5EKQE

The structure of the bamacde subcomplex from e. coli
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
TLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title The structure of the beta-barrel assembly machinery complex.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 5ekqE01
1XXMC 2B5RC 5EKQE 5D0OE 3N4IB 3C7VB 5D0QE 1S0WC 2KXXA 2PXGA 2YH9A 3C7UB 3E2KC 5AYWE 2KM7A 3D4EA 4DM5A 1JTGB 3C4PB 2G2WB 2G2UB 3GMUB 3E2LC 3C4OB
chains in the Genus database with same CATH superfamily
1XXMC 2B5RC 5EKQE 3NWAA 5D0OE 3NW8A 4HSIA 3N4IB 3C7VB 5D0QE 1S0WC 2KXXA 2PXGA 2YH9A 3C7UB 3E2KC 2GUMA 4L1RA 5AYWE 2KM7A 3D4EA 3NWDA 4DM5A 3FVCA 1JTGB 3C4PB 2G2WB 2G2UB 3GMUB 3NWFA 3E2LC 3C4OB
chains in the Genus database with same CATH topology
1XXMC 2B5RC 5EKQE 3NWAA 5D0OE 3NW8A 4HSIA 3N4IB 3C7VB 5D0QE 1S0WC 2KXXA 2PXGA 2YH9A 3C7UB 3E2KC 2GUMA 4L1RA 5AYWE 2KM7A 3D4EA 3NWDA 4DM5A 3FVCA 1JTGB 3C4PB 2G2WB 2G2UB 3GMUB 3NWFA 3E2LC 3C4OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXM C;  2B5R C;  5EKQ E;  5D0O E;  3N4I B;  3C7V B;  5D0Q E;  1S0W C;  2KXX A;  2PXG A;  2YH9 A;  3C7U B;  3E2K C;  5AYW E;  2KM7 A;  3D4E A;  4DM5 A;  1JTG B;  3C4P B;  2G2W B;  2G2U B;  3GMU B;  3E2L C;  3C4O B; 
#chains in the Genus database with same CATH topology
 1XXM C;  2B5R C;  5EKQ E;  3NWA A;  5D0O E;  3NW8 A;  4HSI A;  3N4I B;  3C7V B;  5D0Q E;  1S0W C;  2KXX A;  2PXG A;  2YH9 A;  3C7U B;  3E2K C;  2GUM A;  4L1R A;  5AYW E;  2KM7 A;  3D4E A;  3NWD A;  4DM5 A;  3FVC A;  1JTG B;  3C4P B;  2G2W B;  2G2U B;  3GMU B;  3NWF A;  3E2L C;  3C4O B; 
#chains in the Genus database with same CATH homology
 1XXM C;  2B5R C;  5EKQ E;  3NWA A;  5D0O E;  3NW8 A;  4HSI A;  3N4I B;  3C7V B;  5D0Q E;  1S0W C;  2KXX A;  2PXG A;  2YH9 A;  3C7U B;  3E2K C;  2GUM A;  4L1R A;  5AYW E;  2KM7 A;  3D4E A;  3NWD A;  4DM5 A;  3FVC A;  1JTG B;  3C4P B;  2G2W B;  2G2U B;  3GMU B;  3NWF A;  3E2L C;  3C4O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...