3RAUA 4CDMA 1DVPA 2UWJG 3DSUA 2VGXA 4OAUC 3EU9A 5ANRA 3ULEG 3D9KA 3TWTA 3BG0B 2XHEA 4KT6B 3ML8A 4TXQA 1YCSB 3DSVA 4IRUA 2VSOE 2BTDA 2DYSE 3ULYA 1H2TC 4CEMA 3B7TA 4U7EB 2CHWA 4EZLA 4J6IA 2XENA 4X8QA 2XPIA 1OCRE 1QYMA 2A5EA 2X6HA 4U04A 4HLLA 2VTBA 3P1UA 1OCOE 3ZYKA 1JUQA 1N52A 1ZBPA 5AARA 4YDEA 5CECB 3CKBA 4OAVB 4P29A 4B89A 1E8ZA 5CBNA 2XGSA 2XEVA 1E8WA 4F6RD 3PZDA 3EIJA 3FU6A 5JMND 3OXGA 4DX6D 5E75A 2KZTB 2V8SE 4GYYA 1GW6A 1HX8A 4U63A 3UX4A 3HXFA 2XCCA 3UTMA 3NF1A 2Y1LE 2L9BA 4BERA 1IHBA 4C0EA 1INZA 4FLBA 4OVUA 2QYUA 3ZXSA 4RG6A 4BTAA 5C2YA 2DYRE 3APCA 4G8LA 2X38A 5D2MC 5CCMA 4GCOA 3LXUX 2FO7A 1H6KA 2IOSA 2LXLA 3ZUVB 3I5PA 3NB2A 1TN6A 2CG3A 4HVBA 1TR4A 3FEYA 1UJKA 5T4YA 2J08A 2E2EA 5T3RA 3I4GA 4LG6A 2FF4A 4OYSA 2V5QC 3EHRA 3LDZA 2ZGDA 5JJ7A 3Q15A 3UIPC 4UWKA 3CHSA 1MZCA 2WB2A 2RFAA 1S64A 2X6JA 2LAIA 2C2LA 2HM8A 3ZU7B 3VTYA 4RG9A 1IKND 3PZ1A 5CRUA 3O4ZA 4AV7A 4EPZA 4XI9A 3FDHA 3AU5A 1WY6A 2VSNA 2J9QA 3SF4A 4GYOA 3TGOA 5EYLA 5FZRA 5ENRD 4GU5A 3QKYA 1H19A 4BSZB 3ESKA 3IKOB 1FT2A 3RRMB 4ACKA 3J5QB 2M63A 4MS6A 1IXVA 3FUEA 4G1TA 2WXQA 4XKCA 2WXHA 3LJ3A 5FZQA 2Y69E 2IFUA 3FEXA 5A23A 4LEUA 2DVWA 1TN8A 1HU3A 4I6JA 4JA7A 4RVBA 3HXEA 4FHKA 4GTPA 4EZKA 5J90A 3G2WA 5JHBA 1A17A 4CZ2D 2IO3C 1UOHA 3BEEA 2I1KA 4UWLA 4HOUA 3LKUA 3ZEFA 4G26A 3IHYA 3E34A 1N4SA 3FH8A 4MLPA 4AEZC 2IOLA 4EZJA 4CGWA 3V31A 1TNOA 3MYVA 1H2UA 2ONDA 2I1JA 5BW8C 5EYPF 3HHMA 3T8KA 1QBQA 4TV3A 1HH8A 1KPSB 2YINA 1TNYA 3GZSA 1BI7B 1JCSA 4KMOA 4A3TA 4G2VA 3FUNA 2KATA 3HXBA 3EUVA 3ZIMA 1G3NB 2PQRA 3C5RA 2E0IA 3SBSA 3E32A 2J07A 2WQ6A 5G04J 3HVEA 2ILRA 2OVBA 1DC2A 2NSZA 1E8XA 5AN8A 2IO2C 4UWGA 3SD5A 1OWNA 5ENOD 3C3RA 1MJ0A 4ANWA 1O5MA 4K03A 3DSWA 4HOQA 3L13A 3FWVA 3UM3A 3TWSA 4DLOA 5IY5E 3HVEB 1N0QA 2L6BA 2UY1A 1DCQA 1SW6A 1L5JA 1OUVA 3ZYQA 3LS8A 3PNLB 2BUGA 4J8DA 2P9PG 3MV3B 4B0ZA 4L1BA 3NOGD 3QARA 2WXPA 4KXKB 2AJAA 3E33A 2ZU6B 3JXJA 3KAEA 4NURA 5CMYA 2WXJA 3DXKG 3G2UA 1DCEA 1B89A 4LRZA 4HOSA 3FFLA 3DPYA 3TXNA 3PDNA 4J7WA 3L9TA 3LVQE 2XEEA 2DZOA 4AXHA 4EBAA 4JA9A 4MBGA 3PH0C 3PRZA 4KVOA 3FH7A 4JW1A 3TWWA 4BX9A 4O6FA 4G24A 3JXIA 2VSXE 1NZNA 3G2TA 3ABKE 2NC9A 3QOUA 4G11A 5EX0A 3FTYA 1ELRA 3EJNA 2AXVA 3SHFA 1ELWA 3CLJA 4U96D 3LJNA 1E90A 4Q96A 4TXPA 2OEVA 1HF8A 4ATGA 3L08A 3MKRA 3CVLA 3B7RL 4DI4A 2IU1A 3ZKJA 3Q5MA 4EECA 4GA0A 4GPMA 5E76A 1OWOA 2LSVA 4Y6CA 3HXCA 1SQMA 4A63B 4DI3A 5KNHD 1IQUA 2OOEA 3F6QA 1PC2A 1N54A 3Q9UC 4JD2G 1O1TA 3SQVA 5ENSD 2P9IG 5BV1A 3ZFWA 3UQ3A 4L23A 2I2OA 2ETAA 5D0QD 5CHEE 3VLEA 3TAXA 4BX8A 3KS2A 3PZ3A 3AS4A 4TXRA 3CGHA 2MRIA 4HBDA 3TWUA 3Q47B 2R02A 2IQCA 2WXNA 2KXPC 3IV0A 3PS6A 3NZUA 1WG0A 3MCXA 3UM2A 3ASNE 3R9AB 4AJWA 3FTSA 3C3QA 3DEOA 3G2VA 1D8DA 5EIDA 4ILHB 3DSSA 3CQCB 4JEHA 2XRZA 3IBEA 5H7PA 1PY1A 5CBOA 2YHEA 3DBSA 4CDNA 4H7XA 1YMPA 3DRAA 1ZB1A 1TJCA 4CDRA 5JA4D 4APOA 3MJWA 3AAAC 4LSZE 4GA1A 4B8AA 3JUEA 4HRMB 3J5PA 3NQPA 4FJYA 4U8HA 1O1SA 4LUNU 4UWFA 2YQ8A 4DPRA 2AXUA 2WMNA 5G55A 4MKTA 2QZAA 4YVQC 3D9LA 4O1OA 4GTRA 4L2LA 4I6GA 3MZLB 1DNPA 1OT8A 4ANVA 2VYIA 4WNFA 2KZTA 2GRLA 2XZDG 3NZSA 4A1SA 5KJKA 4DX5D 1KT1A 2DIWA 2JEKA 4B8CB 2V4HC 3BUAA 2LSUA 3ASOE 3DEPA 3JCKC 4JHJA 3PE4A 1LF8A 2GROB 3EHQA 1NA3A 5BT1A 1Z5SC 5BUZA 2HE0A 5FT9A 3L16A 3Q78A 3CK8A 4AM9A 2R17C 4HI8A 3RKVA 2NXPA 3FTVA 3AG3E 2L0TB 5FQ8A 3UUXA 3V30A 2GW1A 3EHNA 3AG4E 2FO1E 2EIJE 4ZHBA 2HYZA 3HYMB 5HRYA 5EILA 2V4LA 4U0UA 2B6CA 3VLFA 1RZ4A 1IYGA 2VGYA 2RKKA 3FULA 5BXOA 3DXMG 3CVNA 5HKPA 3FY4A 3Q7AA 5ENNA 3D9OA 4GB9A 4AY6A 5LCWJ 4HS2A 5KJMA 1N4QA 1BI8B 2AWIA 2VGEA 1N95A 5ARFA 1SZ9A 4JL0A 2FI7A 3EDTB 2F0YA 2ZXWE 4I1AA 2P2CP 3PREA 5BNWA 4GZ5A 4BY6A 2QC9A 4N5CA 1HG5A 3DSXA 3D9IA 4GTSA 4XEIG 4LNUD 4ILGA 2A5UA 3Q75A 3ZN3A 2GRMA 3G2SA 4BTBA 4IN3B 5M72A 2L0IA 1N0RA 3ZRHA 3K9IA 4GTMA 5G05C 1JWGA 5FQ4A 3LCAA 2DCPA 4UQXA 4A1GA 4HFGA 3L54A 3UM1A 3E30A 4LCTA 3Q49B 5FTPA 1S0PA 1KT0A 2WVIA 4Q69A 1K1BA 1YYHA 3HXDA 3ONLA 2J4BA 3PZ4A 3NAWA 1P5QA 3JQ1A 4J0UA 3PUKA 4TUUA 3ASGA 4YVOA 4TUMA 1SZAA 2I9CA 3S7FA 4H7YA 1Z6TA 3URZA 3Q4AB 1HZ4A 4J8YA 4GZCA 4UI9J 1OWLA 3TWXA 4C9BB 4JB8P 2HR2A 3KEAA 1IQRA 1FT1A 3DWLG 4NIKA 5KCMA 2WXKA 3AS8A 4M3OA 5AJDA 3ZPJA 4ABNA 3FUHA 3ASHA 4ATZD 4HORA 1A5EA 5BPPA 1YA0A 3TG5A 2FEZA 2CG2A 2Y4TA 4C48B 1E8YA 3OTNA 3PNTB 3D9HA 5FQ6A 4UWHA 5FWQA 4XE0A 2X3MA 3U9WA 3FHEA 4LERA 3UT7A 3ZHEB 3JYSA 1EYHA 1MX6A 2XZTG 2AXZA 3DSTA 3C3OA 4BFRA 5ARGA 2ETCA 2EIKE 4KYOB 3BU8A 1S63A 4WAFA 5B3SE 4WWNA 2R59A 3E37A 4YDYA 2X6FA 5J08A 2IONA 3AG1E 1MQSA 4KBQA 3GZ1A 3SFYA 4B93B 3ZGQA 2Y4UA 2WXFA 4U8YD 1FVFA 1TNUA 4NRHB 4XX5A 5B1AE 3CVVA 4N3CA 2H6HA 3IXEA 4A3VA 3Q73A 2EILE 1KLXA 3CSFA 5EIBE 2V5FA 4AY5A 1E7UA 3OXFA 3LPZA 1BU9A 4BWRA 4YDOA 5BV0A 5KWDA 1E7VA 3Q79A 5ENQD 4KVMA 3SY2A 5BXUA 1V55E 1OCCE 4F7AA 5EN5D 2KBXA 3I3NA 1N94A 2R05A 5LOZA 1XGWA 5CEAA 5CRVA 3L17A 3WXXA 3SO8A 3D9JA 1TEZA 1MX2A 1QNFA 4UUCA 1IHGA 4WNDA 5FJYA 4R7LA 1Y6IA 2XS8A 