5EKTA

Crystal structure of mutant-k146a of peptidyl-trna hydrolase from vibrio cholerae at 1.63a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
197
structure length
196
Chain Sequence
MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHADKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of mutant-K146A of peptidyl-tRNA hydrolase from Vibrio cholerae at 1.63A resolution.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
total genus 63
structure length 196
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ektA00
4QT4A 3TD2A 2NAFA 3NEAA 4HOYA 4DHWA 4OLJA 4YLYA 3TCNA 4FYJA 2Z2IA 4LWQA 4DJJA 4QAJA 4ZXPA 3KK0A 5B6JA 4JC4A 5IVPA 2Z2JA 4JX9A 2JRCA 3P2JA 4FOTA 3V2IA 4FOPA 1RYBA 4JWKA 4QD3A 4FNOA 5IMBA 5IKEA 1RYNA 2MJLA 2PTHA 4ERXA 2LGJA 3TCKA 3OFVA 4P7BA 3VJRA 4JY7A 4Z86A 5EKTA 2Z2KA 3TD6A 1RYMA 3KJZA 4QBKA 4IKOA
chains in the Genus database with same CATH superfamily
2C8VA 1EWVA 3QNWA 4F46A 4Z0NA 3EVEA 4LCBA 5EKSA 3TRJA 4N0MA 4HGYA 3UTCA 3ZHOA 3HY3A 4V39A 4YCBA 5LQSA 4NZMA 3ZX4A 4H6VA 4B7XA 5HPYB 1P29A 4G36A 2WOOA 4X6UA 1VMDA 2ST1A 4KE6A 1I2ZA 3I6YA 4NYIR 2ZYGA 2JCGA 2CMKA 4EGJA 3K9CA 4EX7A 3IHLA 3WGZA 4RSMA 3THSA 4BKQA 2FX2A 2CVQA 1M1XB 1YQ9A 3MBOA 3RFTA 4MQ4A 4IDAA 1KE2A 2O48X 5B37A 2PO5A 1P6QA 2WAAA 4UAJA 3OPYB 3S7TA 4E03A 1QLHA 4LFAB 1EBBA 4GLJA 3RVPA 1EK0A 4D9FA 1MNQA 1TGVA 2YWGA 3LVQE 1PJ3A 1ZGCA 4GICA 1L7MA 3VJKA 1KRHA 4TVSA 4GPZA 2X40A 5FHQA 1RZRD 3MM4A 1QONA 3VPCA 1K1EA 1J8YF 2QRHA 1ZITA 3ITNA 1JU3A 3B2EA 3ROFA 1FFXB 1JIUA 4OQNA 1NR7A 1T9DA 2OC9A 4P0PB 2OM6A 4NCAA 3ZBQA 4XQ9A 5LLTA 1FRVA 5SZJA 1WLSA 2I2XB 2VDJA 2CKDA 3UXMA 4NICA 4MVJF 4Q18A 1SG0A 5AW5A 4RZ3A 5CFLA 1D03A 3K9FC 1RYEA 5TJ9A 1C8BA 3F78A 3TL3A 2PUGA 4F92B 1CJKC 4C4PA 2PRZA 1BWPA 2WQ6A 3Q8WA 4OYLA 5BSTA 2JFHA 2AD1A 4NCJA 5JAZA 2PJDA 3IBGA 3V4PB 2FLKA 3GPDG 3OPVA 2Z8XA 2E5LB 3A14A 3DBIA 4M1TA 1NURA 2WVHA 1D0SA 2ZSHA 4NX2A 4R9UC 1ABEA 1VQ1A 3LHKA 4MKZA 4MUKA 2FSVA 4G0ZA 3UHJA 2RJOA 4BE9A 5JSZA 3F3KA 1CE8A 2B1JA 4HNGA 4AURA 1J8FA 3E4CA 3EMVA 3RG2A 4RIEA 1M7HA 4IF4A 1Z73A 4IG9A 4QD3A 5CR9A 4P33A 4ZGBA 2N47A 4OYRA 1KARA 4FUTA 3V4RA 8MHTA 2PXCA 4R40A 3Q3IA 4E2XA 4EY3A 1ZIOA 1VE3A 4O3FA 3SBXA 4ECAA 3OFSA 4ZN6A 3ANYB 4RIGA 5HF5A 2E37A 3KOUA 3IA2A 3OU6A 3O9ZA 5D6OA 3SYKA 3M4YA 2Y27A 3ZWCA 1FUKA 3MBIA 3VKHA 1CVIA 3F4LA 3JRWA 4QNRA 2FFJA 1E2UA 5EZSA 4TV9B 5U4QA 4E1BA 1GTVA 5JEDA 2YIJA 1ZGGA 5FR2A 3D64A 1JDNA 1HGXA 3RVBA 1E61A 3UWMA 