5EKQE

The structure of the bamacde subcomplex from e. coli
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
b'TLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title The structure of the beta-barrel assembly machinery complex.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 5ekqE01
2KXXA 1S0WC 3C7UB 1XXMC 2KM7A 2B5RC 2PXGA 3GMUB 3E2LC 3N4IB 1JTGB 3C4OB 5D0OE 5EKQE 3C4PB 5D0QE 2G2WB 3E2KC 5AYWE 3C7VB 3D4EA 2G2UB 4DM5A 2YH9A
chains in the Genus database with same CATH superfamily
2KXXA 1S0WC 3C7UB 1XXMC 2KM7A 2B5RC 2PXGA 4L1RA 3NWDA 3NWAA 3E2LC 3GMUB 2GUMA 3N4IB 1JTGB 3C4OB 3NW8A 5D0OE 5EKQE 3C4PB 3FVCA 5D0QE 2G2WB 3E2KC 3NWFA 5AYWE 3C7VB 3D4EA 4HSIA 2G2UB 4DM5A 2YH9A
chains in the Genus database with same CATH topology
2KXXA 1S0WC 3C7UB 1XXMC 2KM7A 2B5RC 2PXGA 4L1RA 3NWDA 3NWAA 3E2LC 3GMUB 2GUMA 3N4IB 1JTGB 3C4OB 3NW8A 5D0OE 5EKQE 3C4PB 3FVCA 5D0QE 2G2WB 3E2KC 3NWFA 5AYWE 3C7VB 3D4EA 4HSIA 2G2UB 4DM5A 2YH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXX A;  1S0W C;  3C7U B;  1XXM C;  2KM7 A;  2B5R C;  2PXG A;  3GMU B;  3E2L C;  3N4I B;  1JTG B;  3C4O B;  5D0O E;  5EKQ E;  3C4P B;  5D0Q E;  2G2W B;  3E2K C;  5AYW E;  3C7V B;  3D4E A;  2G2U B;  4DM5 A;  2YH9 A; 
#chains in the Genus database with same CATH topology
 2KXX A;  1S0W C;  3C7U B;  1XXM C;  2KM7 A;  2B5R C;  2PXG A;  4L1R A;  3NWD A;  3NWA A;  3E2L C;  3GMU B;  2GUM A;  3N4I B;  1JTG B;  3C4O B;  3NW8 A;  5D0O E;  5EKQ E;  3C4P B;  3FVC A;  5D0Q E;  2G2W B;  3E2K C;  3NWF A;  5AYW E;  3C7V B;  3D4E A;  4HSI A;  2G2U B;  4DM5 A;  2YH9 A; 
#chains in the Genus database with same CATH homology
 2KXX A;  1S0W C;  3C7U B;  1XXM C;  2KM7 A;  2B5R C;  2PXG A;  4L1R A;  3NWD A;  3NWA A;  3E2L C;  3GMU B;  2GUM A;  3N4I B;  1JTG B;  3C4O B;  3NW8 A;  5D0O E;  5EKQ E;  3C4P B;  3FVC A;  5D0Q E;  2G2W B;  3E2K C;  3NWF A;  5AYW E;  3C7V B;  3D4E A;  4HSI A;  2G2U B;  4DM5 A;  2YH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...