1HO8A 1K1AA 4DLQA 1QZ2A 4BSXA 4KZ0A 4XI0A 2GRPB 2H6FA 4FU3A 1H0AA 1UJJA 4WUYA 3SI5A 4QQIA 1E96B 2WXRA 3EIQC 3VTXA 2PQNA 2A4ZA 5HI7A 4UQZA 2XRYA 2MYOA 3R9MA 3ISMC 4PS3A 3APDA 1O1RA 2J8SD 2BKGA 2WXMA 1QQEA 3RK6A 3RIBA 3CEQA 4D10C 3QNKA 3T8MA 3UT8A 1XNFA 3QJZA 4AP2A 5KJNA 1U2VG 1KZPA 1OCZE 4K5CA 3CHQA 3FUMA 4U0ZA 1N9AA 5CCLA 5AQ7A 3TG4A 1JCRA 3CSTA 3FUKA 3CHRA 3D9PA 3B95A 4L2YA 5ENTD 2I6HA 3UI2A 2P9NG 2CFUA 3FP3A 4M7CA 4L9PA 2X6IA 1MX4A 3CKCA 1LD8A 3CVYA 3L6AA 4DUIA 2PL2A 1UN9A 1FCHA 2PZIA 3FTUA 4G25A 3CHMA 1Z3YA 2L6JA 4URKA 1WAO1 2MOWA 3CIAA 5JJTA 2VSYA 3HRAA 3L22A 3HIZA 1WM5A 2EIME 3TWQA 4WWOA 4IYPA 1H6PA 2C0LA 3CHOA 3T9KA 2IY0C 2OV8A 3QC1A 2P9KG 4U07A 3S7DA 4OVVA 2WM9A 4JXTA 3FTXA 3GZ2A 4JHKA 1NL4A 1RW2A 4L7TA 2FBNA 3AG2E 5C1DA 4UI9K 1OWMA 2LAHA 3SFXA 4KZCA 3LY8A 3FH5A 4RQIA 3DPDA 3ZVVA 4CYMD 2Y3AA 1WDYA 3Q9NC 1UG3A 2WXOA 3RRNB 3SNXA 4UQYA 2F8YA 5CERB 3QWPA 1HE8A 3RJVA 4J8EA 4BETA 4GZ3A 2XQ0A 5EX3A 2CFZA 4AOFA 1JWFA 5AENA 2J09A 2OVFA 3EHMA 1BLXB 1SA4A 1TNZA 1HXIA 1N11A 3MGBA 4PS7A 4IULA 3L82A 3QWWA 3SBTB 3ZW3A 4I2WA 1FPPA 3S7BA 2ZGGA 4GMRA 2VGXB 1U3DA 3U4TA 5LP0A 2BF0X 4O1PA 3B7SA 3SZ7A 1TNBA 1LD7A 1FVHA 2XS1A 1H6OA 4GPKA 1Y8MA 3VLDA 1TN7A 4AIFA 2MHKA 4HB5A 4ACLA 3HG0D 1S70B 3TWRA 4XKBA 5LCWC 4DJAA 4BEPA 2B0OE 3UM0A 4RLYA 4I1OB 3ESLA 3B7UX 3GW4A 2AVPA 4FADA 4GA2A 3C98A 1Q2ZA 4NQ0A 3U3WA 4HXIA 3ULQA 1X81A 2VTBB 2XEHA 3CVWA 1AWCB 2RFMA 3CR3A 2GRNB 3FU3A 4JC8A 1SVXA 3S7JA 5AIJA 4Y6WA 2JABA 3UT4A 3T5XA 5DBKA 1TJFA 4N2SA 1NI1A 4GZ6A 3HDXA 4PDXA 4FULA 4GTOA 4G8KA 2AW6A 3CVXA 2P9SG 3KD7A 5FIOA 3O48A 2KM4A 3R7QA 1ZU2A 4CT4A 1H2VC 4B94A 3ABME 2WMOA 3MX3A 2RD0A 2P9LG 2RG8A 4NACA 3QB2A 4I43A 4JEUA 3MEKA 3UPVA 3ONKA 3RO3A 2CHZA 3ENEA 3EU5A 5ENPD 1NA0A 3TL5A 4GTTA 4N2QA 3LVRE 4RSYA 5CMWA 2IEJA 2LUHA 4K0RA 2WQHA 4I9CA 5HQ8A 4UI9C 5G2NA 4DK5A 2NYJA 5KJLA 2KCVA 4F3VA 4CT0A 4JZYA 4DX7D 1AP7A 3ZXPA 4LNBA 5D66A 3FUFA 3UINC 3ASFA 4YNDA 4N5QA 2PM7A 3D9MA 2EQXA 3PZ2A 3QDNA 5KNGA 2WQ7A 4GAAA 2OEWA 4N3AA 5FZSA 3QAQA 4U8VD 4W9RA 4GTQA 3PEUB 5LX8A 4AVXA 4WNGA 4Q94A 2XPYA 2ZIRA 1HG2A 2WXGA 4APFA 4GYWA 4F1SA 1ELKA 3AS5A 2XGMA 4I2ZA 4TRQA 3TXMA 3MA5A 3LY9A 4FLHA 3TJPA 4JPSA 1OWPA 3V2XA 1Z3XA 4O60A 3R7RA 2ETBA 3ML9A 3GYZA 4HI9A 4E85A 4I17A 2VJ8A 2GRRB 2P58C 1JCQA 2IF4A 1V54E 3FUDA 1MHQA 1BD8A 4HNAD 5G04C 3T5VA 3E4BA 2DBAA 3NBNB 4EHMA 5B1BE 5JHAA 3D3MA 1NFIE 3FTWA 4DRXE 4CCAA 3ZHEA 3UKUG 5EKQD 3W9GA 4J8SA 3UXGA 2YHCA 2XGOA 3QK0A 2HO1A 5G05J 2OCCE 2J4DA 3D9NA 4ANXA 4XIFA 2XPZA 3PUJA 4LNGA 3ZNGA 3AJIA 3MV2B 2CHXA 5AAOA 1SA5A 3LYAA 3RO2A 1K3ZD 3UKRG 5JJ6A 4JVSA 1K8KG 1EPUA 2J49A 3RU0A 5LFAA 5A7DB 2PM6A 1VDYA 2QFCA 4BT8A 2H6IA 2WPVA 3WG7E 3CVPA 5FINA
chains in the Genus database with same CATH topology
4XI9A 5DIZA 3FDHA 3AU5A 1WY6A 2VSNA 2J9QA 3SF4A 4GYOA 4L2LA 4I6GA 3S2AA 3TGOA 5FQ7A 3O4ZA 5CCLA 3MZLB 1DNPA 4ANVA 2VYIA 4JHRA 5FZRA 3TG4A 4WNFA 2KZTA 4GU5A 3QKYA 2GRLA 3CSTA 1H19A 3FU5A 3NZSA 3ESKA 4A1SA 3FUKA 3CHRA 3D9PA 3IKOB 5KJKA 4L2YA 2I6HA 3RRMB 4ACKA 4CRWA 1KT1A 4I9EA 2M63A 2DIWA 2YNQA 2CFUA 2JEKA 4MS6A 5AJLA 3FP3A 3U64A 3PE3A 4B8CB 2X6IA 3CKCA 2LSUA 3ASDA 3FUEA 3CVYA 3L6AA 4A55A 2PL2A 3JCKC 1UN9A 1FCHA 4G1TA 4JHJA 1UW4B 2PZIA 2WXQA 2C0MA 3FTUA 4G25A 4XKCA 3CHMA 1Z3YA 4I1MA 2WXHA 2R5SA 2L6JA 3LJ3A 3PE4A 5FZQA 4URKA 1LF8A 1WAO1 2MOWA 2IFUA 3FEXA 3CIAA 5JJTA 5ANLA 2VSYA 4LEUA 3UMVA 5A23A 1NA3A 3CK7A 5BT1A 2GGFA 5BUZA 3L22A 5FT9A 1U3CA 3HIZA 3L16A 1WM5A 3CK8A 4AM9A 5EDSA 1HU3A 2R17C 4I6JA 1HS6A 4WWOA 4IYPA 3RKVA 4FP7A 2NXPA 4JA7A 4RVBA 3FUJA 3FTVA 2C0LA 2L0TB 4FHKA 3CHOA 4GMLA 4EZKA 3N71A 4C0MA 5J90A 3LY7A 5FQ8A 3CQGB 3G2WA 4J8FA 3UUXA 2GW1A 3OAWA 4FA6A 5JHBA 1A17A 2KCLA 3EHNA 3BEEA 1PAQA 2OV8A 2I1KA 3QC1A 3B13A 4QFVA 4U07A 2HYZA 4UWLA 3HYMB 4HOUA 3S7DA 4OVVA 2WM9A 5A6CA 3LKUA 4JXTA 3ZEFA 3FTXA 4G26A 3IHYA 2UY1B 2V4LA 3GZ2A 4JHKA 4U0UA 3FH8A 4L7TA 3VLFA 4MLPA 4AEZC 1IYGA 2FBNA 2IOLA 2VGYA 5C1DA 3FULA 4UI9K 4EZJA 1OWMA 1X5BA 2LAHA 3CVNA 4CGWA 3IHVA 3FY4A 4KZCA 3LY8A 3FH5A 3MYVA 1H2UA 2ONDA 3D9OA 4GB9A 2I1JA 5ENNA 3DPDA 5T8IA 3ZVVA 4GZDA 5BW8C 4AY6A 4GMJA 3HHMA 4MRUA 4XZ4A 2Y3AA 5LCWJ 4HS2A 5KJMA 3APFA 3CK9A 1UG3A 2WXOA 4V3IA 4TV3A 3U66A 1HH8A 3RRNB 3SNXA 4UQYA 2AWIA 3MKQA 2YINA 3QWPA 5ARFA 1HE8A 1SZ9A 3GZSA 3PVLA 4J8EA 3RJVA 3SFZA 4U0SA 4JL0A 4KMOA 2FI7A 3EDTB 4FC8A 4A3TA 3CVUA 4GZ3A 4G2VA 4I1AA 3PREA 2XQ0A 5EX3A 4N39A 3FUNA 2CFZA 4I6EA 4AOFA 1JWFA 2KATA 5AENA 2J09A 5BNWA 3ZIMA 4GZ5A 2OVFA 2PQRA 4BY6A 1JPLA 3EHMA 3FTZA 4E6HA 2E0IA 2JLBA 4N5CA 1HXIA 3MGBA 1HG5A 3KEZA 3SBSA 4PS7A 3D9IA 4IULA 3QWWA 3SBTB 1BPOA 3I4RB 3ZW3A 4ILGA 3ZYMA 4I2WA 3S7BA 2A5UA 2J07A 3MKQB 3ZN3A 4BT9A 4EQFA 5G04J 2WQ6A 2GRMA 3HVEA 3G2SA 2VGXB 4ANUA 1U3DA 2ILRA 3IEGA 3U4TA 4BTBA 4IN3B 5LP0A 2BF0X 5M72A 4ME2A 3OXLA 2L0IA 2OVBA 3B7SA 2NSZA 3SZ7A 1FVHA 2Q7FA 1E8XA 3ZRHA 3K9IA 1EDUA 4F53A 3SGHA 4GPKA 4UWGA 3SD5A 