3LXMA 3R3SA 2GBGA 2GN0A 4X93A 1GQRA 2PKQP 4C7MA 4PBRA 2JLQA 4K81B 1W76A 2UZIR 2XH8A 2DOKA 4GMGA 5BWMA 3GJRA 4LZJA 4BVJA 2VXBA 1JNXX 4EMSA 5KJFA 5C7OO 2HBRA 3OPQA 1I94B 1FTYA 2NIPA 1HFKA 4O25A 1UFVA 1CNFA 3ABQB 4PG4A 2BT4A 5F33A 1H1DA 1DEOA 1SU7A 2QNRA 3C0KA 1T2AA 2VUSA 1C0PA 1ULZA 2ZBQA 3QVUA 4MK4A 4AZ0B 2XQJA 4KXLA 3U7RA 1WL8A 8LDHA 3E1SA 4KFUA 4FE3A 1EWTA 3OMLA 1GRRA 2Q1YA 4TUYF 4BKMA 2NU7A 1PJBA 1NQAO 2HMTA 2NO1A 2AZ4A 2ZK7A 4J0KA 4M21A 4X6YA 5TPZD 1YA4A 3KKPA 1Q1QA 3TF5A 1D2RA 5AJYA 2C2ZA 5ALZA 4Q6WA 5MFPA 3NIFB 1OHHA 5D5PA 1EP3B 1L7XA 2F9FA 3JZAA 1LJ8A 3KVVA 1W4LA 2OCDA 4LGVA 5D7BA 3SS8A 3R6GA 1UT6A 3U2QA 2Y93A 2FSHA 3N8IA 1QFMA 2V6IA 2AXQA 4FK8A 3TPZA 5EKTA 3TLKA 1V6CA 2YNMA 2L42A 5DISB 4B3GA 2QYTA 4URHA 1MJNA 1W4BA 1T25A 4AJ2A 2QVZX 1UJ4A 4EFLA 3AETB 4GE3A 2BTOA 3ESZA 1JMVA 2OV1A 5TGDA 1SUBA 2CHFA 4Y1RA 3VVMA 2R8ZA 3LL7A 1IBLB 1P1BA 4HUQA 2H63A 1R50A 2VQDA 4IUYA 4YRBA 3ROGA 3FTEA 3KBOA 3PSAA 3PKIA 2ZWIA 2LWIA 1ZJWA 2NZ8A 3CEAA 5CH3A 4JBYA 3QSGA 3G0HA 3RRZA 5HK8A 5KHOC 1QFXA 4H08A 4RK6A 4GM4A 3FUVA 3U39A 3P0FA 3V7NA 3PUZA 4JCOA 1K6MA 3AEYA 5EAIA 4ND3A 3AIOA 4EJSA 3WGGA 4H3VA 4HNAB 1TEVA 1GL3A 1SHZA 4X91A 5J2UF 3COJA 1R16A 1XZAA 4R51A 3O5AA 1WNTA 2C7BA 2CNWA 3I05A 3N7TA 3PRKE 4EKDA 2KLHA 1JI0A 1P2GA 2EW1A 3ENNA 1AKVA 4FSHA 1ETHA 4RENA 1NT4A 1RJGA 1FMLA 3BG5A 3MC1A 4B34A 2VPIA 5ICCA 5JH7F 2BGIA 1NJ5A 1D2NA 1FC0A 3PZRA 3AV0B 3LKBA 5TNXA 3SEZA 1XDSA 1B14A 3CY6A 3DCIA 1PZHA 2ID4A 4QUGA 2I54A 3E9EA 1H23A 4KNVA 4WECA 5JNTA 1K7FB 1PZFA 1WHTA 2VEOA 4PX2A 3WGLA 1NNEA 4B9EA 2G70A 3ZXUB 4YT2A 5ALOA 3JQGA 3VHXA 1J0BA 1FDOA 3LQRA 1P45A 3DBLB 4KYTA 1GZDA 1XQ9A 2FEKA 2FFRA 1JHUA 1ZD3A 1M1UA 1RC1A 2FFBA 3G5MA 4BBJA 2O7RA 4BJ5A 1YI8A 4GPBA 4AN0A 1OW3B 5B58T 4CMHA 4PFSA 2XV1A 1Z7YA 1MC5A 1BMQA 1SR8A 2YKGA 4FTWA 2AUTA 1WSAA 3NCTA 3GQBB 3I1JA 1GRVA 3ABSB 4JBIA 1FYDA 4MW6A 5DTEA 2Q3DA 5BW4A 3ADCA 4ILEA 1U7ZA 2ZDQA 5CNJA 1PWZA 8AT1A 3H0EA 4DEYA 4BNTA 5KNDA 5IJ9B 1EVJA 3G9QA 4UBNA 5FL7A 2FEPA 1DV1A 2IYOA 5JD3A 4PU0A 2CK3D 4IHJB 3ROEA 4E2ZA 1PNQA 4EEZA 1V2GA 4CM3A 1G2PA 4KWHA 1RQGA 1ESEA 3RUDA 2WKSA 3IS3A 1QVRA 3TUJC 4HHEA 5LLDA 1A88A 3ZWYA 2IU6A 3HYSA 3ZZUA 4IQ4A 1P1KA 1JPVA 2P7HA 3DWIA 3JAWA 3L0YA 3UWKA 1KFKB 3WP0A 1RADA 1BGVA 1TIKA 4LZZA 1UXGA 1GKIA 3T5DA 3OLXA 4DREA 1E3LA 5CHYA 5FYQA 5KVQA 1YKSA 3Q7IA 4I3HA 4A3SA 1LI4A 5LN1A 1W5AA 4NBKA 2FSFA 1WDTA 1ZM3A 1NOKA 3CWQA 1Q2UA 3IEUA 4LBZA 3MUEA 4MQEA 4BNKA 4GC5A 1DKUA 2WJAA 