5EKQD

The structure of the bamacde subcomplex from e. coli
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
219
Chain Sequence
EVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the beta-barrel assembly machinery complex.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor BamA
total genus 73
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5ekqD00
1KT0A 3GZ2A 1P5QA 3RO2A 5G04C 3QDNA 3S7FA 3CK8A 2PQRA 3PE3A 3CKCA 4AY5A 5G05C 5A6CA 2FO7A 3PE4A 3IEGA 4I2ZA 5D0OD 5CCMA 4GA2A 5LCWC 2FI7A 4UQXA 2VGYA 4WNEA 2DBAA 4N39A 2XGMA 2V5FA 5FZSA 3OXFA 4KYOB 5KJKA 5CHEE 3ASDA 4GYWA 3ZFWA 4I9EA 3BEEA 4GCOA 5JJTA 4GA0A 4Y6CA 4A1SA 3CEQA 2HR2A 4GYOA 4N3CA 4GYYA 4WNFA 1B89A 4G26A 4XI0A 1HXIA 1ZU2A 3FFLA 2FEZA 5KJMA 3MV2B 2HYZA 4I17A 4YNDA 3ZGQA 1OUVA 3U3WA 2VGXB 1NA3A 4GA1A 4NRHB 3MA5A 4UQYA 3ULQA 4U0UA 2VYIA 2E2EA 2MHKA 2L6JA 1NZNA 3OXGA 3QWWA 4G23A 4N3BA 3R9AB 4EQFA 5AYWD 3CVLA 5ARGA 3MV3B 3FP3A 3ASFA 3RKVA 4IN3B 3VTXA 3S7JA 2BUGA 5G05J 3UQ3A 5BT1A 1WM5A 4GPKA 3TAXA 4ME2A 3AS5A 5EX3A 3ASGA 4H7YA 2QFCA 4W9RA 2YQ8A 4GZ6A 3ZHEA 5HQ8A 4JA7A 3PDNA 3MEKA 4JL0A 3TG5A 4HOTA 4CDRA 3CVPA 3ZHEB 3CVQA 3URZA 3AS8A 2I6HA 3Q15A 3KAEA 4G24A 4KBQA 3TG4A 4AM9A 2LNIA 1PC2A 4I2WA 2YHCA 2OOEA 4GZ3A 4RG9A 4N2SA 3ESKA 3RO3A 3QWVA 3N71A 4WNDA 2C0MA 5CCLA 4U0SA 2XGSA 1KT1A 5KJLA 2KCVA 2KC7A 3CKBA 1QQEA 4J8FA 4UI9K 4HOSA 5FZQA 2XEVA 3E4BA 1YA0A 2UWJG 3LYAA 5C1DA 2PZIA 4J8DA 3KD7A 5D0QD 2J9QA 4JHRA 2ONDA 2Q7FA 4G2VA 4KXKB 2VSYA 2IFUA 2Y4TA 4NQ0A 4G25A 4UI9C 2KATA 2KCKA 4I1AA 4UI9J 4BTBA 2KCLA 1HH8A 3U4TA 4AIFA 4YVQC 2FBNA 3JYSA 4BTAA 3NF1A 4BWRA 2Y4UA 2XCBA 4AY6A 1ZBPA 4G1TA 5HI7A 3KS2A 3RU0A 2C2LA 5A7DB 4CGWA 4WNGA 4WUYA 3ASHA 1IYGA 2UY1B 4O6FA 2NC9A 4LEUA 2XCCA 5FTPA 3QWPA 4U04A 5FJYA 4J0UA 3UPVA 4HORA 2HO1A 3SZ7A 4APOA 2PQNA 5EX0A 3RJVA 3UUXA 4RG6A 4UQZA 3VTYA 1E96B 4J8EA 3TGOA 2WPVA 4BT9A 2AVPA 2P58C 2VSNA 5BNWA 3S7BA 2C0LA 5JJ7A 2IF4A 3HYMB 3EDTB 4XI9A 2XPIA 2R5SA 3LY7A 3GYZA 4I9CA 2GW1A 2LSUA 1ELWA 4N5CA 4GCNA 4F3VA 4CGVA 1ELRA 3QKYA 5KJNA 3LY9A 4JA9A 4Y6WA 2VQ2A 4GZ5A 4YVOA 3AS4A 5BW8C 1NA0A 4U0ZA 2LSVA 3CK7A 3LY8A 3S7DA 3ZPJA 5FT9A 4U07A 3GZ1A 2PL2A 3CK9A 3SF4A 4B94A 1FCHA 1QZ2A 1KLXA 1WAO1 3O48A 3Q49B 4HOQA 4ABNA 2FF4A 2VGXA 3GW4A 1A17A 1HZ4A 3Q47B 4BT8A 5JJ6A 5DIZA 5DBKA 1Y8MA 3CVNA 1TJCA 4N2QA 3ZN3A 3Q5MA 5LCWJ 5ARFA 5FZRA 3RIBA 3WXXA 4XIFA 4H7XA 3FWVA 3LKUA 3LPZA 3MKRA 1XNFA 2JLBA 2XGOA 3CV0A 3K9IA 4HOUA 3Q4AB 3QOUA 4N3AA 3OXLA 1IHGA 2UY1A 5EKQD 5G04J 3LCAA 2WQHA 1W3BA 5M72A
chains in the Genus database with same CATH superfamily
1MQSA 1KZOA 4XKBA 3B95A 1H6OA 1N11A 3ZW3A 2ETCA 2YNQA 1OWMA 5FZSA 2V5FA 4U96D 3MX3A 3DEPA 4GCOA 4N3CA 3RK6A 2PM7A 1OWOA 4L9PA 3NB2A 2DZOA 3D9HA 5JMND 4U0UA 1UN8A 2JABA 4CDMA 3L13A 2QYJA 4JEHA 2KZTA 1HG2A 2L0TB 4ZHBA 3TL5A 1PC2A 4GZ3A 4WNDA 3Q9NC 1KT1A 1EF1C 3SO8A 3KD7A 5CRUA 4GAAA 1RW2A 4G1TA 3UKRG 3ULYA 3F6QA 4A3TA 3AG4E 5LP0A 2DZNA 4V3IA 4BY6A 2OVFA 3ML8A 1U2VG 4M7CA 2LSUA 5G2NA 4L2YA 2WQ6A 5KJNA 4JA9A 4GZ5A 2BKKB 3BG0B 4ANWA 3PH0C 2LSVA 4B8AA 5AENA 2A5EA 1A17A 3LDZA 4HB5A 3ZN3A 5LCWJ 4P29A 3RIBA 1JCRA 1NP7A 3PZ3A 4HOUA 3E32A 2F8YA 5ANRA 1OCOE 4JW1A 2PQRA 3CVXA 2VGYA 3AU4A 3MKQB 3LJ3A 2HR2A 3I5PA 4GTQA 4C0MA 1K3ZD 3FFLA 1SA5A 1UOHA 3B7TA 4CDNA 3ZYMA 1BPOA 3G2SA 3DSVA 4JA7A 3CVQA 5AQ9A 1V55E 4AM9A 4KBQA 4CT4A 3PZ4A 4U7EB 5D2MC 2XEEA 3D9LA 2AXUA 3J5PA 3OTNA 2GRPB 4BTAA 2XCBA 3KS2A 3PRZA 2WXRA 2XCCA 4HRLA 4HLLA 3TGOA 2M63A 4JHKA 3EDTB 3FH8A 2FULA 5CECB 4BETA 4RSYA 1UN9A 3LVQE 2VQ2A 3NOGD 2VGXA 2VTBB 3ZEFA 5ITZF 3HVEA 3FUJA 4I6GA 4MKTA 3DBSA 4XIFA 4HI9A 1DCQA 2L6BA 4TV3A 3TWVA 4M3OA 5FQ4A 2XS8A 2DYSE 4MBGA 5BPPA 3LVRE 2FI7A 3MJWA 4ANVA 3OXFA 1E90A 1X81A 4B89A 2WMOA 4GPMA 2H6FA 3FTZA 4D10C 5AN8A 2HM8A 1NA3A 5H7PA 3O4ZA 2WVIA 3NBNB 5KNGA 5AYWD 2WB2A 3ABME 2AJAA 4EZJA 5CRVA 4EECA 1SW6A 5AQAA 3PDNA 2R2LA 2KBXA 4EZKA 3BQOA 3QWVA 5KJLA 4MLPA 1PAQA 3ISMC 2Q7FA 3APCA 2KATA 2KCKA 4AEZC 2LAHA 2LXLA 4JC8A 1N4QA 1S0PA 5EX0A 1N4SA 4RG6A 1E8ZA 2AXVA 3S7BA 4XI9A 4G8LA 2R17C 3LY9A 3V2OA 5B3SE 5FT9A 2PL2A 2VTBA 2H6IA 3FULA 1G3NB 3SFYA 1UJJA 3HVEB 3FWVA 4BESA 2UY1A 3SI5A 5M72A 4WWNA 3QDNA 2GRLA 4A1GA 4J7WA 5BUZA 3V31A 2NYJA 4XE0A 1O1SA 3L17A 4A55A 1B89A 3NZSA 3ZYLA 3D9MA 1N4PA 4GMRA 1OY3D 3R9AB 2EQXA 2XEHA 4IN3B 1WM5A 1DNPA 2XENA 4JL0A 3IXEA 1H2TC 1N94A 4DJAA 1E8WA 1RZ4A 4N2SA 2C0MA 2IONA 5EILA 4PDXA 2IU1A 4JHRA 2ONDA 4I1AA 4YVQC 5HI7A 4U8VD 1HS6A 3SY2A 5A7DB 4WUYA 3PNLB 3DEOA 4Z68A 1QBQA 3UUXA 4UQZA 5EIBE 3HXBA 3DWLG 1LD7A 1VDYA 5C2YA 4FHKA 4N5QA 3CK7A 2EILE 2OCCE 4HOQA 3CHRA 4ABNA 4A3VA 3JQ0A 4GU5A 2F8XK 5CEDB 3PUJA 1TJCA 3IHYA 4L23A 1DC2A 3WXXA 3K9IA 4FHJA 3PEVB 3TXNA 5G04J 2WQHA 5FIOA 5CBNA 3SGHA 2WXMA 2DYRE 1N4RA 4GTMA 4ILHB 3JQ1A 2B0OE 4WNEA 5CBOA 1Z3YA 1Z3XA 4J6IA 3ZFWA 2R03A 1OXJA 3FUKA 3U3WA 4NRHB 4UQYA 3T8MA 3DXMG 3E37A 1TNOA 1S70B 4HQDA 3MEKA 2LAIA 3TG5A 2YHEA 3JUEA 3URZA 1JCQA 3Q15A 3FTVA 1AP7A 3R9MA 3ZKJA 1HFAA 3I4RB 5J08A 3HXCA 3ZVVA 1MYOA 2R05A 5D0QD 5AIJA 2DCPA 2DIWA 3D9OA 3QAQA 4NIKA 2XQ0A 1NL4A 3FEXA 2P9PG 5FTPA 2XZDG 4J0UA 4JVSA 3ABLE 3SBSA 2BEDA 3ZXPA 3QC1A 3U9WA 3EHRA 3QB2A 2FF4A 4PUCA 4RLYA 5FINA 3CVNA 4DX5D 4E85A 3L16A 2MOWA 2JLBA 3LCAA 1HX8A 3KSLA 4GMLA 4AY5A 5G05C 1JWGA 3HDXA 3EHNA 3PE4A 1OT8A 3HRAA 2WQ7A 3B7SA 5A23A 4U63A 3ASDA 1IQRA 2WXIA 4CRWA 4JZYA 4I1OB 4FJZA 3ESLA 