5G05C 1JWGA 3LEWA 1OWNA 1Y8MA 2KCKA 3LCAA 5FQ4A 2X6KA 3RRUA 3BG1B 2DCPA 3VLDA 4UQXA 4A1GA 2WXIA 4HFGA 3P2BA 4CGVA 4ANWA 3L54A 4K03A 4AIFA 2IJGX 2MHKA 4HOQA 4LCTA 3Q49B 3L13A 5FTPA 3FWVA 4ACLA 1S0PA 1KT0A 2XCBA 2WVIA 4G23A 4Q69A 3FUIA 4XKBA 3ONLA 3CHPA 2J4BA 5LCWC 4DJAA 4DLOA 4FJZA 3HVEB 1NP7A 2FULA 2UY1A 3AU4A 1L5JA 1P5QA 1OUVA 1HFAA 4WWPA 1EF1C 4I1OB 3ESLA 3ZYQA 1UN8A 3B7UX 3GW4A 2AVPA 3JQ1A 3LS8A 3PUKA 4GA2A 2LNIA 3C98A 4J0UA 4TUUA 4FADA 3ASGA 2BUGA 3PNLB 4J8DA 4NQ0A 3U3WA 4YVOA 4HXIA 1SZAA 4HOTA 2LO6A 2I9CA 3S7FA 3ULQA 3MV3B 4B0ZA 2VTBB 4H7YA 4L1BA 5AYWD 2QY7A 1Z6TA 2WXPA 3FU0A 3Q4AB 1HZ4A 3QWVA 3QARA 2ZU6B 4KXKB 3URZA 3CVWA 3ZYLA 3KAEA 4GZCA 3CR3A 3FU3A 4NURA 4FHJA 4JC8A 4UI9J 5CMYA 1OWLA 3S7JA 5AIJA 2WXJA 4Y6WA 3G2UA 3UT4A 4C9BB 2V0PA 3T5XA 3CVQA 4WNEA 1B89A 4LRZA 2HR2A 4ILIA 5DBKA 4HOSA 1TJFA 1IQRA 3FFLA 4N2SA 3PEVB 4PS8A 2WXKA 5KCMA 4GCNA 3AS8A 3PDNA 3TXNA 4GZ6A 4HLEA 3JUIA 3HDXA 3JQ0A 4M3OA 4FULA 4PDXA 5AJDA 3ZPJA 4N3BA 4ABNA 3CV0A 5D0OD 2AW6A 3LVQE 3FUHA 3CVXA 4AXHA 3ASHA 3KD7A 4HORA 4EBAA 4JA9A 3PH0C 3PRZA 5BPPA 4PUCA 3O48A 4KVOA 1YA0A 4EBAG 2KM4A 2VQ2A 3TG5A 3R7QA 1ZU2A 2WXLA 4CT4A 1H2VC 3FH7A 2FEZA 4JW1A 2CG2A 4B94A 3MX3A 2WMOA 1W3BA 2KC7A 2RD0A 2Y4TA 4O6FA 4BX9A 4PH4B 2RG8A 4G24A 4NACA 3QB2A 1E8YA 4I43A 4JEUA 3MEKA 4CDMA 1DVPA 2VSXE 3UPVA 1NZNA 3OTNA 2UWJG 3G2TA 3ONKA 3PNTB 2VGXA 3RO3A 5ANRA 2NC9A 3QOUA 4UWHA 5FQ6A 5FWQA 3D9KA 3BG0B 4G11A 4XE0A 2CHZA 2X3MA 5EX0A 3ENEA 3FTYA 3U9WA 2XHEA 1ELRA 4KT6B 3FHEA 3EJNA 3ML8A 4LERA 3UT7A 3ZHEB 3JYSA 1EYHA 1NA0A 2AXVA 4IRUA 3SHFA 3TL5A 1ELWA 3CLJA 4N2QA 2VSOE 3LVRE 4RSYA 2AXZA 2BTDA 5CMWA 4K0RA 2WQHA 4I9CA 1H2TC 4CEMA 4BFRA 5ARGA 3B7TA 5HQ8A 1E90A 4KYOB 4UI9C 2CHWA 5G2NA 4Q96A 4EZLA 4DK5A 4WAFA 4J6IA 1HF8A 5KJLA 2KCVA 4F3VA 4ATGA 2XPIA 4CT0A 3L08A 4WWNA 3MKRA 2R59A 4JZYA 3CVLA 2X6FA 5J08A 3FUFA 3B7RL 4DI4A 2IONA 2IU1A 3ASFA 1MQSA 4YNDA 4KBQA 2X6HA 3Q5MA 4EECA 4U04A 2PM7A 3GZ1A 2VTBA 4GA0A 3P1UA 3D9MA 2EQXA 5E76A 3QDNA 1OWOA 3ZYKA 2WQ7A 3ZGQA 4GAAA 2Y4UA 4N3AA 2WXFA 2LSVA 1JUQA 1FVFA 1N52A 1ZBPA 4Y6CA 5FZSA 1SQMA 3QAQA 4NRHB 4DI3A 4W9RA 3CKBA 4XX5A 3PEUB 5LX8A 4P29A 4B89A 4AVXA 3CVVA 1IQUA 2OOEA 1E8ZA 4N3CA 4WNGA 1PC2A 1N54A 4Q94A 2XPYA 2XGSA 2XEVA 4A3VA 1E8WA 1HG2A 1KLXA 3CSFA 5BV1A 3PZDA 2V5FA 3ZFWA 2WXGA 1E7UA 3UQ3A 4APFA 4AY5A 3OXFA 3LPZA 4GYWA 4F1SA 1ELKA 3AS5A 2XGMA 3EIJA 4I2ZA 4L23A 4TRQA 3FU6A 4BWRA 3TXMA 3MA5A 5BV0A 1E7VA 3LY9A 4FLHA 2I2OA 3OXGA 5D0QD 3TJPA 4JPSA 5CHEE 3VLEA 1OWPA 3TAXA 1Z3XA 5E75A 2KZTB 3R7RA 4BX8A 3KS2A 4KVMA 2V8SE 3ML9A 3GYZA 3AS4A 4GYYA 1GW6A 4E85A 1HX8A 4I17A 4F7AA 2VJ8A 4U63A 3UX4A 3CGHA 2MRIA 2P58C 2IF4A 3Q47B 3FUDA 1MHQA 3I3NA 5LOZA 2XCCA 1XGWA 5G04C 3NF1A 2IQCA 3T5VA 2WXNA 3E4BA 3IV0A 2DBAA 3PS6A 3NZUA 3MCXA 2L9BA 3L17A 5JHAA 3WXXA 3D3MA 4C0EA 1INZA 3R9AB 4FLBA 4OVUA 3FTWA 4AJWA 3FTSA 4CCAA 3ZXSA 3G2VA 4RG6A 3ZHEA 4BTAA 5EKQD 4J8SA 5C2YA 3D9JA 4ILHB 1TEZA 1QNFA 3APCA 1IHGA 2YHCA 2XGOA 3CQCB 4JEHA 2X38A 4WNDA 5FJYA 2XRZA 3IBEA 1Y6IA 4R7LA 5CCMA 3QK0A 4GCOA 1HO8A 2HO1A 1PY1A 3LXUX 4DLQA 1QZ2A 5G05J 4BSXA 4KZ0A 2FO7A 4XI0A 2J4DA 1H6KA 2YHEA 2IOSA 3DBSA 4CDNA 3I5PA 3D9NA 4H7XA 4ANXA 4FU3A 4XIFA 2XPZA 1H0AA 1UJJA 2CG3A 4WUYA 4HVBA 1TJCA 3SI5A 4CDRA 3PUJA 1E96B 3FEYA 2WXRA 3MV2B 3EIQC 1UJKA 3VTXA 4APOA 2PQNA 2A4ZA 3MJWA 5T4YA 2CHXA 5HI7A 2J08A 4UQZA 2E2EA 2XRYA 3I4GA 5T3RA 3LYAA 2FF4A 4OYSA 3RO2A 4GA1A 3LDZA 4B8AA 5JJ7A 4PS3A 3Q15A 3APDA 4JVSA 5JJ6A 3NQPA 4UWKA 4FJYA 4U8HA 1EPUA 3CHSA 2J49A 2WXMA 1QQEA 4LUNU 2YQ8A 4UWFA 3RU0A 2WB2A 3RK6A 5LFAA 3RIBA 5A7DB 3CEQA 4D10C 3QNKA 2PM6A 4DPRA 2X6JA 2LAIA 2AXUA 2C2LA 1VDYA 3T8MA 3UT8A 2WMNA 5G55A 2HM8A 3VTYA 1XNFA 2QFCA 4RG9A 4BT8A 3QJZA 4AP2A 4MKTA 2WPVA 4YVQC 5KJNA 3D9LA 3CVPA 3CHQA 3FUMA 4AV7A 4EPZA 4U0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI9 A;  5DIZ A;  2VSN A;  2J9Q A;  3SF4 A;  4GYO A;  3TGO A;  5CCL A;  2VYI A;  4JHR A;  5FZR A;  3TG4 A;  4WNF A;  3QKY A;  3ESK A;  4A1S A;  5KJK A;  2I6H A;  1KT1 A;  4I9E A;  3FP3 A;  3PE3 A;  3CKC A;  2LSU A;  3ASD A;  2PL2 A;  1FCH A;  4G1T A;  2PZI A;  4G25 A;  2C0M A;  2R5S A;  2L6J A;  3PE4 A;  5FZQ A;  1WAO 1;  2IFU A;  5JJT A;  2VSY A;  4LEU A;  1NA3 A;  3CK7 A;  5BT1 A;  5FT9 A;  1WM5 A;  3CK8 A;  4AM9 A;  3RKV A;  4JA7 A;  2C0L A;  3N71 A;  3LY7 A;  4J8F A;  3UUX A;  2GW1 A;  1A17 A;  2KCL A;  3BEE A;  4U07 A;  2HYZ A;  3HYM B;  4HOU A;  3S7D A;  5A6C A;  3LKU A;  4G26 A;  2UY1 B;  3GZ2 A;  4U0U A;  1IYG A;  2FBN A;  5C1D A;  2VGY A;  4UI9 K;  3CVN A;  4CGW A;  3LY8 A;  2OND A;  5BW8 C;  4AY6 A;  5LCW J;  5KJM A;  3CK9 A;  1HH8 A;  4UQY A;  3QWP A;  5ARF A;  3RJV A;  4J8E A;  4U0S A;  4JL0 A;  2FI7 A;  3EDT B;  4GZ3 A;  4G2V A;  4I1A A;  5EX3 A;  4N39 A;  2KAT A;  5BNW A;  4GZ5 A;  2PQR A;  2JLB A;  4N5C A;  1HXI A;  3QWW A;  4I2W A;  3S7B A;  3ZN3 A;  4BT9 