3N28A 1RCFA 1X1CA 4RETA 5DNDA 4ZKEA 3ME5A 3MCTA 1OAAA 3BSWA 3QF7A 4L73A 1Q1ZA 2DQZA 1MVLA 3PQ8A 1PGQA 2ENUA 1P0MA 3NYIA 3RSFA 5B1IA 4CE6A 3K09C 5E8RA 3QBJA 3FD8A 3OQBA 4CETA 3ER9A 5AWFC 3KJNA 1QFYA 4C1NA 2IXDA 4CLDA 3AWIA 4K9NA 2QUKA 3BM5A 4ZVSA 5JJIA 3IQEA 3ILHA 1UZAA 4XEHA 4MUXA 1F1BA 4BO8A 2I1LA 4TQUS 2HCBA 1OU0A 4WOKA 3ZLTA 3LUHA 2IEBA 4JP3A 1XVUA 2P2ZA 4HB2A 5DX0A 1GAWA 5FNVA 1RPZA 1TOAA 1KYYA 3R5JA 5HS4A 2WD7B 2G0TA 4DE5A 4JOQA 5L6MB 3UAGA 1LH0A 4JJAA 3HLKA 3VAZA 1TPZA 3PWSA 4BO7A 4RKYA 3NH9A 1UC5B 1R3UA 1TVCA 4O4HA 4RHUA 4XD7D 2VAVA 5CM9C 1NFFA 2LE0A 1F7UA 1A2BA 1CD5A 1KC3A 3OJEA 3ISJA 1CRLA 1Y98A 3D54D 2B2NA 3KEOA 3FFTA 3KQOA 2GN2A 2JLSA 2ZTLA 2QLTA 1TQHA 4MVJM 4RV5A 3QPDA 1JPJA 1H6AA 2NXEA 4DLUA 4GVPA 4Z3KA 4GG1A 1XLWA 5KYUA 4FILA 2JIZD 4GL4A 4CN8A 1MU0A 2IV2X 2WC1A 2ZDGA 1FUYB 1M10A 2O6LA 1D07A 3P96A 2C7QA 3G7UA 2XGOA 1XEXB 2CJPA 4GSLA 1DUIA 3VPSA 4PZLA 4MYCA 3U3XA 4BQFA 3ZJYA 4ES6A 1KNXA 4JZKA 1XRLA 1A2QA 3I73A 3PP8A 4HDKA 5AP9A 3TIVA 2B4RO 4DYVA 4HBZA 3GHYA 4FHGA 4GO1A 4UAGA 4DV0B 3BWEA 4P4SB 4O33A 4LECA 3NM4A 1Z2NX 1CQJA 5HIAA 1D7OA 3BF7A 2XE8A 5EXPA 4GKKB 3H5AA 2C9OA 2HOQA 2VP9A 3D3JA 3GRRA 2EIXA 1UMBB 4AULA 1PYGA 3K1JA 4YONB 1IUKA 1T3TA 3DPUA 1L2TA 2JJYA 4H0FA 3CS3A 5DNEA 3GRFA 5BMVF 2I80A 1G18A 2QX4A 3G89A 4TTRA 4KIUA 3CNLA 3SHWA 1KY2A 2RGAA 3WNBA 4AG5A 5B36A 1P0PA 2A1UB 3FNBA 4W6ZA 2IWHA 5BQXA 3NMUF 1AKEA 1JTVA 3PDIB 1F2DA 4LI0A 1PGNA 3EZ6A 5AJUA 4CV3A 4NS1A 3U61B 5GAJA 2J59A 2HEGA 3LP6A 3BIOA 2AEFA 1AUOA 3ZQ4A 4HXFB 5LQCA 3ZU3A 1QKIA 4KN5A 1TAGA 1Y80A 2ZE5A 1BFUA 3HN6A 3VOSA 2Q49A 4GOLD 1LU9A 1NRIA 2WMNB 4ZVTA 3AI1A 2IIBA 2X9QA 4YXWA 4ZDIA 2PLWA 3V7FA 4BO3A 3KT3A 3MD9A 3B8HA 2BF7A 3AERA 4KXXA 1J2YA 1QCYA 1QRUA 2I3ZA 2BJWA 3VR5H 1SXQA 1ZONA 3FJYA 4I6JA 2VDKB 2VH1A 2R6GA 3GOQA 1S3SA 2YY7A 4UNIA 1RI3A 3WZ2A 3WWOA 3GUYA 2AT1A 4M0FA 2OPHA 2QGNA 1BDMA 4MP8A 5EUMA 2X77A 3BH7A 1L4GA 4I14A 2AMYA 4DHEA 2WWYA 2R2GA 2W9XA 3REQA 4W5OA 2Z95A 2EBWA 2VNIA 2ZBDA 2R6HA 1O96B 2V7UA 3PKZA 5BT9A 4D96A 2C9MA 4XIJA 2XD4A 2C04A 1WPQA 3FNHA 1QIKA 3RANA 1ZCZA 1I51A 2ASVA 3KG2A 2HCFA 3R3ZA 1E7YA 1MENA 1P9NA 3IPCA 3CNBA 4UPDA 3T99A 1SB9A 4BNNA 3G8YA 3B3GA 4JK3A 3C3EA 3DOIA 3T15A 3ENKA 2KBEA 4NZOA 3TRKA 2RKOA 4JELA 4KE9A 4KOAA 2KS6A 4C43A 1SXPA 5FAKA 3AKYA 5FPHA 5CA1F 4ALMA 2CDBA 3U62A 1YZQA 2OXRA 4CQJA 3OT1A 1CIPA 3RSSA 4F4FA 4DTCA 1KP2A 1NBME 4G8DA 2XDQB 3DTVD 4CKWB 4CG0A 1F6BA 2IITA 3HB9A 4LOLA 4ON9A 2CJXA 3NP9A 