3VTXA 1Z6TA 3CQCB 2P2CP 1N54A 5HQ8A 1FT1A 2ZISA 3D3MA 3KAEA 5BV1A 1A5EA 4K0RA 3DPDA 2XGSA 2KC7A 1H2UA 2XRZA 1WG0A 4J8DA 2IO2C 4UUCA 3EIJA 1HE8A 4XZ4A 2VGEA 3RU0A 5HKPA 2UY1B 3MZLB 1BD8A 3B7UX 2WXHA 3ULEG 2PQNA 2P58C 4AP2A 5T8IA 3QKYA 5JHAA 3JUIA 3DSWA 3GW4A 4F53A 3Q47B 1QNFA 3G2TA 2GRRB 3CHOA 3CV0A 3FUNA 3D9NA 5KWDA 4HBDA 5AQ7A 3LJNA 4J8SA 4BERA 1IXVA 3RO2A 2CFUA 3PE3A 3ZU7B 4GA2A 4Q69A 4MS6A 3V30A 3KSQA 5IY5E 5JJTA 4A1SA 3FHEA 4GYOA 3EUVA 2HE0A 3E33A 4O1PA 1OUVA 4YDWA 3VLEA 1NZNA 1FVHA 1OWLA 2IO3C 2ETAA 3FU6A 3UM1A 2J08A 4GPKA 4OVVA 4ME2A 3SBTB 4GZ6A 4ILIA 3ZHEA 2X6IA 3DSSA 2AXZA 1OCCE 3QK0A 3FU5A 2WXNA 3SFXA 3FTWA 1QQEA 4I43A 4UI9K 4G11A 2I1KA 4AOFA 2EIJE 3U4TA 3UIPC 2AWIA 1HG5A 2MYOA 4GZDA 3LXUX 1UG3A 5ENSD 1IYGA 4O6FA 1N95A 1HU3A 4YDOA 3QWPA 3ZXSA 2V5QC 3PVLA 1E96B 1H2VC 2AVPA 4RVBA 2C0LA 5EDSA 5AQBA 2I1JA 2WXPA 1ELRA 1NFIE 4L2LA 2VSOE 2KM4A 5LFAA 2J09A 1HZ4A 3L22A 1L5JA 5KBAA 3ASNE 5EKQD 3FUDA 3FTUA 4IULA 4I1MA 3CK8A 4J8YA 5FWQA 3CIAA 4ATZD 3MGBA 2Y0BG 1IQUA 2XGMA 3PEUB 5KJKA 1TJFA 1N0RA 5T3RA 1N52A 3UIOC 4GA0A 3Q7AA 2CHZA 1H19A 3ULQA 4EQFA 1MJ0A 3ASFA 3S7JA 2RFAA 4R7LA 3TWXA 4H7YA 1LTXA 2YQ8A 4DPRA 2WMNA 3AS8A 2WXKA 3UMVA 2H6HA 2DWZA 4FJYA 2YHCA 2OOEA 5FQ6A 4LERA 4O60A 4TXRA 1ELKA 1TNYA 2UWJG 4ILGA 2IFUA 2Y4TA 2WXFA 3NF1A 4EHMA 2KZTB 4NURA 5ENQD 1S63A 3WG7E 3TWWA 3CSTA 4AXHA 1LF8A 5LOZA 4K5BA 4K03A 1WDYA 1TN6A 1ELWA 1TN8A 4Y6WA 3AG1E 4ANUA 4TRQA 3JXJA 3CK9A 4GB9A 3UM0A 1EPUA 3BU8A 3EHMA 4BSZB 3ZNGA 3RSEG 4ACLA 4DI4A 1XNFA 2XGOA 1W3BA 1MX4A 1P5QA 2QC9A 4F7AA 4F1PA 2IQCA 2P9NG 2F0YA 3FDHA 2GRQB 4IYPA 3TWUA 4I9EA 3CEQA 5KJMA 3MV2B 4FLHA 4BX8A 3TXMA 5ENPD 2E2EA 3B7BA 4G23A 1S64A 1UW4B 4GTPA 4DLOA 3FP3A 3AS5A 4HI8A 2P9KG 3CVPA 2CFZA 3CVVA 2LNIA 4HXIA 4OYSA 3B13A 4J8FA 4GTSA 4URKA 3UX4A 4UI9C 1MX2A 1BI8B 5AJLA 4HLEA 4WNGA 3C3OA 3NZUA 2PM6A 4EZLA 1BI7B 2Y69E 3RJVA 4J8EA 4F1SA 2OVBA 4PH4B 4F3VA 1H6KA 4YVOA 3OAWA 5BW8C 2X38A 2BF0X 4UWGA 4EPZA 4XX5A 4FC8A 5AARA 1NI1A 2WM9A 3LKUA 4KT6B 4L7TA 4Q96A 3GZ2A 3IHVA 3S7FA 3P2BA 2FO7A 3CGHA 4YDEA 1K1AA 2RFMA 3FUMA 4JD2G 5AJDA 4FA6A 5CHEE 5B1AE 1E8XA 4A63B 4GTTA 4WNFA 3IV0A 1KPSB 3TWRA 2L6JA 4QQIA 3QWWA 2P9SG 2Y1LE 3FH7A 2CHWA 2ZGDA 3RRNB 3DRAA 1SZ9A 3HHMA 3PS6A 4BEPA 3RAUA 3D9KA 4HOTA 4FULA 2GRMA 3PUKA 3EHQA 3RO3A 2V0PA 3CKBA 1FPPA 2XEVA 1YA0A 4DUIA 2J9QA 3AJIA 4E6HA 2VSYA 3P1UA 4G25A 1HH8A 4AIFA 4TUUA 3APFA 3L9TA 4KZCA 4APFA 3EJNA 3FTYA 3IKOB 1DVPA 4HS2A 3Q7FA 3UKUG 2A4ZA 3LEWA 3HYMB 2R5SA 2XPZA 3MKQA 5LX8A 4JHJA 2H6GA 1SA4A 3SF4A 1KLXA 1QZ2A 1WAO1 2B6CA 3T5XA 4FU3A 4DX6D 5BXOA 1SVXA 4BT9A 2ZU6B 2MHKA 5EN5D 1KT0A 5CMYA 1YYHA 5G04C 4FLBA 4XKCA 1SZAA 2QYUA 3VLFA 4F6RD 2X3MA 2NSZA 3SQVA 2IEJA 4B0ZA 3V79K 1OCRE 4G26A 4I6EA 4KVOA 2FEZA 2HYZA 2WXOA 3I4GA 3L54A 3CLJA 1V54E 3RKVA 3FUEA 4PS7A 3RRMB 4PS3A 4CYMD 3UQ3A 4B8CB 1U3DA 4PS8A 1BLXB 2I6HA 3TG4A 4I2WA 2KXPC 2WXGA 2KCVA 4TXPA 4KXKB 3CQGB 4DX2A 4UI9J 4BX9A 2FBNA 3JYSA 3CHPA 2WXLA 3L08A 5EYPF 2OEWA 4QFVA 2PNNA 3SZ7A 2CG2A 4APOA 5G55A 5CMWA 2GROB 3FU3A 3GYZA 3LS8A 5D66A 2RG8A 2LXMA 4JB8P 4HVBA 4XEIG 3HG0D 4DI3A 1X5BA 4N2QA 3KEAA 4JXTA 1IKND 3OXLA 1IHGA 3FUHA 4N5CA 2IOLA 2L0IA 5B1BE 3I3NA 5A6CA 1Y6IA 4DLQA 1E8YA 3QARA 3FTXA 3UTMA 2QZAA 4FP7A 2CHXA 4YDYA 3L6AA 4GYYA 4XI0A 1ZU2A 1YMPA 1MX6A 4YNDA 2VJ8A 4UWLA 3MA5A 1ZB1A 2L9BA 3CVLA 1JCSA 2XRYA 3BUAA 5G05J 2GGFA 4W9RA 4OVUA 3JCKC 3ZHEB 3QNKA 3FUFA 4LNBA 3SFZA 2BTDA 4JPSA 4AVXA 3AU5A 2XPYA 3E4BA 3TWQA 2VSXE 3LYAA 4CZ2D 4NQ0A 3DXKG 3R7QA 2J4DA 2LO6A 1INZA 3UI2A 1WY6A 4CGWA 4X8QA 2EINE 1HF8A 3HXFA 3C72A 2NC9A 2V4HC 4LEUA 3UPVA 1TNBA 3L82A 3HXEA 2VSNA 3SNXA 3FY4A 1H6PA 4I9CA 5E75A 4GZCA 3LY8A 4U07A 5FQ8A 1FCHA 3CVWA 2BKGA 3JXIA 4BT8A 5DBKA 3C3QA 3CSFA 2XZTG 5ARFA 5T4YA 1JPLA 3QOUA 3FTSA 1O1RA 4LSZE 3S7DA 2A5UA 4I6JA 4CCAA 3TWTA 4I2ZA 3PZ1A 4UQXA 2R59A 2DBAA 3ZUVB 2X6JA 4U8YD 4HFGA 4BSXA 1DCEA 1HXIA 5EYLA 4ATGA 1TEZA 4I17A 3ZGQA 4GA1A 3Q79A 5CCMA 3ONLA 3OXGA 3UXGA 5ARGA 3ZIMA 5JA4D 4BFRA 2ZIRA 2QFCA 1IHBA 3Q9UC 2Y3AA 2ZXWE 3D9PA 1PY1A 4G8KA 4LG6A 3UINC 3ESKA 4HNAD 2I2OA 2V8SE 3CHMA 3W9FA 4JEUA 4UWHA 3EU5A 4UWKA 4CT0A 4BTBA 1E7UA 3ZYQA 2X6HA 2Y4UA 3FUIA 3ASHA 4C48B 1EDUA 2DVWA 4B93B 5HS0A 2IF4A 4CGVA 3C98A 3AS4A 3EIQC 3UT8A 2OEVA 1UJKA 3Q49B 4GTOA 1OWPA 4MRUA 3IBEA 3Q4AB 3CR3A 1TNZA 1LD8A 2YINA 4HRNA 2IOSA 4UWFA 3AAAC 1TYQG 4KVMA 3HXDA 5LCWC 1XGWA 4KYOB 5BXUA 1K1BA 3BEEA 4Y6CA 4Q94A 4CEMA 4U95D 2FO1E 4TUMA 4WAFA 5AAOA 2OV8A 5ANLA 3MV3B 4DX1A 5BV0A 3TAXA 2J4BA 5EX3A 5FQ7A 4L1BA 5J90A 4G24A 4RG9A 3PREA 2X6FA 3NOCD 5FZQA 1QYMA 3NQPA 2J07A 2PZIA 2GRNB 3KEZA 4OAUC 1H0AA 1MZCA 1ZBPA 1YCSB 2IY0C 3QJZA 4EBAA 5EIDA 1AWCB 3C3RA 3DSTA 3E34A 4OAVB 3TWSA 2HO1A 5KNHD 3VTYA 3CVYA 3B7RL 2QY7A 3E30A 2XPIA 3LY7A 2GW1A 3Q75A 3S2AA 1OCZE 3R7RA 4WWPA 1E7VA 3O48A 3APDA 1Y8MA 2J49A 4KMOA 5ENOD 1TR4A 3ZYKA 4N3AA 1D9SA 4LCTA 3HIZA 4C9BB 4ANXA 1D8EA 3IEGA 4KZ0A 4N39A 3G2UA 1HO8A 4LUNU 3UT7A 3T5VA 3CVUA 3MCXA 3DSXA 4IRUA 3FH5A 3ABKE 5ENTD 3W9GA 3UM2A 3ONKA 2XHEA 1FVFA 3D9JA 2X6KA 4HRMB 4CDRA 1N0QA 3D9IA 3C5RA 1TN7A 3N71A 5CCLA 4O1OA 1Q2ZA 4AJWA 4WWOA 2XS1A 4HOSA 5C1DA 4LRZA 2E0IA 3G2VA 3DPYA 3V2XA 1O1TA 2C2LA 2RD0A 4EBAG 1EYHA 3G2WA 5CEAA 4HORA 1JWFA 2LUHA 3U66A 2WPVA 4AV7A 4GTRA 4GCNA 5CERB 2JEKA 4K5CA 1NA0A 2J8SD 4U8HA 4B94A 5ENNA 3UM3A 5JJ6A 2ETBA 3ML9A 3FU0A 1N9AA 4C0EA 3LPZA 3MKRA 3ASOE 5JHBA 3NAWA 2RKKA 3BG1B 3CKCA 2P9IG 2CG3A 3PZDA 3J5QB 5D0OD 3UT4A 1BU9A 4LNUD 3MYVA 4GYWA 1JUQA 2NXPA 2MRIA 3U64A 3GZSA 3PZ2A 4ACKA 5KCMA 2VGXB 4DRXE 2VYIA 4N3BA 4DX7D 4K5AB 1O5MA 3PNTB 3RRUA 2BUGA 2WXQA 5BT1A 3ASGA 4LNGA 3TJPA 1Z5SC 2V4LA 5HRYA 3EU9A 3CHQA 2IJGX 4ZFHA 3X2QE 2F37A 4NACA 4U0SA 2ILRA 3CHSA 1TNUA 2WXJA 2EIME 4G2VA 5FJYA 3SHFA 2KCLA 4BWRA 4AY6A 3Q73A 2R02A 4RQIA 3T9KA 4FADA 2AW6A 1GW6A 2ZGGA 1OWNA 4U04A 3T8KA 3ZRHA 1D8DA 1KZPA 5BNWA 4DK5A 5JJ7A 5E76A 3AG3E 1K8KG 3ENEA 3Q78A 1FT2A 1SQMA 2P9LG 3AG2E 4U0ZA 4TXQA 3ZPJA 3GZ1A 3FEYA 5DIZA 3SD5A 2I9CA 3VLDA 3Q5MA 4GMJA 4GTVA 5FZRA 1MHQA 2P9UG 4H7XA 2EIKE 5ENRD 3DSUA 1U3CA