A;  4EQF A;  5G04 J;  2VGX B;  3U4T A;  3IEG A;  4BTB A;  4IN3 B;  5M72 A;  4ME2 A;  3OXL A;  3SZ7 A;  2Q7F A;  3K9I A;  4GPK A;  5G05 C;  1Y8M A;  2KCK A;  3LCA A;  4UQX A;  4CGV A;  4AIF A;  2MHK A;  4HOQ A;  3Q49 B;  5FTP A;  3FWV A;  1KT0 A;  2XCB A;  4G23 A;  5LCW C;  2UY1 A;  1P5Q A;  1OUV A;  3GW4 A;  2AVP A;  4J0U A;  4GA2 A;  2LNI A;  3ASG A;  2BUG A;  4NQ0 A;  4J8D A;  3U3W A;  4YVO A;  4HOT A;  3ULQ A;  3S7F A;  3MV3 B;  4H7Y A;  5AYW D;  4KXK B;  3URZ A;  3Q4A B;  1HZ4 A;  3QWV A;  3KAE A;  4UI9 J;  3S7J A;  4Y6W A;  4WNE A;  3CVQ A;  1B89 A;  2HR2 A;  5DBK A;  4HOS A;  3FFL A;  4N2S A;  4GCN A;  3AS8 A;  3PDN A;  4GZ6 A;  3ZPJ A;  4N3B A;  4ABN A;  3CV0 A;  5D0O D;  3ASH A;  3KD7 A;  4HOR A;  4JA9 A;  3O48 A;  1YA0 A;  2VQ2 A;  3TG5 A;  1ZU2 A;  2FEZ A;  4B94 A;  1W3B A;  2KC7 A;  2Y4T A;  4O6F A;  4G24 A;  3MEK A;  3UPV A;  1NZN A;  2UWJ G;  2VGX A;  3RO3 A;  2NC9 A;  3QOU A;  5EX0 A;  1ELR A;  3ZHE B;  3JYS A;  1NA0 A;  1ELW A;  4N2Q A;  2WQH A;  4I9C A;  5ARG A;  5HQ8 A;  4KYO B;  4UI9 C;  5KJL A;  2KCV A;  4F3V A;  2XPI A;  3MKR A;  3CVL A;  3ASF A;  4YND A;  4KBQ A;  3Q5M A;  4U04 A;  3GZ1 A;  4GA0 A;  3QDN A;  3ZGQ A;  2Y4U A;  4N3A A;  2LSV A;  5FZS A;  4Y6C A;  1ZBP A;  4NRH B;  4W9R A;  3CKB A;  2OOE A;  4N3C A;  4WNG A;  1PC2 A;  2XGS A;  2XEV A;  1KLX A;  2V5F A;  3ZFW A;  3UQ3 A;  4AY5 A;  3OXF A;  3LPZ A;  4GYW A;  3AS5 A;  2XGM A;  4I2Z A;  4BWR A;  3MA5 A;  3LY9 A;  3OXG A;  5D0Q D;  5CHE E;  3TAX A;  3KS2 A;  3GYZ A;  3AS4 A;  4GYY A;  4I17 A;  2P58 C;  2IF4 A;  3Q47 B;  2XCC A;  5G04 C;  3NF1 A;  3E4B A;  2DBA A;  3WXX A;  3R9A B;  4RG6 A;  3ZHE A;  4BTA A;  5EKQ D;  1IHG A;  2YHC A;  2XGO A;  4WND A;  5FJY A;  5CCM A;  4GCO A;  2HO1 A;  1QZ2 A;  5G05 J;  2FO7 A;  4XI0 A;  4H7X A;  4XIF A;  4WUY A;  1TJC A;  4CDR A;  1E96 B;  3MV2 B;  3VTX A;  4APO A;  2PQN A;  5HI7 A;  4UQZ A;  2E2E A;  3LYA A;  2FF4 A;  3RO2 A;  4GA1 A;  5JJ7 A;  5JJ6 A;  3Q15 A;  3RU0 A;  1QQE A;  2YQ8 A;  3RIB A;  5A7D B;  3CEQ A;  2C2L A;  3VTY A;  1XNF A;  2QFC A;  4RG9 A;  4BT8 A;  4YVQ C;  2WPV A;  5KJN A;  3CVP A;  4U0Z A; 
#chains in the Genus database with same CATH topology
 5DIZ A;  1D8E A;  2P9U G;  3S2A A;  2BKK B;  1KZO A;  5FQ7 A;  4JHR A;  3C72 A;  2DZN A;  2F37 A;  3FU5 A;  4CRW A;  3V79 K;  4I9E A;  2YNQ A;  4K5B A;  5AJL A;  3U64 A;  3PE3 A;  2DWZ A;  3ASD A;  4A55 A;  3RSE G;  3BQO A;  1TYQ G;  1OY3 D;  1UW4 B;  2C0M A;  4I1M A;  4DX2 A;  2R5S A;  4K5A B;  2R2L A;  3UIO C;  5ANL A;  3UMV A;  3CK7 A;  2GGF A;  1U3C A;  5EDS A;  5AQ9 A;  1HS6 A;  2ZIS A;  4FP7 A;  2Y0B G;  3FUJ A;  3TWV A;  4GML A;  3N71 A;  4C0M A;  3LY7 A;  3W9F A;  3CQG B;  4J8F A;  3OAW A;  4YDW A;  4FA6 A;  2KCL A;  1PAQ A;  3B13 A;  4QFV A;  1LTX A;  5A6C A;  2UY1 B;  1X5B A;  3IHV A;  2PNN A;  2BED A;  3Q7F A;  5T8I A;  4GZD A;  4GMJ A;  4MRU A;  4XZ4 A;  4HRL A;  3APF A;  3CK9 A;  4V3I A;  5KBA A;  3U66 A;  3MKQ A;  4ZFH A;  3PVL A;  3SFZ A;  4U0S A;  5AQA A;  4FC8 A;  3CVU A;  2EIN E;  4N39 A;  4I6E A;  1JPL A;  3FTZ A;  5CED B;  4E6H A;  2JLB A;  3KEZ A;  3NOC D;  4Z68 A;  1BPO A;  3I4R B;  3KSL A;  4DX1 A;  3ZYM A;  3MKQ B;  4BT9 A;  4EQF A;  3KSQ A;  4BES A;  4ANU A;  3IEG A;  4ME2 A;  2LXM A;  3OXL A;  2Q7F A;  1EDU A;  4F53 A;  3SGH A;  3LEW A;  3RRU A;  2KCK A;  3ABL E;  2X6K A;  3BG1 B;  2WXI A;  3P2B A;  4CGV A;  2IJG X;  3B7B A;  2XCB A;  4G23 A;  2GRQ B;  3FUI A;  3CHP A;  1OXJ A;  4FJZ A;  1NP7 A;  4GTV A;  2FUL A;  3AU4 A;  4HRN A;  3V2O A;  3X2Q E;  4WWP A;  1HFA A;  1EF1 C;  1N4P A;  1UN8 A;  2LNI A;  5ITZ F;  4HOT A;  2LO6 A;  4F1P A;  5AYW D;  2QY7 A;  3FU0 A;  3QWV A;  1D9S A;  3ZYL A;  4FHJ A;  5HS0 A;  2F8X K;  2V0P A;  3CVQ A;  4WNE A;  5AQB A;  4ILI A;  1N4R A;  4U95 D;  3PEV B;  4PS8 A;  4GCN A;  4HLE A;  3JUI A;  2H6G A;  3JQ0 A;  4N3B A;  3CV0 A;  5D0O D;  4PUC A;  1MYO A;  4EBA G;  2R03 A;  2VQ2 A;  2WXL A;  4HQD A;  2QYJ A;  1W3B A;  2KC7 A;  4PH4 B;  3RAU A;  4CDM A;  1DVP A;  2UWJ G;  3DSU A;  2VGX A;  4OAU C;  3EU9 A;  5ANR A;  3ULE G;  3D9K A;  3TWT A;  3BG0 B;  2XHE A;  4KT6 B;  3ML8 A;  4TXQ A;  1YCS B;  3DSV A;  4IRU A;  2VSO E;  2BTD A;  2DYS E;  3ULY A;  1H2T C;  4CEM A;  3B7T A;  4U7E B;  2CHW A;  4EZL A;  4J6I A;  2XEN A;  4X8Q A;  2XPI A;  1OCR E;  1QYM A;  2A5E A;  2X6H A;  4U04 A;  4HLL A;  2VTB A;  3P1U A;  1OCO E;  3ZYK A;  1JUQ A;  1N52 A;  1ZBP A;  5AAR A;  4YDE A;  5CEC B;  3CKB A;  4OAV B;  4P29 A;  4B89 A;  1E8Z A;  5CBN A;  2XGS A;  2XEV A;  1E8W A;  4F6R D;  3PZD A;  3EIJ A;  3FU6 A;  5JMN D;  3OXG A;  4DX6 D;  5E75 A;  2KZT B;  2V8S E;  4GYY A;  1GW6 A;  1HX8 A;  4U63 A;  3UX4 A;  3HXF A;  2XCC A;  3UTM A;  3NF1 A;  2Y1L E;  2L9B A;  4BER A;  1IHB A;  4C0E A;  1INZ A;  4FLB A;  4OVU A;  2QYU A;  3ZXS A;  