2VWHA 3AU9A 1YR1A 3M33A 3TD2A 4Q3AA 1TKBA 5DM4A 5AM5A 1GWNA 1YDWA 1FX0A 2Z6QA 2DFVA 2K7FA 5HR5A 1DQPA 2A9OA 3AX6A 3RWOA 4EECA 3CVYA 1AJEA 3NJ8A 3A6GA 5KVVA 4YCNA 2QJFA 4BPRA 2PMCA 3FYDA 3JR7A 4N0DA 2WF7A 4JYMA 2ZRDA 2QPAA 3R4CA 3HO1A 3H86A 4EKIA 5A4JA 1SUPA 3QI2A 4QGBA 1QIHA 3EFHA 4X92A 5C5EA 2F1KA 5AVWA 2GCOB 5CDHA 3U60B 4CV1A 1TW3A 2RGBA 1X1EA 3C7AA 1MD9A 2GK3A 2JG3A 2HLHA 1HMPA 1QHNA 1YZ3A 3BWDD 3VPGA 2ZAYA 3DNFA 2X2OA 5F1OA 1DBPA 4ZQBA 4UBMA 4YLYA 4LJ7A 3ZHZA 4X94A 2HT1A 1Y81A 3MQ2A 1ELOA 1KZ7B 3RTDA 3QNMA 4BJ3A 4ZFNA 5IDQA 4ZTZB 4GBJA 2DP4E 2OWEA 3SZ3A 2XITA 3IP6A 4JUDX 2CYBA 3NIGB 1EIZA 3O8LA 1IUNA 3EPHA 4EGAA 2ODQA 2IHUA 1KJ9A 3H1GA 4K6GA 4LF5B 3T3IA 3DMYA 5IBPA 3ZCVA 2FZVA 4WZAB 1WXFA 3ABRB 1Z6TA 2FPPB 1IWPB 2GSWA 3AOGA 3DFIA 2WFAA 3M6WA 4M22A 4C78A 4YMLA 3CVXA 5FOQA 1MW9X 1RTTA 3OX1A 4UUMA 5HRAA 4WVLA 3JYOA 1L3IA 3K70D 3TMAA 1UXKA 5D86A 3KPVA 2EJBA 2Q3CA 1TD9A 2IRWA 4CKYA 3A3OA 2BHSA 1EGVB 1CC1S 2R65A 2LVBA 2ANBA 1U2EA 3L1UA 4XB6B 5DNUA 1WULS 4QO7A 2FY8A 5LIPA 2OFOA 3FTFA 4BO4A 1U7OA 2I6UA 3DZCA 3GNTA 3PNYA 4TWIA 4LQCA 4EPVA 5I8WA 5FFFA 1HE1C 3AKDA 2C4WA 3LVFO 3CN9A 3S8EA 1NFQA 1XCJA 2JRCA 4QJBA 4X3OA 5F5LA 2J5BA 1NIJA 2DWOA 2H9AA 3H4IA 4PFQA 1QDLB 3V2HA 1ONSA 1B6GA 2O3JA 4RNDB 3BD7A 4A92A 3C1OA 1GZSA 2LPMA 3UMBA 5BUCA 2WP0A 4A5SA 1YUMA 3VYTB 3MWFA 3S70A 2ZM6B 1XRMA 3NDBB 5DYGA 1BFKA 4G37A 2JGEA 3ZW8A 4HN4B 4K46A 1R0LA 5J59A 4LV6A 2H8GA 2DRIA 1KK2A 1CEEA 1IC6A 2NGRA 4FGSA 3F67A 1C0EA 4AWBA 3G9TA 3LFHA 3ER8A 3C48A 1SU4A 3MTEA 5FXMA 3E5RA 3PXCX 5JC1A 4A8JC 1MVOA 1JQ3A 2J0QA 2IYNA 4JR1A 4LPKA 4JODA 2YJNA 4EB3A 2JAXA 5T6MA 1TVKA 4L8YA 1D8TA 3VPAA 1XXHB 3TXXA 2W2LD 5TRTA 5J9FA 3T7TA 2EATA 4OHCA 1PR2A 3HKBB 5JBIA 3BJIC 2EDCA 1XDUA 1UKYA 1GZ4A 5F3RA 2BCEA 1Q21A 2YWBA 3EAGA 1OOEA 4JKOA 1P4SA 4RMGA 5FQOA 1U2DA 4KQEA 4AD8A 3NALA 3A06A 1ZIDA 2PRIA 1V8DA 3D0QA 3NHYA 4QGHA 2IXFA 3WGJA 1BVHA 1JECA 1JEDA 3EF1A 4LHEA 3FMPB 5HCIA 1DRKA 1P31A 1G5PA 3IQWA 4TSRA 2XYHA 3PBKA 5D51S 3V48A 2H1SA 2VBIA 4ZEOA 4CODB 3TSOA 5J40A 3W6ZA 4D3FA 2WU1A 1ZD4A 1M1YA 4KO8A 4JDUA 1SO8A 1ZIPA 3RYIA 1Y8QA 2A30A 1NQTA 3NEPX 3EIXA 2X5OA 5DTJA 4GNKA 3FOZA 3OZGA 4LVCA 5ALKA 3EK2A 3VR6A 1VA4A 3PLNA 4M76B 4XUEA 2HSJA 3HA5A 1O4WA 2YIDA 3E7PA 5HF6A 4CI0B 4CR7A 4MVJG 6CHYA 2OWDA 2AQ8A 5LQDA 2Z98A 2WWWA 2IIQA 2OBLA 4UBKA 4XJSA 2GD1O 4HGRA 2WWIA 1M2FA 3HBAA 2NUTB 3F6YA 4V0NA 3WYFA 2JHPA 5GMOA 1J90A 5B57C 5IXSA 3BXGA 3FPLA 4I9UA 4XLTA 5U4XA 