chains in the Genus database with same CATH topology
1MQSA 2WXMA 4I6JA 1P5QA 4ILHB 4CCAA 4XKBA 4F7AA 3JQ1A 3ZW3A 2IQCA 4I2ZA 4UQXA 2R59A 1OWMA 2DBAA 2YNQA 4WNEA 2V5FA 3FDHA 5FZSA 2X6JA 4IYPA 1Z3YA 1Z3XA 3MX3A 4J6IA 4I9EA 3ZFWA 4GCOA 4HFGA 3CEQA 4N3CA 3RK6A 2PM7A 4BSXA 1HXIA 1OWOA 3MV2B 4ATGA 5KJMA 1TEZA 3FUKA 4I17A 3U3WA 3ZGQA 4FLHA 4BX8A 4GA1A 3TXMA 4NRHB 4UQYA 3T8MA 4U0UA 5CCMA 1UN8A 2E2EA 3ONLA 3OXGA 4G23A 1UW4B 5ARGA 4DLOA 3FP3A 3ZIMA 4CDMA 3L13A 4BFRA 4JEHA 3AS5A 2QFCA 2KZTA 1HG2A 2L0TB 3MEKA 2LAIA 3TG5A 3CVPA 2YHEA 2Y3AA 3D9PA 3URZA 2CFZA 3CVVA 3Q15A 2LNIA 1PY1A 1PC2A 3FTVA 4GZ3A 4HXIA 3TL5A 3ESKA 4OYSA 4WNDA 2I2OA 2V8SE 1KT1A 3CHMA 1HFAA 3B13A 3I4RB 1EF1C 4J8FA 5J08A 4JEUA 3ZVVA 4UWHA 3KD7A 5D0QD 5AIJA 2DCPA 4URKA 4GAAA 4UWKA 2DIWA 4CT0A 3UX4A 4UI9C 4BTBA 1E7UA 3D9OA 3QAQA 3ZYQA 2X6HA 2Y4UA 4G1TA 2XQ0A 5AJLA 4HLEA 3FEXA 4WNGA 3FUIA 3ASHA 3NZUA 2PM6A 5FTPA 4A3TA 4J0UA 4JVSA 4EZLA 1EDUA 5LP0A 3SBSA 4V3IA 4BY6A 3RJVA 4J8EA 2OVFA 3ML8A 4F1SA 2OVBA 2IF4A 3QC1A 4PH4B 4F3VA 2LSUA 3U9WA 1H6KA 4CGVA 3C98A 4L2YA 5G2NA 5KJNA 2WQ6A 4JA9A 4GZ5A 4YVOA 3BG0B 3AS4A 3OAWA 5BW8C 4ANWA 2X38A 2BF0X 3PH0C 2LSVA 3EIQC 4B8AA 3UT8A 1UJKA 3QB2A 5AENA 4UWGA 3Q49B 2FF4A 1A17A 3LDZA 4PUCA 4EPZA 4XX5A 3CVNA 4FC8A 3ZN3A 5LCWJ 4P29A 2WM9A 3RIBA 1NP7A 1OWPA 4E85A 3L16A 3LKUA 4KT6B 2MOWA 2JLBA 4HOUA 4MRUA 3IBEA 3Q4AB 5ANRA 3CR3A 3LCAA 1HX8A 2YINA 4L7TA 4Q96A 2IOSA 3GZ2A 3IHVA 4JW1A 4UWFA 3S7FA 4GMLA 2PQRA 4AY5A 5G05C 3P2BA 1JWGA 3HDXA 2FO7A 5G04J 4KVMA 3EHNA 3PE4A 3CGHA 3CVXA 2WQ7A 5LCWC 1XGWA 2VGYA 3AU4A 3FUMA 5AJDA 3B7SA 5A23A 3MKQB 4KYOB 4U63A 4FA6A 3LJ3A 5CHEE 3ASDA 1E8XA 3BEEA 4Y6CA 4Q94A 2HR2A 3I5PA 4CEMA 4C0MA 4WNFA 1IQRA 2WXIA 3FFLA 4CRWA 3IV0A 4JZYA 4I1OB 4FJZA 4WAFA 3ESLA 2L6JA 2OV8A 3QWWA 5ANLA 3B7TA 3MV3B 3VTXA 1Z6TA 3CQCB 4CDNA 3FH7A 5BV0A 2CHWA 3ZYMA 3TAXA 1BPOA 2J4BA 3G2SA 5EX3A 5FQ7A 3RRNB 1SZ9A 1N54A 3HHMA 5HQ8A 3PS6A 4JA7A 3D3MA 3D9KA 4HOTA 4L1BA 3CVQA 4FULA 2GRMA 4AM9A 3KAEA 4G24A 4KBQA 4CT4A 5BV1A 5J90A 3PUKA 4RG9A 4K0RA 3PREA 3RO3A 2X6FA 3DPDA 2XGSA 2V0PA 2KC7A 1H2UA 3CKBA 5FZQA 2XRZA 2XEVA 3NQPA 1YA0A 2J07A 3D9LA 2PZIA 4J8DA 2AXUA 2J9QA 4E6HA 3KEZA 2VSYA 3OTNA 3P1UA 4G25A 1HH8A 1H0AA 4AIFA 3EIJA 4BTAA 1HE8A 4TUUA 2XCBA 1ZBPA 4XZ4A 3KS2A 3RU0A 3APFA 3PRZA 3QJZA 2WXRA 4EBAA 2UY1B 4KZCA 4APFA 2XCCA 3MZLB 3EJNA 3FTYA 3IKOB 1DVPA 2HO1A 3B7UX 4HS2A 2WXHA 2PQNA 3VTYA 3TGOA 3CVYA 2M63A 3B7RL 4JHKA 2P58C 2QY7A 4AP2A 2A4ZA 3LEWA 3HYMB 3EDTB 3FH8A 2FULA 2XPIA 2R5SA 3LY7A 2XPZA 3MKQA 2GW1A 5T8IA 4RSYA 1UN9A 3QKYA 3LVQE 3S2AA 5JHAA 2VQ2A 5LX8A 3R7RA 4WWPA 3JUIA 4JHJA 3S7DA 3SF4A 1E7VA 1KLXA 1QZ2A 1WAO1 3O48A 3APDA 2VGXA 3GW4A 4F53A 3Q47B 2VTBB 3ZEFA 1Y8MA 1QNFA 3HVEA 3T5XA 2J49A 3FUJA 3G2TA 4I6GA 4MKTA 4FU3A 3DBSA 4KMOA 4XIFA 3ZYKA 3FUNA 3CHOA 3CV0A 4N3AA 3D9NA 4TV3A 4BT9A 2ZU6B 2MHKA 4M3OA 4J8SA 5FQ4A 1KT0A 4LCTA 5CMYA 3HIZA 3RO2A 5G04C 2CFUA 3PE3A 4C9BB 4ANXA 4FLBA 4XKCA 5BPPA 3LVRE 3IEGA 1SZAA 4KZ0A 3VLFA 4GA2A 2FI7A 4Q69A 3MJWA 4MS6A 4N39A 4ANVA 2X3MA 3G2UA 3OXFA 2NSZA 1E90A 4B0ZA 5JJTA 4A1SA 1HO8A 3FHEA 4B89A 4GYOA 4LUNU 2WMOA 4G26A 3UT7A 4I6EA 4KVOA 3T5VA 2FEZA 3CVUA 2HYZA 3FTZA 4D10C 3MCXA 1OUVA 2HM8A 1NA3A 4IRUA 3VLEA 3FH5A 2WXOA 3I4GA 3O4ZA 3L54A 1NZNA 2WVIA 1FVHA 5AYWD 1OWLA 3CLJA 2WB2A 3ONKA 3RKVA 3FUEA 3FU6A 4PS7A 3RRMB 2XHEA 1FVFA 4PS3A 2J08A 3UQ3A 4EZJA 4GPKA 4OVVA 4ME2A 3D9JA 4B8CB 1U3DA 3SBTB 4GZ6A 4ILIA 3ZHEA 4EECA 2X6KA 3PDNA 4PS8A 2X6IA 4CDRA 2AXZA 3D9IA 2I6HA 3QK0A 3TG4A 4EZKA 4I2WA 2WXGA 3QWVA 3N71A 5CCLA 5KJLA 3FU5A 1PAQA 2KCVA 2WXNA 3FTWA 4MLPA 4AJWA 1QQEA 4I43A 4UI9K 4WWOA 4HOSA 5C1DA 4KXKB 2Q7FA 4G11A 2I1KA 3APCA 4LRZA 3CQGB 2KATA 2KCKA 4AOFA 2E0IA 4UI9J 4AEZC 3U4TA 4BX9A 2FBNA 3JYSA 2AWIA 1HG5A 3CHPA 3G2VA 4GZDA 3LXUX 1UG3A 2C2LA 2RD0A 2WXLA 3L08A 2LAHA 4EBAG 1EYHA 3G2WA 1IYGA 4O6FA 4JC8A 1HU3A 4QFVA 3QWPA 3ZXSA 4HORA 1JWFA 3SZ7A 1S0PA 2CG2A 4APOA 3U66A 5EX0A 3PVLA 4RG6A 1E8ZA 1E96B 5G55A 5CMWA 1H2VC 2WPVA 2AXVA 2AVPA 3S7BA 4RVBA 2C0LA 4XI9A 4AV7A 5EDSA 3FU3A 3GYZA 2I1JA 3LS8A 4GCNA 2WXPA 2R17C 1ELRA 3LY9A 4L2LA 2JEKA 2RG8A 1NA0A 5FT9A 2VSOE 2PL2A 2KM4A 2VTBA 5LFAA 4U8HA 4B94A 4HVBA 5ENNA 2J09A 1HZ4A 5JJ6A 3L22A 3FULA 1L5JA 4DI3A 1X5BA 4N2QA 3ML9A 3FU0A 1UJJA 3HVEB 4JXTA 4C0EA 3FWVA 3LPZA 3MKRA 5EKQD 3FUDA 3OXLA 1IHGA 2UY1A 3FTUA 3FUHA 4IULA 4N5CA 4I1MA 3SI5A 5JHBA 2IOLA 2L0IA 5M72A 4WWNA 3I3NA 3BG1B 3QDNA 2GRLA 3CK8A 4A1GA 5A6CA 3CKCA 1Y6IA 5FWQA 3CIAA 4DLQA 1E8YA 2CG3A 3FTXA 3PZDA 3MGBA 3QARA 5BUZA 5D0OD 3UT4A 4XE0A 1IQUA 2XGMA 3PEUB 3MYVA 5KJKA 1TJFA 3SGHA 5T3RA 3L17A 4FP7A 4GYWA 2CHXA 4A55A 1N52A 1JUQA 4GA0A 2NXPA 2MRIA 3L6AA 4GYYA 3U64A 1B89A 4XI0A 