4RG6 A;  4BTA A;  5C2Y A;  2DYR E;  3APC A;  4G8L A;  2X38 A;  5D2M C;  5CCM A;  4GCO A;  3LXU X;  2FO7 A;  1H6K A;  2IOS A;  2LXL A;  3ZUV B;  3I5P A;  3NB2 A;  1TN6 A;  2CG3 A;  4HVB A;  1TR4 A;  3FEY A;  1UJK A;  5T4Y A;  2J08 A;  2E2E A;  5T3R A;  3I4G A;  4LG6 A;  2FF4 A;  4OYS A;  2V5Q C;  3EHR A;  3LDZ A;  2ZGD A;  5JJ7 A;  3Q15 A;  3UIP C;  4UWK A;  3CHS A;  1MZC A;  2WB2 A;  2RFA A;  1S64 A;  2X6J A;  2LAI A;  2C2L A;  2HM8 A;  3ZU7 B;  3VTY A;  4RG9 A;  1IKN D;  3PZ1 A;  5CRU A;  3O4Z A;  4AV7 A;  4EPZ A;  4XI9 A;  3FDH A;  3AU5 A;  1WY6 A;  2VSN A;  2J9Q A;  3SF4 A;  4GYO A;  3TGO A;  5EYL A;  5FZR A;  5ENR D;  4GU5 A;  3QKY A;  1H19 A;  4BSZ B;  3ESK A;  3IKO B;  1FT2 A;  3RRM B;  4ACK A;  3J5Q B;  2M63 A;  4MS6 A;  1IXV A;  3FUE A;  4G1T A;  2WXQ A;  4XKC A;  2WXH A;  3LJ3 A;  5FZQ A;  2Y69 E;  2IFU A;  3FEX A;  5A23 A;  4LEU A;  2DVW A;  1TN8 A;  1HU3 A;  4I6J A;  4JA7 A;  4RVB A;  3HXE A;  4FHK A;  4GTP A;  4EZK A;  5J90 A;  3G2W A;  5JHB A;  1A17 A;  4CZ2 D;  2IO3 C;  1UOH A;  3BEE A;  2I1K A;  4UWL A;  4HOU A;  3LKU A;  3ZEF A;  4G26 A;  3IHY A;  3E34 A;  1N4S A;  3FH8 A;  4MLP A;  4AEZ C;  2IOL A;  4EZJ A;  4CGW A;  3V31 A;  1TNO A;  3MYV A;  1H2U A;  2OND A;  2I1J A;  5BW8 C;  5EYP F;  3HHM A;  3T8K A;  1QBQ A;  4TV3 A;  1HH8 A;  1KPS B;  2YIN A;  1TNY A;  3GZS A;  1BI7 B;  1JCS A;  4KMO A;  4A3T A;  4G2V A;  3FUN A;  2KAT A;  3HXB A;  3EUV A;  3ZIM A;  1G3N B;  2PQR A;  3C5R A;  2E0I A;  3SBS A;  3E32 A;  2J07 A;  2WQ6 A;  5G04 J;  3HVE A;  2ILR A;  2OVB A;  1DC2 A;  2NSZ A;  1E8X A;  5AN8 A;  2IO2 C;  4UWG A;  3SD5 A;  1OWN A;  5ENO D;  3C3R A;  1MJ0 A;  4ANW A;  1O5M A;  4K03 A;  3DSW A;  4HOQ A;  3L13 A;  3FWV A;  3UM3 A;  3TWS A;  4DLO A;  5IY5 E;  3HVE B;  1N0Q A;  2L6B A;  2UY1 A;  1DCQ A;  1SW6 A;  1L5J A;  1OUV A;  3ZYQ A;  3LS8 A;  3PNL B;  2BUG A;  4J8D A;  2P9P G;  3MV3 B;  4B0Z A;  4L1B A;  3NOG D;  3QAR A;  2WXP A;  4KXK B;  2AJA A;  3E33 A;  2ZU6 B;  3JXJ A;  3KAE A;  4NUR A;  5CMY A;  2WXJ A;  3DXK G;  3G2U A;  1DCE A;  1B89 A;  4LRZ A;  4HOS A;  3FFL A;  3DPY A;  3TXN A;  3PDN A;  4J7W A;  3L9T A;  3LVQ E;  2XEE A;  2DZO A;  4AXH A;  4EBA A;  4JA9 A;  4MBG A;  3PH0 C;  3PRZ A;  4KVO A;  3FH7 A;  4JW1 A;  3TWW A;  4BX9 A;  4O6F A;  4G24 A;  3JXI A;  2VSX E;  1NZN A;  3G2T A;  3ABK E;  2NC9 A;  3QOU A;  4G11 A;  5EX0 A;  3FTY A;  1ELR A;  3EJN A;  2AXV A;  3SHF A;  1ELW A;  3CLJ A;  4U96 D;  3LJN A;  1E90 A;  4Q96 A;  4TXP A;  2OEV A;  1HF8 A;  4ATG A;  3L08 A;  3MKR A;  3CVL A;  3B7R L;  4DI4 A;  2IU1 A;  3ZKJ A;  3Q5M A;  4EEC A;  4GA0 A;  4GPM A;  5E76 A;  1OWO A;  2LSV A;  4Y6C A;  3HXC A;  1SQM A;  4A63 B;  4DI3 A;  5KNH D;  1IQU A;  2OOE A;  3F6Q A;  1PC2 A;  1N54 A;  3Q9U C;  4JD2 G;  1O1T A;  3SQV A;  5ENS D;  2P9I G;  5BV1 A;  3ZFW A;  3UQ3 A;  4L23 A;  2I2O A;  2ETA A;  5D0Q D;  5CHE E;  3VLE A;  3TAX A;  4BX8 A;  3KS2 A;  3PZ3 A;  3AS4 A;  4TXR A;  3CGH A;  2MRI A;  4HBD A;  3TWU A;  3Q47 B;  2R02 A;  2IQC A;  2WXN A;  2KXP C;  3IV0 A;  3PS6 A;  3NZU A;  1WG0 A;  3MCX A;  3UM2 A;  3ASN E;  3R9A B;  4AJW A;  3FTS A;  3C3Q A;  3DEO A;  3G2V A;  1D8D A;  5EID A;  4ILH B;  3DSS A;  3CQC B;  4JEH A;  2XRZ A;  3IBE A;  5H7P A;  1PY1 A;  5CBO A;  2YHE A;  3DBS A;  4CDN A;  4H7X A;  1YMP A;  3DRA A;  1ZB1 A;  1TJC A;  4CDR A;  5JA4 D;  4APO A;  3MJW A;  3AAA C;  4LSZ E;  4GA1 A;  4B8A A;  3JUE A;  4HRM B;  3J5P A;  3NQP A;  4FJY A;  4U8H A;  1O1S A;  4LUN U;  4UWF A;  2YQ8 A;  4DPR A;  2AXU A;  2WMN A;  5G55 A;  4MKT A;  2QZA A;  4YVQ C;  3D9L A;  4O1O A;  4GTR A;  4L2L A;  4I6G A;  3MZL B;  1DNP A;  1OT8 A;  4ANV A;  2VYI A;  4WNF A;  2KZT A;  2GRL A;  2XZD G;  3NZS A;  4A1S A;  5KJK A;  4DX5 D;  1KT1 A;  2DIW A;  2JEK A;  4B8C B;  2V4H C;  3BUA A;  2LSU A;  3ASO E;  3DEP A;  3JCK C;  4JHJ A;  3PE4 A;  1LF8 A;  2GRO B;  3EHQ A;  1NA3 A;  5BT1 A;  1Z5S C;  5BUZ A;  2HE0 A;  5FT9 A;  3L16 A;  3Q78 A;  3CK8 A;  4AM9 A;  2R17 C;  4HI8 A;  3RKV A;  2NXP A;  3FTV A;  3AG3 E;  2L0T B;  5FQ8 A;  3UUX A;  3V30 A;  2GW1 A;  3EHN A;  3AG4 E;  2FO1 E;  2EIJ E;  4ZHB A;  2HYZ A;  3HYM B;  5HRY A;  5EIL A;  2V4L A;  4U0U A;  2B6C A;  3VLF A;  1RZ4 A;  1IYG A;  2VGY A;  2RKK A;  3FUL A;  5BXO A;  3DXM G;  3CVN A;  5HKP A;  3FY4 A;  3Q7A A;  5ENN A;  3D9O A;  4GB9 A;  4AY6 A;  5LCW J;  4HS2 A;  5KJM A;  1N4Q A;  1BI8 B;  2AWI A;  2VGE A;  1N95 A;  5ARF A;  1SZ9 A;  4JL0 A;  2FI7 A;  3EDT B;  2F0Y A;  2ZXW E;  4I1A A;  2P2C P;  3PRE A;  5BNW A;  4GZ5 A;  4BY6 A;  2QC9 A;  4N5C A;  1HG5 A;  3DSX A;  3D9I A;  4GTS A;  4XEI G;  4LNU D;  4ILG A;  2A5U A;  3Q75 A;  3ZN3 A;  2GRM A;  3G2S A;  4BTB A;  4IN3 B;  5M72 A;  2L0I A;  1N0R A;  3ZRH A;  3K9I A;  4GTM A;  5G05 C;  1JWG A;  5FQ4 A;  3LCA A;  2DCP A;  4UQX A;  4A1G A;  4HFG