1MNAA 3RC7A 4ZMRA 5HWSA 5HXAA 2ZRAA 5GQSA 3ABZA 2AI3A 1PV1A 4FR5A 4K6OA 3W9SA 4NK5A 3VA7A 1UDXA 2YZNA 3W90A 3B1FA 3WRYC 1EHIA 3DLTA 1QHHA 1J20A 5LC1A 3A4NA 1IBCA 2X2PA 3DOUA 4Z8YA 2Q1XA 3CIOA 5BN1A 4ESVA 5DBGA 4JL6A 3D7MA 4GX5A 3ZHTA 3PC7A 2JZOA 3CX7A 4X20B 1LK0A 3R44A 1KE1A 2WWFA 1VIYA 1TZCA 3JD3A 4ZYZA 3FCXA 2C8KA 1L7OA 2NT3A 5B3JA 5J58A 1PBNA 1CQPA 2ZFUA 5DTRA 4ZT2A 2AFIA 2XCUA 3UBMA 1IXKA 4EX6A 1HDIA 1WV1A 4CGYA 5IANA 3Q40A 1DQRA 5CVUA 2EYQA 3PHJA 9ATCA 2W6QA 1ZN7A 3ITEA 1KDRA 3GIDA 3RI3A 1S4QA 2A57A 5LD2C 3LWNA 4MV1A 1OXMA 2ZRNA 1GM5A 5H82A 1JN0A 4QXQA 3WLRA 4DANA 1VFNA 3ZZTA 2VTDA 1JT9A 2TYSB 2XOKA 3I8XA 3LWZA 4I66A 1J8DA 4S0ZA 3UWOA 2NO0A 4B6GA 1KMCA 3NOQA 4LY6A 3TG2A 3D2LA 1K06A 4C3VA 4EHFA 4MYSA 4Q3KA 2WLSA 3WNDA 1XP5A 1XMQB 1UEJA 3C1AA 3MTIA 3AVYA 5KDDA 4NONA 4L5JA 2AOXA 1OD6A 1Z36A 5BN4A 2P4EA 5FEMA 5H59A 1QK5A 2Y1EA 1JF8A 1E6LA 4MWOA 1PZEA 2C84A 2EWWA 2P11A 1R0RE 2VJAA 3M0EA 3Q6MA 1SZJG 4R3UC 1RJ9A 5JCXA 5BRJA 2I4TA 2W4QA 5IVDA 1DT5A 2JEZA 4DLWA 3ILXA 1EM6A 1L4YA 1X7XA 2CJYA 2D4AA 2I8CA 2YV2A 3MWGA 2NU9B 1FLNA 2IIPA 3UA4A 4YUZA 2BY4A 2GZRA 4P3YA 4R2IA 5JAUA 3ASZA 5EJGA 4J0JA 3CUWA 4IH1A 3NDJA 1BA2A 2AEJA 3EC1A 4MWBA 1R4NB 4ZI7B 3IESA 1E9RA 5JS2A 3W8NA 5JPIA 3G0DA 2IHBA 2X76A 1DJMA 3NGXA 1V7QA 1YZYA 3K0CC 4WGGA 4EDFA 3GRYA 1CVRA 1XRPA 4HB0A 3TNFA 2PUFA 1TO1E 1JJFA 4MUAA 3P9SA 4JVLA 1DFHA 2DR0A 4TUYA 4XYLA 2B2CA 2IYXA 4MWCA 4XWWA 3KSRA 5DVZA 5DNYB 4GDFA 3B3FA 5D3KA 4FDVA 3N39C 4BHTA 1G2OA 4UHJA 2QMYA 2W6MA 4M9SA 4UE2A 4E13A 4BN5A 4YH1A 2C7OA 3KAPA 4MQFB 4EELA 4RGYA 4YJGA 1MGOA 2WWHA 3RD5A 1THTA 4FEYA 3LWBA 4MV6A 3W05A 3AM1A 5FOTA 3GFRA 3DBOB 5C34B 4ZHQB 1K7YA 2VI5A 3K2IA 4X44A 5HS6A 3GUUA 2Z09A 2WYVA 3KUCA 4O1HA 2VZ0A 3E7WA 1J2JA 1QNFA 4R9RA 3AZQA 3IDQA 4ZV9A 5H5JA 3IKLA 3AP1A 2WJIA 2HJVA 4I4LA 4KXYA 4NFLA 4BV9A 2ZE7A 5B2EA 4M8KA 4PZAA 5IW8A 1U3DA 3CPEA 3LRTA 4MGIR 1W5SA 3MTJA 2R6AA 4O2LA 1TIPA 1X39A 5AKJA 4I36A 1QG4A 1QOZA 4LPSA 3ZHBA 2R6FA 4Q21A 1X42A 1T3GA 4D8XA 4TT3D 3TFWA 4ASUD 1RRCA 1CR0A 4HVLA 3W2TA 1YDHA 1YONA 2WBLC 3UKDA 1AHIA 3OJFA 3GLGE 2QM7A 2YOHA 3D1LA 3THOA 5F76A 3A1EA 4PIMA 3E7DA 1QIJA 1XLUA 2DHRA 2PM8A 1E94E 2XEDA 2B4KA 2ODNA 4P4UA 5FTWA 2RH8A 5JH7A 1M5TA 2JFVA 1WMDA 2OVFA 3WGQA 1PJRA 1CJUC 2P90A 3NIDB 5CX1A 3EVGA 4REQB 4E70A 1IWBB 4BNWA 5ITSA 1MC1A 1X9GA 2I65A 1ZJ4A 2IXEA 3FNQA 3WL3A 2I55A 2SCUB 5BYBA 2BI4A 2VPYA 3QKSB 2O3QA 4C03A 4XASA 4YLGA 3R4VA 3AHEA 3G8BA 1SOMA 3LBNA 4KQXA 