1ZU2A 3NZSA 3GZSA 3ZYLA 3D9MA 2CHZA 4ACKA 5KCMA 4YNDA 2VJ8A 2VGXB 1H19A 4UWLA 3MA5A 3ULQA 2VYIA 4N3BA 4EQFA 3R9AB 2EQXA 2L9BA 3CVLA 2XRYA 3ASFA 4IN3B 3PNTB 3S7JA 3RRUA 2BUGA 2WXQA 4R7LA 5G05J 1WM5A 5BT1A 2GGFA 1DNPA 3ASGA 3TJPA 4H7YA 4W9RA 2YQ8A 4DPRA 4JL0A 2WMNA 4OVUA 1H2TC 2V4LA 3JCKC 3QNKA 3AS8A 3ZHEB 3CHQA 2IJGX 2WXKA 4DJAA 3UMVA 3FUFA 1E8WA 4FJYA 2YHCA 2OOEA 5FQ6A 2BTDA 3SFZA 4N2SA 4NACA 2C0MA 4JPSA 3AU5A 4LERA 4U0SA 4AVXA 1ELKA 2ILRA 2IONA 2XPYA 3CHSA 3E4BA 2UWJG 2VSXE 3LYAA 2WXJA 4PDXA 2IU1A 4JHRA 2ONDA 4G2VA 4ILGA 4NQ0A 2IFUA 2Y4TA 5FJYA 4I1AA 3SHFA 3R7QA 2KCLA 2J4DA 2WXFA 4YVQC 4BWRA 3NF1A 4AY6A 2LO6A 2KZTB 1INZA 5HI7A 1WY6A 1HS6A 4FADA 2AW6A 4NURA 5A7DB 4CGWA 1GW6A 4WUYA 1HF8A 2NC9A 4LEUA 1OWNA 3PNLB 4U04A 3UPVA 3ZRHA 3CSTA 3UUXA 4AXHA 1LF8A 4UQZA 5BNWA 2VSNA 5LOZA 4DK5A 3FY4A 4K03A 5E76A 3SNXA 5JJ7A 1VDYA 4I9CA 5C2YA 1ELWA 3ENEA 1SQMA 4Y6WA 4FHKA 4ANUA 4U0ZA 5E75A 4TRQA 4GZCA 3CK7A 3LY8A 3ZPJA 4U07A 3GZ1A 3CK9A 5FQ8A 1FCHA 3CHRA 4HOQA 4ABNA 3CVWA 4A3VA 4GB9A 4BT8A 3JQ0A 4GU5A 3FEYA 5DIZA 5DBKA 3SD5A 1EPUA 2I9CA 1TJCA 3CSFA 3EHMA 3PUJA 3Q5MA 4GMJA 4L23A 3VLDA 5ARFA 5FZRA 1MHQA 5T4YA 3WXXA 4H7XA 4ACLA 4DI4A 1XNFA 2XGOA 3K9IA 1JPLA 4FHJA 3PEVB 3TXNA 3QOUA 3FTSA 3IHYA 2WQHA 1W3BA 2A5UA 1U3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT0 A;  3GZ2 A;  1P5Q A;  3RO2 A;  5G04 C;  3QDN A;  3S7F A;  3CK8 A;  2PQR A;  3PE3 A;  3CKC A;  4AY5 A;  5G05 C;  5A6C A;  2FO7 A;  3PE4 A;  3IEG A;  4I2Z A;  5D0O D;  5CCM A;  4GA2 A;  5LCW C;  2FI7 A;  4UQX A;  2VGY A;  4WNE A;  2DBA A;  4N39 A;  2XGM A;  2V5F A;  5FZS A;  3OXF A;  4KYO B;  5KJK A;  5CHE E;  3ASD A;  4GYW A;  3ZFW A;  4I9E A;  3BEE A;  4GCO A;  5JJT A;  4GA0 A;  4Y6C A;  4A1S A;  3CEQ A;  2HR2 A;  4GYO A;  4N3C A;  4GYY A;  4WNF A;  1B89 A;  4G26 A;  4XI0 A;  1HXI A;  1ZU2 A;  3FFL A;  2FEZ A;  5KJM A;  3MV2 B;  2HYZ A;  4I17 A;  4YND A;  3ZGQ A;  1OUV A;  3U3W A;  2VGX B;  1NA3 A;  4GA1 A;  4NRH B;  3MA5 A;  4UQY A;  3ULQ A;  4U0U A;  2VYI A;  2E2E A;  2MHK A;  2L6J A;  1NZN A;  3OXG A;  3QWW A;  4G23 A;  4N3B A;  3R9A B;  4EQF A;  5AYW D;  3CVL A;  5ARG A;  3MV3 B;  3FP3 A;  3ASF A;  3RKV A;  4IN3 B;  3VTX A;  3S7J A;  2BUG A;  5G05 J;  3UQ3 A;  5BT1 A;  1WM5 A;  4GPK A;  3TAX A;  4ME2 A;  3AS5 A;  5EX3 A;  3ASG A;  4H7Y A;  2QFC A;  4W9R A;  2YQ8 A;  4GZ6 A;  3ZHE A;  5HQ8 A;  4JA7 A;  3PDN A;  3MEK A;  4JL0 A;  3TG5 A;  4HOT A;  4CDR A;  3CVP A;  3ZHE B;  3CVQ A;  3URZ A;  3AS8 A;  2I6H A;  3Q15 A;  3KAE A;  4G24 A;  4KBQ A;  3TG4 A;  4AM9 A;  2LNI A;  1PC2 A;  4I2W A;  2YHC A;  2OOE A;  4GZ3 A;  4RG9 A;  4N2S A;  3ESK A;  3RO3 A;  3QWV A;  3N71 A;  4WND A;  2C0M A;  5CCL A;  4U0S A;  2XGS A;  1KT1 A;  5KJL A;  2KCV A;  2KC7 A;  3CKB A;  1QQE A;  4J8F A;  4UI9 K;  4HOS A;  5FZQ A;  2XEV A;  3E4B A;  1YA0 A;  2UWJ G;  3LYA A;  5C1D A;  2PZI A;  4J8D A;  3KD7 A;  5D0Q D;  2J9Q A;  4JHR A;  2OND A;  2Q7F A;  4G2V A;  4KXK B;  2VSY A;  2IFU A;  2Y4T A;  4NQ0 A;  4G25 A;  4UI9 C;  2KAT A;  2KCK A;  4I1A A;  4UI9 J;  4BTB A;  2KCL A;  1HH8 A;  3U4T A;  4AIF A;  4YVQ C;  2FBN A;  3JYS A;  4BTA A;  3NF1 A;  4BWR A;  2Y4U A;  2XCB A;  4AY6 A;  1ZBP A;  4G1T A;  5HI7 A;  3KS2 A;  3RU0 A;  2C2L A;  5A7D B;  4CGW A;  4WNG A;  4WUY A;  3ASH A;  1IYG A;  2UY1 B;  4O6F A;  2NC9 A;  4LEU A;  2XCC A;  5FTP A;  3QWP A;  4U04 A;  5FJY A;  4J0U A;  3UPV A;  4HOR A;  2HO1 A;  3SZ7 A;  4APO A;  2PQN A;  5EX0 A;  3RJV A;  3UUX A;  4RG6 A;  4UQZ A;  3VTY A;  1E96 B;  4J8E A;  3TGO A;  2WPV A;  4BT9 A;  2AVP A;  2P58 C;  2VSN A;  5BNW A;  3S7B A;  2C0L A;  5JJ7 A;  2IF4 A;  3HYM B;  3EDT B;  4XI9 A;  2XPI A;  2R5S A;  3LY7 A;  3GYZ A;  4I9C A;  2GW1 A;  2LSU A;  1ELW A;  4N5C A;  4GCN A;  4F3V A;  4CGV A;  1ELR A;  3QKY A;  5KJN A;  3LY9 A;  4JA9 A;  4Y6W A;  2VQ2 A;  4GZ5 A;  4YVO A;  3AS4 A;  5BW8 C;  1NA0 A;  4U0Z A;  2LSV A;  3CK7 A;  3LY8 A;  3S7D A;  3ZPJ A;  5FT9 A;  4U07 A;  3GZ1 A;  2PL2 A;  3CK9 A;  3SF4 A;  4B94 A;  1FCH A;  1QZ2 A;  1KLX A;  1WAO 1;  3O48 A;  3Q49 B;  4HOQ A;  4ABN A;  2FF4 A;  2VGX A;  3GW4 A;  1A17 A;  1HZ4 A;  3Q47 B;  4BT8 A;  5JJ6 A;  5DIZ A;  5DBK A;  1Y8M A;  3CVN A;  1TJC A;  4N2Q A;  3ZN3 A;  3Q5M A;  5LCW J;  5ARF A;  5FZR A;  3RIB A;  3WXX A;  4XIF A;  4H7X A;  3FWV A;  3LKU A;  3LPZ A;  3MKR A;  1XNF A;  2JLB A;  2XGO A;  3CV0 A;  3K9I A;  4HOU A;  3Q4A B;  3QOU A;  4N3A A;  3OXL A;  1IHG A;  2UY1 A;  5EKQ D;  5G04 J;  3LCA A;  2WQH A;  1W3B A;  5M72 A; 
#chains in the Genus database with same CATH topology