A;  3L54 A;  3UM1 A;  3E30 A;  4LCT A;  3Q49 B;  5FTP A;  1S0P A;  1KT0 A;  2WVI A;  4Q69 A;  1K1B A;  1YYH A;  3HXD A;  3ONL A;  2J4B A;  3PZ4 A;  3NAW A;  1P5Q A;  3JQ1 A;  4J0U A;  3PUK A;  4TUU A;  3ASG A;  4YVO A;  4TUM A;  1SZA A;  2I9C A;  3S7F A;  4H7Y A;  1Z6T A;  3URZ A;  3Q4A B;  1HZ4 A;  4J8Y A;  4GZC A;  4UI9 J;  1OWL A;  3TWX A;  4C9B B;  4JB8 P;  2HR2 A;  3KEA A;  1IQR A;  1FT1 A;  3DWL G;  4NIK A;  5KCM A;  2WXK A;  3AS8 A;  4M3O A;  5AJD A;  3ZPJ A;  4ABN A;  3FUH A;  3ASH A;  4ATZ D;  4HOR A;  1A5E A;  5BPP A;  1YA0 A;  3TG5 A;  2FEZ A;  2CG2 A;  2Y4T A;  4C48 B;  1E8Y A;  3OTN A;  3PNT B;  3D9H A;  5FQ6 A;  4UWH A;  5FWQ A;  4XE0 A;  2X3M A;  3U9W A;  3FHE A;  4LER A;  3UT7 A;  3ZHE B;  3JYS A;  1EYH A;  1MX6 A;  2XZT G;  2AXZ A;  3DST A;  3C3O A;  4BFR A;  5ARG A;  2ETC A;  2EIK E;  4KYO B;  3BU8 A;  1S63 A;  4WAF A;  5B3S E;  4WWN A;  2R59 A;  3E37 A;  4YDY A;  2X6F A;  5J08 A;  2ION A;  3AG1 E;  1MQS A;  4KBQ A;  3GZ1 A;  3SFY A;  4B93 B;  3ZGQ A;  2Y4U A;  2WXF A;  4U8Y D;  1FVF A;  1TNU A;  4NRH B;  4XX5 A;  5B1A E;  3CVV A;  4N3C A;  2H6H A;  3IXE A;  4A3V A;  3Q73 A;  2EIL E;  1KLX A;  3CSF A;  5EIB E;  2V5F A;  4AY5 A;  1E7U A;  3OXF A;  3LPZ A;  1BU9 A;  4BWR A;  4YDO A;  5BV0 A;  5KWD A;  1E7V A;  3Q79 A;  5ENQ D;  4KVM A;  3SY2 A;  5BXU A;  1V55 E;  1OCC E;  4F7A A;  5EN5 D;  2KBX A;  3I3N A;  1N94 A;  2R05 A;  5LOZ A;  1XGW A;  5CEA A;  5CRV A;  3L17 A;  3WXX A;  3SO8 A;  3D9J A;  1TEZ A;  1MX2 A;  1QNF A;  4UUC A;  1IHG A;  4WND A;  5FJY A;  4R7L A;  1Y6I A;  2XS8 A;  1HO8 A;  1K1A A;  4DLQ A;  1QZ2 A;  4BSX A;  4KZ0 A;  4XI0 A;  2GRP B;  2H6F A;  4FU3 A;  1H0A A;  1UJJ A;  4WUY A;  3SI5 A;  4QQI A;  1E96 B;  2WXR A;  3EIQ C;  3VTX A;  2PQN A;  2A4Z A;  5HI7 A;  4UQZ A;  2XRY A;  2MYO A;  3R9M A;  3ISM C;  4PS3 A;  3APD A;  1O1R A;  2J8S D;  2BKG A;  2WXM A;  1QQE A;  3RK6 A;  3RIB A;  3CEQ A;  4D10 C;  3QNK A;  3T8M A;  3UT8 A;  1XNF A;  3QJZ A;  4AP2 A;  5KJN A;  1U2V G;  1KZP A;  1OCZ E;  4K5C A;  3CHQ A;  3FUM A;  4U0Z A;  1N9A A;  5CCL A;  5AQ7 A;  3TG4 A;  1JCR A;  3CST A;  3FUK A;  3CHR A;  3D9P A;  3B95 A;  4L2Y A;  5ENT D;  2I6H A;  3UI2 A;  2P9N G;  2CFU A;  3FP3 A;  4M7C A;  4L9P A;  2X6I A;  1MX4 A;  3CKC A;  1LD8 A;  3CVY A;  3L6A A;  4DUI A;  2PL2 A;  1UN9 A;  1FCH A;  2PZI A;  3FTU A;  4G25 A;  3CHM A;  1Z3Y A;  2L6J A;  4URK A;  1WAO 1;  2MOW A;  3CIA A;  5JJT A;  2VSY A;  3HRA A;  3L22 A;  3HIZ A;  1WM5 A;  2EIM E;  3TWQ A;  4WWO A;  4IYP A;  1H6P A;  2C0L A;  3CHO A;  3T9K A;  2IY0 C;  2OV8 A;  3QC1 A;  2P9K G;  4U07 A;  3S7D A;  4OVV A;  2WM9 A;  4JXT A;  3FTX A;  3GZ2 A;  4JHK A;  1NL4 A;  1RW2 A;  4L7T A;  2FBN A;  3AG2 E;  5C1D A;  4UI9 K;  1OWM A;  2LAH A;  3SFX A;  4KZC A;  3LY8 A;  3FH5 A;  4RQI A;  3DPD A;  3ZVV A;  4CYM D;  2Y3A A;  1WDY A;  3Q9N C;  1UG3 A;  2WXO A;  3RRN B;  3SNX A;  4UQY A;  2F8Y A;  5CER B;  3QWP A;  1HE8 A;  3RJV A;  4J8E A;  4BET A;  4GZ3 A;  2XQ0 A;  5EX3 A;  2CFZ A;  4AOF A;  1JWF A;  5AEN A;  2J09 A;  2OVF A;  3EHM A;  1BLX B;  1SA4 A;  1TNZ A;  1HXI A;  1N11 A;  3MGB A;  4PS7 A;  4IUL A;  3L82 A;  3QWW A;  3SBT B;  3ZW3 A;  4I2W A;  1FPP A;  3S7B A;  2ZGG A;  4GMR A;  2VGX B;  1U3D A;  3U4T A;  5LP0 A;  2BF0 X;  4O1P A;  3B7S A;  3SZ7 A;  1TNB A;  1LD7 A;  1FVH A;  2XS1 A;  1H6O A;  4GPK A;  1Y8M A;  3VLD A;  1TN7 A;  4AIF A;  2MHK A;  4HB5 A;  4ACL A;  3HG0 D;  1S70 B;  3TWR A;  4XKB A;  5LCW C;  4DJA A;  4BEP A;  2B0O E;  3UM0 A;  4RLY A;  4I1O B;  3ESL A;  3B7U X;  3GW4 A;  2AVP A;  4FAD A;  4GA2 A;  3C98 A;  1Q2Z A;  4NQ0 A;  3U3W A;  4HXI A;  3ULQ A;  1X81 A;  2VTB B;  2XEH A;  3CVW A;  1AWC B;  2RFM A;  3CR3 A;  2GRN B;  3FU3 A;  4JC8 A;  1SVX A;  3S7J A;  5AIJ A;  4Y6W A;  2JAB A;  3UT4 A;  3T5X A;  5DBK A;  1TJF A;  4N2S A;  1NI1 A;  4GZ6 A;  3HDX A;  4PDX A;  4FUL A;  4GTO A;  4G8K A;  2AW6 A;  3CVX A;  2P9S G;  3KD7 A;  5FIO A;  3O48 A;  2KM4 A;  3R7Q A;  1ZU2 A;  4CT4 A;  1H2V C;  4B94 A;  3ABM E;  2WMO A;  3MX3 A;  2RD0 A;  2P9L G;  2RG8 A;  4NAC A;  3QB2 A;  4I43 A;  4JEU A;  3MEK A;  3UPV A;  3ONK A;  3RO3 A;  2CHZ A;  3ENE A;  3EU5 A;  5ENP D;  1NA0 A;  3TL5 A;  4GTT A;  4N2Q A;  3LVR E;  4RSY A;  5CMW A;  2IEJ A;  2LUH A;  4K0R A;  2WQH A;  4I9C A;  5HQ8 A;  4UI9 C;  5G2N A;  4DK5 A;  2NYJ A;  5KJL A;  2KCV A;  4F3V A;  4CT0 A;  4JZY A;  4DX7 D;  1AP7 A;  3ZXP A;  4LNB A;  5D66 A;  3FUF A;  3UIN C;  3ASF A;  4YND A;  4N5Q A;  2PM7 A;  3D9M A;  2EQX A;  3PZ2 A;  3QDN A;  5KNG A;  2WQ7 A;  4GAA A;  2OEW A;  4N3A A;  5FZS A;  3QAQ A;  4U8V D;  4W9R A;  4GTQ A;  3PEU B;  5LX8 A;  4AVX A;  4WNG A;  4Q94 A;  2XPY A;  2ZIR A;  1HG2 A;  2WXG A;  4APF A;  4GYW A;  4F1S A;  1ELK A;  3AS5 A;  2XGM A;  4I2Z A;  4TRQ A;  3TXM A;  3MA5 A;  3LY9 A;  4FLH