2VFAA 3DAGA 3GCDA 2YVAA 1FP4B 2O3SA 3CEMA 3GLFE 4FGWA 4OX9B 4ALJA 3MHTA 4OA8A 1AM4D 3MQFA 3QVTA 3NWEA 1CZKA 4XCQA 3Q2KA 1N6NA 3A6JA 5F78A 3DFZA 3ZGNA 1CEQA 1A8IA 5HFJA 3DNPA 2FFAA 5EE0A 5G02A 3UPTA 4P3PA 2X0FA 3N2KB 1PTJA 5DBFA 1H4TA 1WXXA 4RV9A 5BQOA 2ZE8A 3BIJA 4FGLA 3QE9Y 1Y9ZA 4MTLA 2AWOA 1G21E 4R83A 1Y3HA 4R1UA 5JRZA 3HJHA 2FSVC 4MB0A 1C0LA 4Q1EA 4ZO7A 3VZRA 1H2WA 5DCLA 2ORIA 3W7BA 1FJXA 1W29A 3IP1A 3LQ4A 1YI1A 3IOMA 1V1MA 4HAYA 4PLHA 4BX3A 3RVNA 1OIXA 1SQSA 3GP3A 1KK0A 3KZCA 2IEDA 1U81A 3P7MA 4Z9FA 3WL5A 3UXYA 1GA6A 2PYDA 1M34A 3LF1A 1CUIA 1B15A 2CSUA 4WNIA 4Y30A 4A6XA 4CV0A 4X61A 3IBCA 2I78A 2KHZA 4C0QC 4EO4A 5A62A 4BV2A 2IK8A 2JVIA 1AZWA 3LBFA 5CMLA 4YRZA 1XNHA 2R87A 3GJSA 4YAUA 3Q7RA 1D9XA 3DBHB 4WJZA 1JLKA 2QTCA 5K4GA 1JAYA 4WFQA 4DLRA 2DFLA 2HB6A 4V24A 2XE7A 3PF9A 3FVRA 5LYJA 3HCAA 1R6VA 4LJ8A 4RYLA 1W59A 3HG7A 4RZUA 1LI5A 2X4IA 3UWPA 4C14A 4E4YA 4U7WA 1SH7A 5D5QA 5LD2B 3UWSA 4DM7A 1Z4MA 1UWCA 4MSUA 3TIGA 3QVGB 4G0UA 1OWLA 1XJ5A 4BCDA 3REOA 3ZVKA 3FCAA 3MWKA 3B13B 5BOSB 5EQDA 2CMGA 3EUAA 1HUQA 2K2QB 4Y6RA 1UFRA 4YQEA 1RACA 4QUKA 3RC9A 1M6EX 1NUHA 3N7AA 2RKWA 4YPOA 1QPZA 4TMYA 4W7SA 3NUGA 5AHXA 1JU4A 4RDIA 3R7BA 3EQ9A 1N5LA 4IUCS 4OKSA 3MMZA 2DHCA 1U8TA 2YZ2A 3VX4A 1W5EA 3KT0A 3AXSA 3BJMA 2WIKA 1Q1NA 4GPIB 1CXZA 3RHTA 1K75A 3PEFA 5CYPA 4FI3C 4BLTA 2DZDA 4KLNA 1G5FA 2I33A 1ADGA 2XB8A 2F8LA 1VJDA 1BMTA 2YASA 3PHGA 1XK6A 3NTXA 3QJ5A 4L0QA 4Q7EA 1T6ZA 1UJ6A 3P2MA 5EVCA 1LQUA 2PLFA 3LF2A 2DR3A 5H3LA 3VI3B 4E94A 5H8WA 1IZYA 1I32A 1RYYA 2ZYUX 2WW8A 4GP6A 4I08A 4MARA 1YGYA 5JE8A 5FTMA 4BZWA 4KLCA 3CRRA 4FDAA 3DQZA 4PRYA 2ZWAA 3TR6A 1WW8A 1E1YA 3GLQA 5KTPA 3SR0A 4UAVA 2IHYA 4X1OA 1J9GA 1VMAA 2C3OA 3JCZA 4I5IA 4NRDA 1RZ3A 2GA8A 1LRLA 3LA8A 3S8MA 4J0IA 3RIEA 3V5NA 4N9WA 4FZVA 1RM4A 1M3SA 1QK4A 1U7UA 2VQ3A 5KS2A 4B3RB 3JTMA 3E5HA 4DBZA 5CYOA 2JD2A 2ZIXA 5D1NA 1O89A 1ZMRA 2P0EA 1JE0A 2WM3A 3P2EA 5A6VA 4E5VA 3G5LA 2W5UA 3LM8A 4TTPA 4EQ6B 1YAHA 4ZV4A 1GTRA 5I8ZA 3A7DA 1GZ7A 4R2XA 2W42A 2C2HA 1FNSA 1M6WA 3TFQA 4EJSC 3JR3A 2OESA 2QTVB 3ZWKA 3JYHA 3LXXA 4HKTA 1HEUA 4NESA 3LI2A 4DNOA 4EY7A 4KTTE 1BD4A 4ONEA 2B7CA 4M98A 2ZRGA 4MWDA 3WLJA 5A7HA 4B5KA 4DAEA 1ZOPA 4XB2A 4G1UC 1N32B 4GPAA 4WBNA 3OZRA 4WZBE 1JP7A 1LW7A 3F47A 4N0QA 1ZN8A 1IK4A 4JENA 4C4ZA 3C3YA 5JNUA 1K7EB 1DOZA 1ZU4A 2I7VA 4ZALA 4RUKA 2ZIZA 3MCAA 5FA6A 5C46F 3TG8A 1FBTA 1C1XA 2NO7A 4BNFA 1MT0A 3CKMA 2OZVA 3DT8A 3L40A 4R8SA 5T41A 5K0JA 5KYKA 2HJRA 4M0UA 