 1MQS A;  1KZO A;  4XKB A;  3B95 A;  1H6O A;  1N11 A;  3ZW3 A;  2ETC A;  2YNQ A;  1OWM A;  5FZS A;  2V5F A;  4U96 D;  3MX3 A;  3DEP A;  4GCO A;  4N3C A;  3RK6 A;  2PM7 A;  1OWO A;  4L9P A;  3NB2 A;  2DZO A;  3D9H A;  5JMN D;  4U0U A;  1UN8 A;  2JAB A;  4CDM A;  3L13 A;  2QYJ A;  4JEH A;  2KZT A;  1HG2 A;  2L0T B;  4ZHB A;  3TL5 A;  1PC2 A;  4GZ3 A;  4WND A;  3Q9N C;  1KT1 A;  1EF1 C;  3SO8 A;  3KD7 A;  5CRU A;  4GAA A;  1RW2 A;  4G1T A;  3UKR G;  3ULY A;  3F6Q A;  4A3T A;  3AG4 E;  5LP0 A;  2DZN A;  4V3I A;  4BY6 A;  2OVF A;  3ML8 A;  1U2V G;  4M7C A;  2LSU A;  5G2N A;  4L2Y A;  2WQ6 A;  5KJN A;  4JA9 A;  4GZ5 A;  2BKK B;  3BG0 B;  4ANW A;  3PH0 C;  2LSV A;  4B8A A;  5AEN A;  2A5E A;  1A17 A;  3LDZ A;  4HB5 A;  3ZN3 A;  5LCW J;  4P29 A;  3RIB A;  1JCR A;  1NP7 A;  3PZ3 A;  4HOU A;  3E32 A;  2F8Y A;  5ANR A;  1OCO E;  4JW1 A;  2PQR A;  3CVX A;  2VGY A;  3AU4 A;  3MKQ B;  3LJ3 A;  2HR2 A;  3I5P A;  4GTQ A;  4C0M A;  1K3Z D;  3FFL A;  1SA5 A;  1UOH A;  3B7T A;  4CDN A;  3ZYM A;  1BPO A;  3G2S A;  3DSV A;  4JA7 A;  3CVQ A;  5AQ9 A;  1V55 E;  4AM9 A;  4KBQ A;  4CT4 A;  3PZ4 A;  4U7E B;  5D2M C;  2XEE A;  3D9L A;  2AXU A;  3J5P A;  3OTN A;  2GRP B;  4BTA A;  2XCB A;  3KS2 A;  3PRZ A;  2WXR A;  2XCC A;  4HRL A;  4HLL A;  3TGO A;  2M63 A;  4JHK A;  3EDT B;  3FH8 A;  2FUL A;  5CEC B;  4BET A;  4RSY A;  1UN9 A;  3LVQ E;  2VQ2 A;  3NOG D;  2VGX A;  2VTB B;  3ZEF A;  5ITZ F;  3HVE A;  3FUJ A;  4I6G A;  4MKT A;  3DBS A;  4XIF A;  4HI9 A;  1DCQ A;  2L6B A;  4TV3 A;  3TWV A;  4M3O A;  5FQ4 A;  2XS8 A;  2DYS E;  4MBG A;  5BPP A;  3LVR E;  2FI7 A;  3MJW A;  4ANV A;  3OXF A;  1E90 A;  1X81 A;  4B89 A;  2WMO A;  4GPM A;  2H6F A;  3FTZ A;  4D10 C;  5AN8 A;  2HM8 A;  1NA3 A;  5H7P A;  3O4Z A;  2WVI A;  3NBN B;  5KNG A;  5AYW D;  2WB2 A;  3ABM E;  2AJA A;  4EZJ A;  5CRV A;  4EEC A;  1SW6 A;  5AQA A;  3PDN A;  2R2L A;  2KBX A;  4EZK A;  3BQO A;  3QWV A;  5KJL A;  4MLP A;  1PAQ A;  3ISM C;  2Q7F A;  3APC A;  2KAT A;  2KCK A;  4AEZ C;  2LAH A;  2LXL A;  4JC8 A;  1N4Q A;  1S0P A;  5EX0 A;  1N4S A;  4RG6 A;  1E8Z A;  2AXV A;  3S7B A;  4XI9 A;  4G8L A;  2R17 C;  3LY9 A;  3V2O A;  5B3S E;  5FT9 A;  2PL2 A;  2VTB A;  2H6I A;  3FUL A;  1G3N B;  3SFY A;  1UJJ A;  3HVE B;  3FWV A;  4BES A;  2UY1 A;  3SI5 A;  5M72 A;  4WWN A;  3QDN A;  2GRL A;  4A1G A;  4J7W A;  5BUZ A;  3V31 A;  2NYJ A;  4XE0 A;  1O1S A;  3L17 A;  4A55 A;  1B89 A;  3NZS A;  3ZYL A;  3D9M A;  1N4P A;  4GMR A;  1OY3 D;  3R9A B;  2EQX A;  2XEH A;  4IN3 B;  1WM5 A;  1DNP A;  2XEN A;  4JL0 A;  3IXE A;  1H2T C;  1N94 A;  4DJA A;  1E8W A;  1RZ4 A;  4N2S A;  2C0M A;  2ION A;  5EIL A;  4PDX A;  2IU1 A;  4JHR A;  2OND A;  4I1A A;  4YVQ C;  5HI7 A;  4U8V D;  1HS6 A;  3SY2 A;  5A7D B;  4WUY A;  3PNL B;  3DEO A;  4Z68 A;  1QBQ A;  3UUX A;  4UQZ A;  5EIB E;  3HXB A;  3DWL G;  1LD7 A;  1VDY A;  5C2Y A;  4FHK A;  4N5Q A;  3CK7 A;  2EIL E;  2OCC E;  4HOQ A;  3CHR A;  4ABN A;  4A3V A;  3JQ0 A;  4GU5 A;  2F8X K;  5CED B;  3PUJ A;  1TJC A;  3IHY A;  4L23 A;  1DC2 A;  3WXX A;  3K9I A;  4FHJ A;  3PEV B;  3TXN A;  5G04 J;  2WQH A;  5FIO A;  5CBN A;  3SGH A;  2WXM A;  2DYR E;  1N4R A;  4GTM A;  4ILH B;  3JQ1 A;  2B0O E;  4WNE A;  5CBO A;  1Z3Y A;  1Z3X A;  4J6I A;  3ZFW A;  2R03 A;  1OXJ A;  3FUK A;  3U3W A;  4NRH B;  4UQY A;  3T8M A;  3DXM G;  3E37 A;  1TNO A;  1S70 B;  4HQD A;  3MEK A;  2LAI A;  3TG5 A;  2YHE A;  3JUE A;  3URZ A;  1JCQ A;  3Q15 A;  3FTV A;  1AP7 A;  3R9M A;  3ZKJ A;  1HFA A;  3I4R B;  5J08 A;  3HXC A;  3ZVV A;  1MYO A;  2R05 A;  5D0Q D;  5AIJ A;  2DCP A;  2DIW A;  3D9O A;  3QAQ A;  4NIK A;  2XQ0 A;  1NL4 A;  3FEX A;  2P9P G;  5FTP A;  2XZD G;  4J0U A;  4JVS A;  3ABL E;  3SBS A;  2BED A;  3ZXP A;  3QC1 A;  3U9W A;  3EHR A;  3QB2 A;  2FF4 A;  4PUC A;  4RLY A;  5FIN A;  3CVN A;  4DX5 D;  4E85 A;  3L16 A;  2MOW A;  2JLB A;  3LCA A;  1HX8 A;  3KSL A;  4GML A;  4AY5 A;  5G05 C;  1JWG A;  3HDX A;  3EHN A;  3PE4 A;  1OT8 A;  3HRA A;  2WQ7 A;  3B7S A;  5A23 A;  4U63 A;  3ASD A;  1IQR A;  2WXI A;  4CRW A;  4JZY A;  4I1O B;  4FJZ A;  3ESL A;  3VTX A;  1Z6T A;  3CQC B;  2P2C P;  1N54 A;  5HQ8 A;  1FT1 A;  2ZIS A;  3D3M A;  3KAE A;  5BV1 A;  1A5E A;  4K0R A;  3DPD A;  2XGS A;  2KC7 A;  1H2U A;  2XRZ A;  1WG0 A;  4J8D A;  2IO2 C;  4UUC A;  3EIJ A;  1HE8 A;  4XZ4 A;  2VGE A;  3RU0 A;  5HKP A;  2UY1 B;  3MZL B;  1BD8 A;  3B7U X;  2WXH A;  3ULE G;  2PQN A;  2P58 C;  4AP2 A;  5T8I A;  3QKY A;  5JHA A;  3JUI A;  3DSW A;  3GW4 A;  4F53 A;  3Q47 B;  1QNF A;  3G2T A;  2GRR B;  3CHO A;  3CV0 A;  3FUN A;  3D9N A;  5KWD A;  4HBD A;  5AQ7 A;  3LJN A;  4J8S A;  4BER A;  1IXV A;  3RO2 A;  2CFU A;  3PE3 A;  3ZU7 B;  4GA2 A;  4Q69 A;  4MS6 A;  3V30 A;  3KSQ A;  5IY5 E;  5JJT A;  4A1S A;  3FHE A;  4GYO A;  3EUV A;  2HE0 A;  3E33 A;  4O1P A;  1OUV A;  4YDW A;  3VLE A;  1NZN A;  1FVH A;  1OWL A;  2IO3 C;  2ETA A;  3FU6 A;  3UM1 A;  2J08 A;  4GPK A;  4OVV A;  4ME2 A;  3SBT B;  4GZ6 A;  4ILI A;  3ZHE A;  2X6I A;  3DSS A;  2AXZ A;  1OCC E;  3QK0 A;  3FU5 A;  2WXN A;  3SFX A;  3FTW A;  1QQE A;  4I43 A;  4UI9 K;  4G11 A;  2I1K A;  4AOF A;  2EIJ E;  3U4T A;  3UIP C;  2AWI A;  1HG5 A;  2MYO A;  4GZD A;  3LXU X;  1UG3 A;  5ENS D;  1IYG A;  4O6F A;  1N95 A;  1HU3 A;  4YDO A;  3QWP A;  3ZXS A;  2V5Q C;  3PVL A;  1E96 B;  1H2V C;  2AVP A;  4RVB A;  2C0L A;  5EDS A;  5AQB A;  2I1J A;  2WXP A;  1ELR A;  1NFI E;  4L2L A;  2VSO E;  2KM4 A;  5LFA A;  2J09 A;  1HZ4 A;  3L22 A;  1L5J A;  5KBA A;  3ASN E;  5EKQ D;  3FUD A;  3FTU A;  4IUL A;  4I1M A;  3CK8 A;  4J8Y A;  5FWQ A;  3CIA A;  4ATZ D;  3MGB A;  2Y0B G;  1IQU A;  2XGM A;  3PEU B;  5KJK A;  1TJF A;  1N0R A;  5T3R A;  1N52 A;  3UIO C;  4GA0 A;  3Q7A A;  2CHZ A;  1H19 A;  3ULQ A;  4EQF A;  1MJ0 A;  3ASF A;  3S7J A;  2RFA A;  4R7L A;  3TWX A;  4H7Y A;  1LTX A;  2YQ8 A;  4DPR A;  2WMN A;  3AS8 A;  2WXK A;  3UMV A;  2H6H A;  2DWZ A;  4FJY A;  2YHC A;  2OOE A;  5FQ6 A;  4LER A;  4O60 A;  4TXR A;  1ELK A;  1TNY A;  2UWJ G;  4ILG A;  2IFU A;  2Y4T A;  