A;  3TJP A;  4JPS A;  1OWP A;  3V2X A;  1Z3X A;  4O60 A;  3R7R A;  2ETB A;  3ML9 A;  3GYZ A;  4HI9 A;  4E85 A;  4I17 A;  2VJ8 A;  2GRR B;  2P58 C;  1JCQ A;  2IF4 A;  1V54 E;  3FUD A;  1MHQ A;  1BD8 A;  4HNA D;  5G04 C;  3T5V A;  3E4B A;  2DBA A;  3NBN B;  4EHM A;  5B1B E;  5JHA A;  3D3M A;  1NFI E;  3FTW A;  4DRX E;  4CCA A;  3ZHE A;  3UKU G;  5EKQ D;  3W9G A;  4J8S A;  3UXG A;  2YHC A;  2XGO A;  3QK0 A;  2HO1 A;  5G05 J;  2OCC E;  2J4D A;  3D9N A;  4ANX A;  4XIF A;  2XPZ A;  3PUJ A;  4LNG A;  3ZNG A;  3AJI A;  3MV2 B;  2CHX A;  5AAO A;  1SA5 A;  3LYA A;  3RO2 A;  1K3Z D;  3UKR G;  5JJ6 A;  4JVS A;  1K8K G;  1EPU A;  2J49 A;  3RU0 A;  5LFA A;  5A7D B;  2PM6 A;  1VDY A;  2QFC A;  4BT8 A;  2H6I A;  2WPV A;  3WG7 E;  3CVP A;  5FIN A; 
#chains in the Genus database with same CATH homology
 4XI9 A;  5DIZ A;  3FDH A;  3AU5 A;  1WY6 A;  2VSN A;  2J9Q A;  3SF4 A;  4GYO A;  4L2L A;  4I6G A;  3S2A A;  3TGO A;  5FQ7 A;  3O4Z A;  5CCL A;  3MZL B;  1DNP A;  4ANV A;  2VYI A;  4JHR A;  5FZR A;  3TG4 A;  4WNF A;  2KZT A;  4GU5 A;  3QKY A;  2GRL A;  3CST A;  1H19 A;  3FU5 A;  3NZS A;  3ESK A;  4A1S A;  3FUK A;  3CHR A;  3D9P A;  3IKO B;  5KJK A;  4L2Y A;  2I6H A;  3RRM B;  4ACK A;  4CRW A;  1KT1 A;  4I9E A;  2M63 A;  2DIW A;  2YNQ A;  2CFU A;  2JEK A;  4MS6 A;  5AJL A;  3FP3 A;  3U64 A;  3PE3 A;  4B8C B;  2X6I A;  3CKC A;  2LSU A;  3ASD A;  3FUE A;  3CVY A;  3L6A A;  4A55 A;  2PL2 A;  3JCK C;  1UN9 A;  1FCH A;  4G1T A;  4JHJ A;  1UW4 B;  2PZI A;  2WXQ A;  2C0M A;  3FTU A;  4G25 A;  4XKC A;  3CHM A;  1Z3Y A;  4I1M A;  2WXH A;  2R5S A;  2L6J A;  3LJ3 A;  3PE4 A;  5FZQ A;  4URK A;  1LF8 A;  1WAO 1;  2MOW A;  2IFU A;  3FEX A;  3CIA A;  5JJT A;  5ANL A;  2VSY A;  4LEU A;  3UMV A;  5A23 A;  1NA3 A;  3CK7 A;  5BT1 A;  2GGF A;  5BUZ A;  3L22 A;  5FT9 A;  1U3C A;  3HIZ A;  3L16 A;  1WM5 A;  3CK8 A;  4AM9 A;  5EDS A;  1HU3 A;  2R17 C;  4I6J A;  1HS6 A;  4WWO A;  4IYP A;  3RKV A;  4FP7 A;  2NXP A;  4JA7 A;  4RVB A;  3FUJ A;  3FTV A;  2C0L A;  2L0T B;  4FHK A;  3CHO A;  4GML A;  4EZK A;  3N71 A;  4C0M A;  5J90 A;  3LY7 A;  5FQ8 A;  3CQG B;  3G2W A;  4J8F A;  3UUX A;  2GW1 A;  3OAW A;  4FA6 A;  5JHB A;  1A17 A;  2KCL A;  3EHN A;  3BEE A;  1PAQ A;  2OV8 A;  2I1K A;  3QC1 A;  3B13 A;  4QFV A;  4U07 A;  2HYZ A;  4UWL A;  3HYM B;  4HOU A;  3S7D A;  4OVV A;  2WM9 A;  5A6C A;  3LKU A;  4JXT A;  3ZEF A;  3FTX A;  4G26 A;  3IHY A;  2UY1 B;  2V4L A;  3GZ2 A;  4JHK A;  4U0U A;  3FH8 A;  4L7T A;  3VLF A;  4MLP A;  4AEZ C;  1IYG A;  2FBN A;  2IOL A;  2VGY A;  5C1D A;  3FUL A;  4UI9 K;  4EZJ A;  1OWM A;  1X5B A;  2LAH A;  3CVN A;  4CGW A;  3IHV A;  3FY4 A;  4KZC A;  3LY8 A;  3FH5 A;  3MYV A;  1H2U A;  2OND A;  3D9O A;  4GB9 A;  2I1J A;  5ENN A;  3DPD A;  5T8I A;  3ZVV A;  4GZD A;  5BW8 C;  4AY6 A;  4GMJ A;  3HHM A;  4MRU A;  4XZ4 A;  2Y3A A;  5LCW J;  4HS2 A;  5KJM A;  3APF A;  3CK9 A;  1UG3 A;  2WXO A;  4V3I A;  4TV3 A;  3U66 A;  1HH8 A;  3RRN B;  3SNX A;  4UQY A;  2AWI A;  3MKQ A;  2YIN A;  3QWP A;  5ARF A;  1HE8 A;  1SZ9 A;  3GZS A;  3PVL A;  4J8E A;  3RJV A;  3SFZ A;  4U0S A;  4JL0 A;  4KMO A;  2FI7 A;  3EDT B;  4FC8 A;  4A3T A;  3CVU A;  4GZ3 A;  4G2V A;  4I1A A;  3PRE A;  2XQ0 A;  5EX3 A;  4N39 A;  3FUN A;  2CFZ A;  4I6E A;  4AOF A;  1JWF A;  2KAT A;  5AEN A;  2J09 A;  5BNW A;  3ZIM A;  4GZ5 A;  2OVF A;  2PQR A;  4BY6 A;  1JPL A;  3EHM A;  3FTZ A;  4E6H A;  2E0I A;  2JLB A;  4N5C A;  1HXI A;  3MGB A;  1HG5 A;  3KEZ A;  3SBS A;  4PS7 A;  3D9I A;  4IUL A;  3QWW A;  3SBT B;  1BPO A;  3I4R B;  3ZW3 A;  4ILG A;  3ZYM A;  4I2W A;  3S7B A;  2A5U A;  2J07 A;  3MKQ B;  3ZN3 A;  4BT9 A;  4EQF A;  5G04 J;  2WQ6 A;  2GRM A;  3HVE A;  3G2S A;  2VGX B;  4ANU A;  1U3D A;  2ILR A;  3IEG A;  3U4T A;  4BTB A;  4IN3 B;  5LP0 A;  2BF0 X;  5M72 A;  4ME2 A;  3OXL A;  2L0I A;  2OVB A;  3B7S A;  2NSZ A;  3SZ7 A;  1FVH A;  2Q7F A;  1E8X A;  3ZRH A;  3K9I A;  1EDU A;  4F53 A;  3SGH A;  4GPK A;  4UWG A;  3SD5 A;  5G05 C;  1JWG A;  3LEW A;  1OWN A;  1Y8M A;  2KCK A;  3LCA A;  5FQ4 A;  2X6K A;  3RRU A;  3BG1 B;  2DCP A;  3VLD A;  4UQX A;  4A1G A;  2WXI A;  4HFG A;  3P2B A;  4CGV A;  4ANW A;  3L54 A;  4K03 A;  4AIF A;  2IJG X;  2MHK A;  4HOQ A;  4LCT A;  3Q49 B;  3L13 A;  5FTP A;  3FWV A;  4ACL A;  1S0P A;  1KT0 A;  2XCB A;  2WVI A;  4G23 A;  4Q69 A;  3FUI A;  4XKB A;  3ONL A;  3CHP A;  2J4B A;  5LCW C;  4DJA A;  4DLO A;  4FJZ A;  3HVE B;  1NP7 A;  2FUL A;  2UY1 A;  3AU4 A;  1L5J A;  1P5Q A;  1OUV A;  1HFA A;  4WWP A;  1EF1 C;  4I1O B;  3ESL A;  3ZYQ A;  1UN8 A;  3B7U X;  3GW4 A;  2AVP A;  3JQ1 A;  3LS8 A;  3PUK A;  4GA2 A;  2LNI A;  3C98 A;  4J0U A;  4TUU A;  4FAD A;  3ASG A;  2BUG A;  3PNL B;  4J8D A;  4NQ0 A;  3U3W A;  4YVO A;  4HXI A;  1SZA A;  4HOT A;  2LO6 A;  2I9C A;  3S7F A;  3ULQ A;  3MV3 B;  4B0Z A;  