2I2FA 1SVMA 3G59A 5I9IA 3AJRA 1V1JA 3CURA 3D2AA 4UM5A 1P7YA 2BKVA 2RAFA 4YBRA 2CNLA 3SM9A 4ND5A 4S1OA 1F2UA 1DSSG 3C41J 3IP8A 4IOKA 3EOBI 2RDMA 2CV1A 1TAUA 3C15C 3OJOA 4ENTA 2ZJ5A 3WZLA 1PSWA 2QZJA 1DFGA 2P40A 1E3IA 1H9BA 3TUZC 2IUFA 4CF4A 3OICA 4YUAA 1SXJD 1VYTA 2RG1A 3HWWA 1IHOA 2NPOA 3K72B 5HE9A 2JAOA 4RK5A 2PBFA 5KWIA 4CM6A 5D3MA 1Q11A 3KSZO 1IOWA 3L7LA 3VU9B 1P9OA 4WJLA 1A7JA 1XZGA 3N58A 2ZB2A 1J9ZA 3T3MB 4WN9A 2GTHA 4GOXA 4XDYA 1C4WA 1Y3IA 4QO8A 3TMYA 5ICSA 3F7TA 4QULA 3X1WA 1MT3A 5LFAA 4INAA 3DFMA 3FSEA 3IDAA 4G0OA 3HS3A 1YMQA 2H1VA 2H5JA 4LJAA 4QSMA 3L05A 1HQDA 2J6CA 2WM8A 5IN4A 5M5BA 1FF9A 3QFTA 4U2DA 4B81A 4CMEA 1EFLA 2X9LA 4ZI2A 2I3BA 1G9TA 3PGJA 4I50F 1U4OA 2ZEJA 5HJ2A 1B1AA 2P5YA 1FE8A 2AFHA 2R47A 3JQ7A 3BTSA 3JYNA 3JQFC 3FDXA 5E6SA 1CUUA 3ON5A 4XCXA 1KJWA 2CHGA 3OZTA 5DYNA 1CY2A 4YUWA 5LP6A 4A73A 2Q0SA 2K5UA 4NENA 3C39A 4K3UA 4UAUA 3SSNA 3U40A 1CE8B 1NVWQ 1TM2A 4IMIB 2W37A 1T2FA 2LNDA 5G0SA 3TNYA 3WWPA 3K0FA 3FMVA 3T7DA 1USKA 3DFUA 1A69A 1JLLB 1Z0IA 2D5LA 2W90A 1T6XA 2H4XA 5ILQA 3OHSX 1QP7A 1KH1A 1Y6RA 1I1QB 2VBFA 3H9CA 1DIRA 4HB3A 5EKDA 3ZXYA 3OSZA 4FE7A 3VOAA 1DB3A 3RBAA 3EZ9A 4ZT5A 4A03A 4PZZA 2VQEB 3DMFA 5GJCA 4OTZA 2CL6X 2W2MA 2WHEA 5T6BA 2YIVX 1DX4A 2JFPA 3SVZA 4F71A 1MB0A 1CUBA 1BQ4A 1SVWA 2VCYA 3SIRA 4AFNA 1SNYA 1VJTA 2ZXUA 3GBSA 3LLVA 2WOJA 2DQYA 2OMKA 4AJJA 3ZQJA 4DY4A 1CRPA 1OA0A 5KNBH 4PCVA 1RYZA 3WWYA 1JHOA 3FE2A 1YV9A 4OG2A 3NM5A 5GIPE 2PYIA 1FYFA 2PBZA 1PV4A 1Q7GA 2DLDA 3KEFA 4U7FA 2XJ4A 1JHXA 1X86B 5ALFA 2ZRJA 5DEOA 4DLAA 5B7NA 5AI8A 3TSWA 2HH9A 4MRMA 4D41A 5CCBA 3HXQA 2W8ZA 4PLCA 1FCJA 5AI6A 5EJ8A 1V43A 3RJTA 5DRYA 2ZJ8A 1GQQA 1V3VA 2C2XA 3P9IA 1Q5PA 1DZ3A 2V4UA 2E85A 2YHSA 3I8OA 3SMQA 3IEVA 2NU7B 1M2EA 5AHOA 4CNQA 4LRTB 2I3AA 3LT4A 1PDWA 3R0ZA 2CL5A 1HETA 3F6PA 4N5DA 3P94A 5TT1A 2CJFA 2P68A 3SYRA 3UKJA 1TF2A 1AXRA 1RSZA 2H3HA 1XTZA 4CFSA 5IWAB 4CF7A 2D54A 3EPKA 3OC6A 2CY0A 1KH2A 3PPIA 1PT6A 3GJ7A 1TKRA 1VIAA 2GT1A 3N6RA 4D5EA 4DDWA 3HLYA 1WHSA 3KQSA 4BFYA 2DCMA 2YZMA 4HWRA 3C5VA 1E2NA 3WKDA 2VJPA 2XYPA 2FEOA 4EW1A 1IQPA 1RDFA 3L1IA 3CZPA 1URPA 3MPUA 1TUBA 3PNPA 4OLFA 5GIOE 2TMDA 4HYEA 2QORA 1TC1A 2V9CA 1RRGA 3DMHA 4K6MA 4Y0VA 3EHEA 3OJ0A 4Y1RB 4HUQB 3WTCA 1B73A 1COWD 2A3RA 3LT0A 4P80A 3HA7A 4JC5A 4ZCQA 5LXTB 2D0PB 2IYSA 1ZI9A 2EFJA 2J67A 5J4VA 5IN5A 3E8XA 2W2VA 1CUGA 2ZTHA 3MWEA 2HRCA 3OZIA 1O5OA 1ZKDA 4U7TB 1SBQA 1AXEA 3N5KA 5JZVA 1S2MA 1QQ6A 3MMNA 3GGCA 2QQGA 3AO0B 