2WXF A;  3NF1 A;  4EHM A;  2KZT B;  4NUR A;  5ENQ D;  1S63 A;  3WG7 E;  3TWW A;  3CST A;  4AXH A;  1LF8 A;  5LOZ A;  4K5B A;  4K03 A;  1WDY A;  1TN6 A;  1ELW A;  1TN8 A;  4Y6W A;  3AG1 E;  4ANU A;  4TRQ A;  3JXJ A;  3CK9 A;  4GB9 A;  3UM0 A;  1EPU A;  3BU8 A;  3EHM A;  4BSZ B;  3ZNG A;  3RSE G;  4ACL A;  4DI4 A;  1XNF A;  2XGO A;  1W3B A;  1MX4 A;  1P5Q A;  2QC9 A;  4F7A A;  4F1P A;  2IQC A;  2P9N G;  2F0Y A;  3FDH A;  2GRQ B;  4IYP A;  3TWU A;  4I9E A;  3CEQ A;  5KJM A;  3MV2 B;  4FLH A;  4BX8 A;  3TXM A;  5ENP D;  2E2E A;  3B7B A;  4G23 A;  1S64 A;  1UW4 B;  4GTP A;  4DLO A;  3FP3 A;  3AS5 A;  4HI8 A;  2P9K G;  3CVP A;  2CFZ A;  3CVV A;  2LNI A;  4HXI A;  4OYS A;  3B13 A;  4J8F A;  4GTS A;  4URK A;  3UX4 A;  4UI9 C;  1MX2 A;  1BI8 B;  5AJL A;  4HLE A;  4WNG A;  3C3O A;  3NZU A;  2PM6 A;  4EZL A;  1BI7 B;  2Y69 E;  3RJV A;  4J8E A;  4F1S A;  2OVB A;  4PH4 B;  4F3V A;  1H6K A;  4YVO A;  3OAW A;  5BW8 C;  2X38 A;  2BF0 X;  4UWG A;  4EPZ A;  4XX5 A;  4FC8 A;  5AAR A;  1NI1 A;  2WM9 A;  3LKU A;  4KT6 B;  4L7T A;  4Q96 A;  3GZ2 A;  3IHV A;  3S7F A;  3P2B A;  2FO7 A;  3CGH A;  4YDE A;  1K1A A;  2RFM A;  3FUM A;  4JD2 G;  5AJD A;  4FA6 A;  5CHE E;  5B1A E;  1E8X A;  4A63 B;  4GTT A;  4WNF A;  3IV0 A;  1KPS B;  3TWR A;  2L6J A;  4QQI A;  3QWW A;  2P9S G;  2Y1L E;  3FH7 A;  2CHW A;  2ZGD A;  3RRN B;  3DRA A;  1SZ9 A;  3HHM A;  3PS6 A;  4BEP A;  3RAU A;  3D9K A;  4HOT A;  4FUL A;  2GRM A;  3PUK A;  3EHQ A;  3RO3 A;  2V0P A;  3CKB A;  1FPP A;  2XEV A;  1YA0 A;  4DUI A;  2J9Q A;  3AJI A;  4E6H A;  2VSY A;  3P1U A;  4G25 A;  1HH8 A;  4AIF A;  4TUU A;  3APF A;  3L9T A;  4KZC A;  4APF A;  3EJN A;  3FTY A;  3IKO B;  1DVP A;  4HS2 A;  3Q7F A;  3UKU G;  2A4Z A;  3LEW A;  3HYM B;  2R5S A;  2XPZ A;  3MKQ A;  5LX8 A;  4JHJ A;  2H6G A;  1SA4 A;  3SF4 A;  1KLX A;  1QZ2 A;  1WAO 1;  2B6C A;  3T5X A;  4FU3 A;  4DX6 D;  5BXO A;  1SVX A;  4BT9 A;  2ZU6 B;  2MHK A;  5EN5 D;  1KT0 A;  5CMY A;  1YYH A;  5G04 C;  4FLB A;  4XKC A;  1SZA A;  2QYU A;  3VLF A;  4F6R D;  2X3M A;  2NSZ A;  3SQV A;  2IEJ A;  4B0Z A;  3V79 K;  1OCR E;  4G26 A;  4I6E A;  4KVO A;  2FEZ A;  2HYZ A;  2WXO A;  3I4G A;  3L54 A;  3CLJ A;  1V54 E;  3RKV A;  3FUE A;  4PS7 A;  3RRM B;  4PS3 A;  4CYM D;  3UQ3 A;  4B8C B;  1U3D A;  4PS8 A;  1BLX B;  2I6H A;  3TG4 A;  4I2W A;  2KXP C;  2WXG A;  2KCV A;  4TXP A;  4KXK B;  3CQG B;  4DX2 A;  4UI9 J;  4BX9 A;  2FBN A;  3JYS A;  3CHP A;  2WXL A;  3L08 A;  5EYP F;  2OEW A;  4QFV A;  2PNN A;  3SZ7 A;  2CG2 A;  4APO A;  5G55 A;  5CMW A;  2GRO B;  3FU3 A;  3GYZ A;  3LS8 A;  5D66 A;  2RG8 A;  2LXM A;  4JB8 P;  4HVB A;  4XEI G;  3HG0 D;  4DI3 A;  1X5B A;  4N2Q A;  3KEA A;  4JXT A;  1IKN D;  3OXL A;  1IHG A;  3FUH A;  4N5C A;  2IOL A;  2L0I A;  5B1B E;  3I3N A;  5A6C A;  1Y6I A;  4DLQ A;  1E8Y A;  3QAR A;  3FTX A;  3UTM A;  2QZA A;  4FP7 A;  2CHX A;  4YDY A;  3L6A A;  4GYY A;  4XI0 A;  1ZU2 A;  1YMP A;  1MX6 A;  4YND A;  2VJ8 A;  4UWL A;  3MA5 A;  1ZB1 A;  2L9B A;  3CVL A;  1JCS A;  2XRY A;  3BUA A;  5G05 J;  2GGF A;  4W9R A;  4OVU A;  3JCK C;  3ZHE B;  3QNK A;  3FUF A;  4LNB A;  3SFZ A;  2BTD A;  4JPS A;  4AVX A;  3AU5 A;  2XPY A;  3E4B A;  3TWQ A;  2VSX E;  3LYA A;  4CZ2 D;  4NQ0 A;  3DXK G;  3R7Q A;  2J4D A;  2LO6 A;  1INZ A;  3UI2 A;  1WY6 A;  4CGW A;  4X8Q A;  2EIN E;  1HF8 A;  3HXF A;  3C72 A;  2NC9 A;  2V4H C;  4LEU A;  3UPV A;  1TNB A;  3L82 A;  3HXE A;  2VSN A;  3SNX A;  3FY4 A;  1H6P A;  4I9C A;  5E75 A;  4GZC A;  3LY8 A;  4U07 A;  5FQ8 A;  1FCH A;  3CVW A;  2BKG A;  3JXI A;  4BT8 A;  5DBK A;  3C3Q A;  3CSF A;  2XZT G;  5ARF A;  5T4Y A;  1JPL A;  3QOU A;  3FTS A;  1O1R A;  4LSZ E;  3S7D A;  2A5U A;  4I6J A;  4CCA A;  3TWT A;  4I2Z A;  3PZ1 A;  4UQX A;  2R59 A;  2DBA A;  3ZUV B;  2X6J A;  4U8Y D;  4HFG A;  4BSX A;  1DCE A;  1HXI A;  5EYL A;  4ATG A;  1TEZ A;  4I17 A;  3ZGQ A;  4GA1 A;  3Q79 A;  5CCM A;  3ONL A;  3OXG A;  3UXG A;  5ARG A;  3ZIM A;  5JA4 D;  4BFR A;  2ZIR A;  2QFC A;  1IHB A;  3Q9U C;  2Y3A A;  2ZXW E;  3D9P A;  1PY1 A;  4G8K A;  4LG6 A;  3UIN C;  3ESK A;  4HNA D;  2I2O A;  2V8S E;  3CHM A;  3W9F A;  4JEU A;  4UWH A;  3EU5 A;  4UWK A;  4CT0 A;  4BTB A;  1E7U A;  3ZYQ A;  2X6H A;  2Y4U A;  3FUI A;  3ASH A;  4C48 B;  1EDU A;  2DVW A;  4B93 B;  5HS0 A;  2IF4 A;  4CGV A;  3C98 A;  3AS4 A;  3EIQ C;  3UT8 A;  2OEV A;  1UJK A;  3Q49 B;  4GTO A;  1OWP A;  4MRU A;  3IBE A;  3Q4A B;  3CR3 A;  1TNZ A;  1LD8 A;  2YIN A;  4HRN A;  2IOS A;  4UWF A;  3AAA C;  1TYQ G;  4KVM A;  3HXD A;  5LCW C;  1XGW A;  4KYO B;  5BXU A;  1K1B A;  3BEE A;  4Y6C A;  4Q94 A;  4CEM A;  4U95 D;  2FO1 E;  4TUM A;  4WAF A;  5AAO A;  2OV8 A;  5ANL A;  3MV3 B;  4DX1 A;  5BV0 A;  3TAX A;  2J4B A;  5EX3 A;  5FQ7 A;  4L1B A;  5J90 A;  4G24 A;  4RG9 A;  3PRE A;  2X6F A;  3NOC D;  5FZQ A;  1QYM A;  3NQP A;  2J07 A;  2PZI A;  2GRN B;  3KEZ A;  4OAU C;  1H0A A;  1MZC A;  1ZBP A;  1YCS B;  2IY0 C;  3QJZ A;  4EBA A;  5EID A;  1AWC B;  3C3R A;  3DST A;  3E34 A;  4OAV B;  3TWS A;  2HO1 A;  5KNH D;  3VTY A;  3CVY A;  3B7R L;  2QY7 A;  3E30 A;  2XPI A;  3LY7 A;  2GW1 A;  3Q75 A;  3S2A A;  1OCZ E;  3R7R A;  4WWP A;  1E7V A;  3O48 A;  3APD A;  1Y8M A;  2J49 A;  4KMO A;  5ENO D;  1TR4 A;  3ZYK A;  4N3A A;  1D9S A;  4LCT A;  3HIZ A;  4C9B B;  4ANX