2VTB B;  4H7Y A;  4L1B A;  5AYW D;  2QY7 A;  1Z6T A;  2WXP A;  3FU0 A;  3Q4A B;  1HZ4 A;  3QWV A;  3QAR A;  2ZU6 B;  4KXK B;  3URZ A;  3CVW A;  3ZYL A;  3KAE A;  4GZC A;  3CR3 A;  3FU3 A;  4NUR A;  4FHJ A;  4JC8 A;  4UI9 J;  5CMY A;  1OWL A;  3S7J A;  5AIJ A;  2WXJ A;  4Y6W A;  3G2U A;  3UT4 A;  4C9B B;  2V0P A;  3T5X A;  3CVQ A;  4WNE A;  1B89 A;  4LRZ A;  2HR2 A;  4ILI A;  5DBK A;  4HOS A;  1TJF A;  1IQR A;  3FFL A;  4N2S A;  3PEV B;  4PS8 A;  2WXK A;  5KCM A;  4GCN A;  3AS8 A;  3PDN A;  3TXN A;  4GZ6 A;  4HLE A;  3JUI A;  3HDX A;  3JQ0 A;  4M3O A;  4FUL A;  4PDX A;  5AJD A;  3ZPJ A;  4N3B A;  4ABN A;  3CV0 A;  5D0O D;  2AW6 A;  3LVQ E;  3FUH A;  3CVX A;  4AXH A;  3ASH A;  3KD7 A;  4HOR A;  4EBA A;  4JA9 A;  3PH0 C;  3PRZ A;  5BPP A;  4PUC A;  3O48 A;  4KVO A;  1YA0 A;  4EBA G;  2KM4 A;  2VQ2 A;  3TG5 A;  3R7Q A;  1ZU2 A;  2WXL A;  4CT4 A;  1H2V C;  3FH7 A;  2FEZ A;  4JW1 A;  2CG2 A;  4B94 A;  3MX3 A;  2WMO A;  1W3B A;  2KC7 A;  2RD0 A;  2Y4T A;  4O6F A;  4BX9 A;  4PH4 B;  2RG8 A;  4G24 A;  4NAC A;  3QB2 A;  1E8Y A;  4I43 A;  4JEU A;  3MEK A;  4CDM A;  1DVP A;  2VSX E;  3UPV A;  1NZN A;  3OTN A;  2UWJ G;  3G2T A;  3ONK A;  3PNT B;  2VGX A;  3RO3 A;  5ANR A;  2NC9 A;  3QOU A;  4UWH A;  5FQ6 A;  5FWQ A;  3D9K A;  3BG0 B;  4G11 A;  4XE0 A;  2CHZ A;  2X3M A;  5EX0 A;  3ENE A;  3FTY A;  3U9W A;  2XHE A;  1ELR A;  4KT6 B;  3FHE A;  3EJN A;  3ML8 A;  4LER A;  3UT7 A;  3ZHE B;  3JYS A;  1EYH A;  1NA0 A;  2AXV A;  4IRU A;  3SHF A;  3TL5 A;  1ELW A;  3CLJ A;  4N2Q A;  2VSO E;  3LVR E;  4RSY A;  2AXZ A;  2BTD A;  5CMW A;  4K0R A;  2WQH A;  4I9C A;  1H2T C;  4CEM A;  4BFR A;  5ARG A;  3B7T A;  5HQ8 A;  1E90 A;  4KYO B;  4UI9 C;  2CHW A;  5G2N A;  4Q96 A;  4EZL A;  4DK5 A;  4WAF A;  4J6I A;  1HF8 A;  5KJL A;  2KCV A;  4F3V A;  4ATG A;  2XPI A;  4CT0 A;  3L08 A;  4WWN A;  3MKR A;  2R59 A;  4JZY A;  3CVL A;  2X6F A;  5J08 A;  3FUF A;  3B7R L;  4DI4 A;  2ION A;  2IU1 A;  3ASF A;  1MQS A;  4YND A;  4KBQ A;  2X6H A;  3Q5M A;  4EEC A;  4U04 A;  2PM7 A;  3GZ1 A;  2VTB A;  4GA0 A;  3P1U A;  3D9M A;  2EQX A;  5E76 A;  3QDN A;  1OWO A;  3ZYK A;  2WQ7 A;  3ZGQ A;  4GAA A;  2Y4U A;  4N3A A;  2WXF A;  2LSV A;  1JUQ A;  1FVF A;  1N52 A;  1ZBP A;  4Y6C A;  5FZS A;  1SQM A;  3QAQ A;  4NRH B;  4DI3 A;  4W9R A;  3CKB A;  4XX5 A;  3PEU B;  5LX8 A;  4P29 A;  4B89 A;  4AVX A;  3CVV A;  1IQU A;  2OOE A;  1E8Z A;  4N3C A;  4WNG A;  1PC2 A;  1N54 A;  4Q94 A;  2XPY A;  2XGS A;  2XEV A;  4A3V A;  1E8W A;  1HG2 A;  1KLX A;  3CSF A;  5BV1 A;  3PZD A;  2V5F A;  3ZFW A;  2WXG A;  1E7U A;  3UQ3 A;  4APF A;  4AY5 A;  3OXF A;  3LPZ A;  4GYW A;  4F1S A;  1ELK A;  3AS5 A;  2XGM A;  3EIJ A;  4I2Z A;  4L23 A;  4TRQ A;  3FU6 A;  4BWR A;  3TXM A;  3MA5 A;  5BV0 A;  1E7V A;  3LY9 A;  4FLH A;  2I2O A;  3OXG A;  5D0Q D;  3TJP A;  4JPS A;  5CHE E;  3VLE A;  1OWP A;  3TAX A;  1Z3X A;  5E75 A;  2KZT B;  3R7R A;  4BX8 A;  3KS2 A;  4KVM A;  2V8S E;  3ML9 A;  3GYZ A;  3AS4 A;  4GYY A;  1GW6 A;  4E85 A;  1HX8 A;  4I17 A;  4F7A A;  2VJ8 A;  4U63 A;  3UX4 A;  3CGH A;  2MRI A;  2P58 C;  2IF4 A;  3Q47 B;  3FUD A;  1MHQ A;  3I3N A;  5LOZ A;  2XCC A;  1XGW A;  5G04 C;  3NF1 A;  2IQC A;  3T5V A;  2WXN A;  3E4B A;  3IV0 A;  2DBA A;  3PS6 A;  3NZU A;  3MCX A;  2L9B A;  3L17 A;  5JHA A;  3WXX A;  3D3M A;  4C0E A;  1INZ A;  3R9A B;  4FLB A;  4OVU A;  3FTW A;  4AJW A;  3FTS A;  4CCA A;  3ZXS A;  3G2V A;  4RG6 A;  3ZHE A;  4BTA A;  5EKQ D;  4J8S A;  5C2Y A;  3D9J A;  4ILH B;  1TEZ A;  1QNF A;  3APC A;  1IHG A;  2YHC A;  2XGO A;  3CQC B;  4JEH A;  2X38 A;  4WND A;  5FJY A;  2XRZ A;  3IBE A;  1Y6I A;  4R7L A;  5CCM A;  3QK0 A;  4GCO A;  1HO8 A;  2HO1 A;  1PY1 A;  3LXU X;  4DLQ A;  1QZ2 A;  5G05 J;  4BSX A;  4KZ0 A;  2FO7 A;  4XI0 A;  2J4D A;  1H6K A;  2YHE A;  2IOS A;  3DBS A;  4CDN A;  3I5P A;  3D9N A;  4H7X A;  4ANX A;  4FU3 A;  4XIF A;  2XPZ A;  1H0A A;  1UJJ A;  2CG3 A;  4WUY A;  4HVB A;  1TJC A;  3SI5 A;  4CDR A;  3PUJ A;  1E96 B;  3FEY A;  2WXR A;  3MV2 B;  3EIQ C;  1UJK A;  3VTX A;  4APO A;  2PQN A;  2A4Z A;  3MJW A;  5T4Y A;  2CHX A;  5HI7 A;  2J08 A;  4UQZ A;  2E2E A;  2XRY A;  3I4G A;  5T3R A;  3LYA A;  2FF4 A;  4OYS A;  3RO2 A;  4GA1 A;  3LDZ A;  4B8A A;  5JJ7 A;  4PS3 A;  3Q15 A;  3APD A;  4JVS A;  5JJ6 A;  3NQP A;  4UWK A;  4FJY A;  4U8H A;  1EPU A;  3CHS A;  2J49 A;  2WXM A;  1QQE A;  4LUN U;  2YQ8 A;  4UWF A;  3RU0 A;  2WB2 A;  3RK6 A;  5LFA A;  3RIB A;  5A7D B;  3CEQ A;  4D10 C;  3QNK A;  2PM6 A;  4DPR A;  2X6J A;  2LAI A;  2AXU A;  2C2L A;  1VDY A;  3T8M A;  3UT8 A;  2WMN A;  5G55 A;  2HM8 A;  3VTY A;  1XNF A;  2QFC A;  4RG9 A;  4BT8 A;  3QJZ A;  4AP2 A;  4MKT A;  2WPV A;  4YVQ C;  5KJN A;  3D9L A;  3CVP A;  3CHQ A;  3FUM A;  4AV7 A;  4EPZ A;  4U0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...