A;  1D8E A;  3IEG A;  4KZ0 A;  4N39 A;  3G2U A;  1HO8 A;  4LUN U;  3UT7 A;  3T5V A;  3CVU A;  3MCX A;  3DSX A;  4IRU A;  3FH5 A;  3ABK E;  5ENT D;  3W9G A;  3UM2 A;  3ONK A;  2XHE A;  1FVF A;  3D9J A;  2X6K A;  4HRM B;  4CDR A;  1N0Q A;  3D9I A;  3C5R A;  1TN7 A;  3N71 A;  5CCL A;  4O1O A;  1Q2Z A;  4AJW A;  4WWO A;  2XS1 A;  4HOS A;  5C1D A;  4LRZ A;  2E0I A;  3G2V A;  3DPY A;  3V2X A;  1O1T A;  2C2L A;  2RD0 A;  4EBA G;  1EYH A;  3G2W A;  5CEA A;  4HOR A;  1JWF A;  2LUH A;  3U66 A;  2WPV A;  4AV7 A;  4GTR A;  4GCN A;  5CER B;  2JEK A;  4K5C A;  1NA0 A;  2J8S D;  4U8H A;  4B94 A;  5ENN A;  3UM3 A;  5JJ6 A;  2ETB A;  3ML9 A;  3FU0 A;  1N9A A;  4C0E A;  3LPZ A;  3MKR A;  3ASO E;  5JHB A;  3NAW A;  2RKK A;  3BG1 B;  3CKC A;  2P9I G;  2CG3 A;  3PZD A;  3J5Q B;  5D0O D;  3UT4 A;  1BU9 A;  4LNU D;  3MYV A;  4GYW A;  1JUQ A;  2NXP A;  2MRI A;  3U64 A;  3GZS A;  3PZ2 A;  4ACK A;  5KCM A;  2VGX B;  4DRX E;  2VYI A;  4N3B A;  4DX7 D;  4K5A B;  1O5M A;  3PNT B;  3RRU A;  2BUG A;  2WXQ A;  5BT1 A;  3ASG A;  4LNG A;  3TJP A;  1Z5S C;  2V4L A;  5HRY A;  3EU9 A;  3CHQ A;  2IJG X;  4ZFH A;  3X2Q E;  2F37 A;  4NAC A;  4U0S A;  2ILR A;  3CHS A;  1TNU A;  2WXJ A;  2EIM E;  4G2V A;  5FJY A;  3SHF A;  2KCL A;  4BWR A;  4AY6 A;  3Q73 A;  2R02 A;  4RQI A;  3T9K A;  4FAD A;  2AW6 A;  1GW6 A;  2ZGG A;  1OWN A;  4U04 A;  3T8K A;  3ZRH A;  1D8D A;  1KZP A;  5BNW A;  4DK5 A;  5JJ7 A;  5E76 A;  3AG3 E;  1K8K G;  3ENE A;  3Q78 A;  1FT2 A;  1SQM A;  2P9L G;  3AG2 E;  4U0Z A;  4TXQ A;  3ZPJ A;  3GZ1 A;  3FEY A;  5DIZ A;  3SD5 A;  2I9C A;  3VLD A;  3Q5M A;  4GMJ A;  4GTV A;  5FZR A;  1MHQ A;  2P9U G;  4H7X A;  2EIK E;  5ENR D;  3DSU A;  1U3C A; 
#chains in the Genus database with same CATH homology
 1MQS A;  2WXM A;  4I6J A;  1P5Q A;  4ILH B;  4CCA A;  4XKB A;  4F7A A;  3JQ1 A;  3ZW3 A;  2IQC A;  4I2Z A;  4UQX A;  2R59 A;  1OWM A;  2DBA A;  2YNQ A;  4WNE A;  2V5F A;  3FDH A;  5FZS A;  2X6J A;  4IYP A;  1Z3Y A;  1Z3X A;  3MX3 A;  4J6I A;  4I9E A;  3ZFW A;  4GCO A;  4HFG A;  3CEQ A;  4N3C A;  3RK6 A;  2PM7 A;  4BSX A;  1HXI A;  1OWO A;  3MV2 B;  4ATG A;  5KJM A;  1TEZ A;  3FUK A;  4I17 A;  3U3W A;  3ZGQ A;  4FLH A;  4BX8 A;  4GA1 A;  3TXM A;  4NRH B;  4UQY A;  3T8M A;  4U0U A;  5CCM A;  1UN8 A;  2E2E A;  3ONL A;  3OXG A;  4G23 A;  1UW4 B;  5ARG A;  4DLO A;  3FP3 A;  3ZIM A;  4CDM A;  3L13 A;  4BFR A;  4JEH A;  3AS5 A;  2QFC A;  2KZT A;  1HG2 A;  2L0T B;  3MEK A;  2LAI A;  3TG5 A;  3CVP A;  2YHE A;  2Y3A A;  3D9P A;  3URZ A;  2CFZ A;  3CVV A;  3Q15 A;  2LNI A;  1PY1 A;  1PC2 A;  3FTV A;  4GZ3 A;  4HXI A;  3TL5 A;  3ESK A;  4OYS A;  4WND A;  2I2O A;  2V8S E;  1KT1 A;  3CHM A;  1HFA A;  3B13 A;  3I4R B;  1EF1 C;  4J8F A;  5J08 A;  4JEU A;  3ZVV A;  4UWH A;  3KD7 A;  5D0Q D;  5AIJ A;  2DCP A;  4URK A;  4GAA A;  4UWK A;  2DIW A;  4CT0 A;  3UX4 A;  4UI9 C;  4BTB A;  1E7U A;  3D9O A;  3QAQ A;  3ZYQ A;  2X6H A;  2Y4U A;  4G1T A;  2XQ0 A;  5AJL A;  4HLE A;  3FEX A;  4WNG A;  3FUI A;  3ASH A;  3NZU A;  2PM6 A;  5FTP A;  4A3T A;  4J0U A;  4JVS A;  4EZL A;  1EDU A;  5LP0 A;  3SBS A;  4V3I A;  4BY6 A;  3RJV A;  4J8E A;  2OVF A;  3ML8 A;  4F1S A;  2OVB A;  2IF4 A;  3QC1 A;  4PH4 B;  4F3V A;  2LSU A;  3U9W A;  1H6K A;  4CGV A;  3C98 A;  4L2Y A;  5G2N A;  5KJN A;  2WQ6 A;  4JA9 A;  4GZ5 A;  4YVO A;  3BG0 B;  3AS4 A;  3OAW A;  5BW8 C;  4ANW A;  2X38 A;  2BF0 X;  3PH0 C;  2LSV A;  3EIQ C;  4B8A A;  3UT8 A;  1UJK A;  3QB2 A;  5AEN A;  4UWG A;  3Q49 B;  2FF4 A;  1A17 A;  3LDZ A;  4PUC A;  4EPZ A;  4XX5 A;  3CVN A;  4FC8 A;  3ZN3 A;  5LCW J;  4P29 A;  2WM9 A;  3RIB A;  1NP7 A;  1OWP A;  4E85 A;  3L16 A;  3LKU A;  4KT6 B;  2MOW A;  2JLB A;  4HOU A;  4MRU A;  3IBE A;  3Q4A B;  5ANR A;  3CR3 A;  3LCA A;  1HX8 A;  2YIN A;  4L7T A;  4Q96 A;  2IOS A;  3GZ2 A;  3IHV A;  4JW1 A;  4UWF A;  3S7F A;  4GML A;  2PQR A;  4AY5 A;  5G05 C;  3P2B A;  1JWG A;  3HDX A;  2FO7 A;  5G04 J;  4KVM A;  3EHN A;  3PE4 A;  3CGH A;  3CVX A;  2WQ7 A;  5LCW C;  1XGW A;  2VGY A;  3AU4 A;  3FUM A;  5AJD A;  3B7S A;  5A23 A;  3MKQ B;  4KYO B;  4U63 A;  4FA6 A;  3LJ3 A;  5CHE E;  3ASD A;  1E8X A;  3BEE A;  4Y6C A;  4Q94 A;  2HR2 A;  3I5P A;  4CEM A;  4C0M A;  4WNF A;  1IQR A;  2WXI A;  3FFL A;  4CRW A;  3IV0 A;  4JZY A;  4I1O B;  4FJZ A;  4WAF A;  3ESL A;  2L6J A;  2OV8 A;  3QWW A;  5ANL A;  3B7T A;  3MV3 B;  3VTX A;  1Z6T A;  3CQC B;  4CDN A;  3FH7 A;  5BV0 A;  2CHW A;  3ZYM A;  3TAX A;  1BPO A;  2J4B A;  3G2S A;  5EX3 A;  5FQ7 A;  3RRN B;  1SZ9 A;  1N54 A;  3HHM A;  5HQ8 A;  3PS6 A;  4JA7 A;  3D3M A;  3D9K A;  4HOT A;  4L1B A;  3CVQ A;  4FUL A;  2GRM A;  4AM9 A;  3KAE A;  4G24 A;  4KBQ A;  4CT4 A;  5BV1 A;  5J90 A;  3PUK A;  4RG9 A;  4K0R A;  3PRE A;  3RO3 A;  2X6F A;  3DPD A;  2XGS A;  2V0P A;  2KC7 A;  1H2U A;  3CKB A;  5FZQ A;  2XRZ A;  2XEV A;  3NQP A;  1YA0 A;  2J07 A;  3D9L A;  2PZI A;  4J8D A;  2AXU A;  2J9Q A;  4E6H A;  3KEZ A;  2VSY A;  3OTN A;  3P1U A;  4G25 A;  1HH8 A;  1H0A A;  4AIF A;  3EIJ A;  4BTA A;  1HE8 A;  4TUU A;  2XCB A;  1ZBP A;  4XZ4 A;  3KS2 A;  3RU0 A;  3APF A;  3PRZ A;  3QJZ A;  2WXR A;  4EBA A;  2UY1 B;  4KZC A;  4APF A;  2XCC A;  3MZL B;  3EJN A;  3FTY A;  3IKO B;  1DVP A;  2HO1 A;  3B7U X;  4HS2 A;  2WXH A;  2PQN A;  3VTY A;  3TGO A;  3CVY A;  2M63 A;  3B7R L;  4JHK A;  2P58 C;  2QY7 A;  4AP2 A;  2A4Z A;  3LEW A;  3HYM B;  3EDT B;  3FH8 A;  2FUL A;  2XPI A;  2R5S A;  3LY7 A;  2XPZ A;  3MKQ A;  2GW1 A;  5T8I A;  4RSY A;  1UN9 A;  3QKY A;  3LVQ E;  3S2A A;  5JHA A;  2VQ2 A;  5LX8 A;  3R7R A;  4WWP A;  3JUI A;  4JHJ A;  3S7D A;  3SF4 A;  1E7V A;  1KLX A;  1QZ2 A;  1WAO 1;  3O48 A;  3APD A;  2VGX A;  3GW4 A;  4F53 A;  3Q47 B;  2VTB B;  3ZEF A;  1Y8M A;  1QNF A;  3HVE A;  3T5X A;  2J49 A;  3FUJ A;  3G2T A;  4I6G A;  4MKT A;  4FU3 A;  3DBS A;  4KMO A;  4XIF A;  3ZYK A;  3FUN A;  3CHO A;  3CV0 A;  4N3A A;  3D9N A;  4TV3 A;  4BT9 A;  2ZU6 B;  2MHK A;  4M3O A;  4J8S A;  5FQ4 A;  1KT0 A;  4LCT A;  5CMY A;  3HIZ A;  3RO2 A;  5G04 C;  2CFU A;  3PE3 A;  4C9B B;  4ANX A;  4FLB A;  4XKC A;  5BPP A;  3LVR E;  3IEG A;  1SZA A;  4KZ0 A;  3VLF A;  4GA2 A;  2FI7 A;  4Q69 A;  3MJW A;  4MS6 A;  4N39 A;  4ANV A;  2X3M A;  3G2U A;  3OXF A;  2NSZ A;  1E90 A;  4B0Z A;  5JJT A;  4A1S A;  1HO8 A;  3FHE A;  4B89 A;  4GYO A;  4LUN U;  2WMO A;  4G26 A;  3UT7 A;  4I6E A;  4KVO A;  3T5V A;  2FEZ A;  3CVU A;  2HYZ A;  3FTZ A;  4D10 C;  3MCX A;  1OUV A;  2HM8 A;  1NA3 A;  4IRU A;  3VLE A;  3FH5 A;  2WXO A;  3I4G A;  3O4Z A;  3L54 A;  1NZN A;  2WVI A;  1FVH A;  5AYW D;  1OWL A;  3CLJ A;  2WB2 A;  3ONK A;  3RKV A;  3FUE A;  3FU6 A;  4PS7 A;  3RRM B;  2XHE A;  1FVF A;  4PS3 A;  2J08 A;  3UQ3 A;  4EZJ A;  4GPK A;  4OVV A;  4ME2 A;  3D9J A;  4B8C B;  1U3D A;  3SBT B;  4GZ6 A;  4ILI A;  3ZHE A;  4EEC A;  2X6K A;  3PDN A;  4PS8 A;  2X6I A;  4CDR A;  2AXZ A;  3D9I A;  2I6H A;  3QK0 A;  3TG4 A;  4EZK A;  4I2W A;  2WXG A;  3QWV A;  3N71 A;  5CCL A;  5KJL A;  3FU5 A;  1PAQ A;  2KCV A;  2WXN A;  3FTW A;  4MLP A;  4AJW A;  1QQE A;  4I43 A;  4UI9 K;  4WWO A;  4HOS A;  5C1D A;  4KXK B;  2Q7F A;  4G11 A;  2I1K A;  3APC A;  4LRZ A;  3CQG B;  2KAT A;  2KCK A;  4AOF A;  2E0I A;  4UI9 J;  4AEZ C;  3U4T A;  4BX9 A;  2FBN A;  3JYS A;  2AWI A;  1HG5 A;  3CHP A;  3G2V A;  4GZD A;  3LXU X;  1UG3 A;  2C2L A;  2RD0 A;  2WXL A;  3L08 A;  2LAH A;  4EBA G;  1EYH A;  3G2W A;  1IYG A;  4O6F A;  4JC8 A;  1HU3 A;  4QFV A;  3QWP A;  3ZXS A;  4HOR A;  1JWF A;  3SZ7 A;  1S0P A;  2CG2 A;  4APO A;  3U66 A;  5EX0 A;  3PVL A;  4RG6 A;  1E8Z A;  1E96 B;  5G55 A;  5CMW A;  1H2V C;  2WPV A;  2AXV A;  2AVP A;  3S7B A;  4RVB A;  2C0L A;  4XI9 A;  4AV7 A;  5EDS A;  3FU3 A;  3GYZ A;  2I1J A;  3LS8 A;  4GCN A;  2WXP A;  2R17 C;  1ELR A;  3LY9 A;  4L2L A;  2JEK A;  2RG8 A;  1NA0 A;  5FT9 A;  2VSO E;  2PL2 A;  2KM4 A;  2VTB A;  5LFA A;  4U8H A;  4B94 A;  4HVB A;  5ENN A;  2J09 A;  1HZ4 A;  5JJ6 A;  3L22 A;  3FUL A;  1L5J A;  4DI3 A;  1X5B A;  4N2Q A;  3ML9 A;  3FU0 A;  1UJJ A;  3HVE B;  4JXT A;  4C0E A;  3FWV A;  3LPZ A;  3MKR A;  5EKQ D;  3FUD A;  3OXL A;  1IHG A;  2UY1 A;  3FTU A;  3FUH A;  4IUL A;  4N5C A;  4I1M A;  3SI5 A;  5JHB A;  2IOL A;  2L0I A;  5M72 A;  4WWN A;  3I3N A;  3BG1 B;  3QDN A;  2GRL A;  3CK8 A;  4A1G A;  5A6C A;  3CKC A;  1Y6I A;  5FWQ A;  3CIA A;  4DLQ A;  1E8Y A;  2CG3 A;  3FTX A;  3PZD A;  3MGB A;  3QAR A;  5BUZ A;  5D0O D;  3UT4 A;  4XE0 A;  1IQU A;  2XGM A;  3PEU B;  3MYV A;  5KJK A;  1TJF A;  3SGH A;  5T3R A;  3L17 A;  4FP7 A;  4GYW A;  2CHX A;  4A55 A;  1N52 A;  1JUQ A;  4GA0 A;  2NXP A;  2MRI A;  3L6A A;  4GYY A;  3U64 A;  1B89 A;  4XI0 A;  1ZU2 A;  3NZS A;  3GZS A;  3ZYL A;  3D9M A;  2CHZ A;  4ACK A;  5KCM A;  4YND A;  2VJ8 A;  2VGX B;  1H19 A;  4UWL A;  3MA5 A;  3ULQ A;  2VYI A;  4N3B A;  4EQF A;  3R9A B;  2EQX A;  2L9B A;  3CVL A;  2XRY A;  3ASF A;  4IN3 B;  3PNT B;  3S7J A;  3RRU A;  2BUG A;  2WXQ A;  4R7L A;  5G05 J;  1WM5 A;  5BT1 A;  2GGF A;  1DNP A;  3ASG A;  3TJP A;  4H7Y A;  4W9R A;  2YQ8 A;  4DPR A;  4JL0 A;  2WMN A;  4OVU A;  1H2T C;  2V4L A;  3JCK C;  3QNK A;  3AS8 A;  3ZHE B;  3CHQ A;  2IJG X;  2WXK A;  4DJA A;  3UMV A;  3FUF A;  1E8W A;  4FJY A;  2YHC A;  2OOE A;  5FQ6 A;  2BTD A;  3SFZ A;  4N2S A;  4NAC A;  2C0M A;  4JPS A;  3AU5 A;  4LER A;  4U0S A;  4AVX A;  1ELK A;  2ILR A;  2ION A;  2XPY A;  3CHS A;  3E4B A;  2UWJ G;  2VSX E;  3LYA A;  2WXJ A;  4PDX A;  2IU1 A;  4JHR A;  2OND A;  4G2V A;  4ILG A;  4NQ0 A;  2IFU A;  2Y4T A;  5FJY A;  4I1A A;  3SHF A;  3R7Q A;  2KCL A;  2J4D A;  2WXF A;  4YVQ C;  4BWR A;  3NF1 A;  4AY6 A;  2LO6 A;  2KZT B;  1INZ A;  5HI7 A;  1WY6 A;  1HS6 A;  4FAD A;  2AW6 A;  4NUR A;  5A7D B;  4CGW A;  1GW6 A;  4WUY A;  1HF8 A;  2NC9 A;  4LEU A;  1OWN A;  3PNL B;  4U04 A;  3UPV A;  3ZRH A;  3CST A;  3UUX A;  4AXH A;  1LF8 A;  4UQZ A;  5BNW A;  2VSN A;  5LOZ A;  4DK5 A;  3FY4 A;  4K03 A;  5E76 A;  3SNX A;  5JJ7 A;  1VDY A;  4I9C A;  5C2Y A;  1ELW A;  3ENE A;  1SQM A;  4Y6W A;  4FHK A;  4ANU A;  4U0Z A;  5E75 A;  4TRQ A;  4GZC A;  3CK7 A;  3LY8 A;  3ZPJ A;  4U07 A;  3GZ1 A;  3CK9 A;  5FQ8 A;  1FCH A;  3CHR A;  4HOQ A;  4ABN A;  3CVW A;  4A3V A;  4GB9 A;  4BT8 A;  3JQ0 A;  4GU5 A;  3FEY A;  5DIZ A;  5DBK A;  3SD5 A;  1EPU A;  2I9C A;  1TJC A;  3CSF A;  3EHM A;  3PUJ A;  3Q5M A;  4GMJ A;  4L23 A;  3VLD A;  5ARF A;  5FZR A;  1MHQ A;  5T4Y A;  3WXX A;  4H7X A;  4ACL A;  4DI4 A;  1XNF A;  2XGO A;  3K9I A;  1JPL A;  4FHJ A;  3PEV B;  3TXN A;  3QOU A;  3FTS A;  3IHY A;  2WQH A;  1W3B A;  2A5U A;  1U3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...