4ITRC 2WKQA 1YS9A 3WMRA 4F04A 1ENYA 1KY5A 1RHKA 2AYYA 2OHVA 3J7TA 1M73E 1YZTA 4FLEA 4RBNA 1H0RA 5DLYA 1WAMA 5JZBA 2YV5A 2XVXA 4LDJA 1ARZA 2VUHB 1I3KA 4B43A 1ZY2A 3QIVA 3J80A 3K5WA 3TTYA 2WG2A 3KLMX 4WXEA 2PJZA 3CIFA 4O2RA 1FDIA 2GK6A 1PNVA 1ZWLA 3MWDA 4NMWA 3UMCA 3ZWQA 4J1TA 5K45A 5C51B 5AW8A 3PC8A 2Y2UA 3UMVA 3V2GA 5IM4F 1QDEA 1F48A 2FPUA 4IBOA 4IW3B 3V8RA 2FWPA 3DDUA 4AL4A 2XUIA 1X38A 2WNIA 2YZKA 3MNFA 2O2GA 1U2SA 4URZR 1OWNA 4PO1A 1IZ9A 4TYWA 2QV7A 4X1YB 1J7KA 2J87A 2V9ZA 1G64A 2AS0A 2WAOA 2ZSKA 1WHTB 2R60A 1DFIA 2DBYA 3ROQA 3AFHA 4RY9A 1G16A 1RFGE 2AG5A 3ESBA 4DRXA 3SY8A 2O8BA 4JI3B 2GCIA 1W0CA 5AM4A 2NMVA 4ND4A 1UBJS 5EJIA 3W6PA 3CNOA 3F8SA 3HN2A 5EESA 5I5EA 4E5KA 3G49A 1N3IA 5ALRA 5IARA 4BUZA 1B1CA 4X60A 2WJ3A 3GWGA 4IIEA 2VA9A 2AJCA 2V97A 3QEJA 3EZGA 3QOWA 5CDFA 3H9QA 5DW0A 4Z2YA 2OKCA 2VKQA 4ZHSA 1BX3A 1BH6A 4LE2A 1EK6A 4CT5A 1CUSA 4HEJA 2N1MA 3X1XA 1GZUA 2V4MA 2J1LA 1IN4A 1N75A 4GH5A 3KYCA 1XMIA 1KR2A 3HJFA 3O3CA 4UULA 3VDMA 3NAZA 5JVDA 5IK2A 4UOZA 4DR5B 4E33A 1L7BA 1MQSA 1GLNA 1X15A 3BFJA 1NQOA 1XGKA 3VH4A 3BC1A 4L8FA 2NZYA 3RAPR 2QVXX 4Q4JA 2OYRA 3R9XA 1ISIA 1KRXA 2COEA 3KWJA 3R5FA 2HA7A 3B52X 3WAKA 2G3YA 3OFND 5HVNA 3MLAA 1SC9A 4BNJA 4IWNA 1BEZA 3M5PA 4OMFG 4ZOQI 3DLBA 2J9RA 1CW2B 3UAZA 2BH2A 2Z2XA 3N2EA 1OI7A 2GVDC 3PNVA 3STTA 3EFEA 1VHQA 2QP9X 5J43A 3OA0A 1WV0A 2IEYA 4M89A 4R81A 2PANA 5ECDA 1OLUA 3VR4H 1QO9A 2CVPA 1PD0A 2FG5A 4JY7A 4MQEB 2DTDA 4MQLA 3BE8A 3U49A 1NG9A 1OIVA 3AKZA 1H5UA 4QBTA 5JNWA 1KYQA 2QR2A 3T9DA 3UHPA 2YRFA 3DLIA 4LRXA 1PQPA 4HI0E 1U0HC 5CDUA 2M1ZA 2QK4A 2VEDA 4ZT4A 4LHZA 1LPAB 1XI2A 3WK9A 4AKHA 2HCTA 3DDCA 3EQ6A 5CLLA 4UHFA 1WMBA 4WACA 1JTFA 5CW1A 2QN6A 3ZHQA 4D9NA 2C5HA 1DAGA 2C5EA 5FV7A 4J16C 1EXVA 2BM1A 2WF5A 5KTMA 3IODA 1EB8A 3IAHA 4RYDA 4TN1A 1WQ1R 4KMRA 3S8YA 2PT6A 4D6PA 2NUAA 3EA0A 3LGAA 2WWTA 4N47A 3KTAA 4MLPA 1ICEA 3TBKA 4EY4A 2PGNA 1RBQA 5CTAA 2COKA 5AOAA 1X14A 3G5TA 2DFTA 2QRPA 1A5BB 1EAMA 5D1HA 1NL3A 1S8OA 2P2DA 5IX8A 1GTG1 5HF9A 1SHLA 3D7SA 2G36A 1F2VA 4BIMA 4HP8A 3I58A 4YIHA 3RGWS 1IQUA 1X87A 3ZXIA 4I1OA 4M60A 3TPCA 1J2RA 1KDVA 3NEJA 4OLJA 4O4HB 1TD1A 3L7OA 1GKKA 4RD1A 5HCNA 1GPUA 3WB1A 1CR4A 1YJ8A 2F1JA 1PEKE 4PG7A 1HYBA 2RGDA 2YV1A 5IJ0A 4FMDB 3TL2A 3HP7A 3D3WB 1JXOA 2Y4OA 4D81A 2XHEA 2VAXA 3RWMB 2G1PA 2Z08A 3MJEA 3JD4A 2VP6A 4NYMQ 5C7LO 5KYUB 1EUYA 1L5HB 3FRIA 3ZY3A 5I7WA 3PNMA 5B2FA 4DLTA 2WHRA 4C7JA 3QNUA 1F3LA 3IUEA 3WNQA 1GU0A 1M9NA 5G53C 2ZDHA 3IV9A 1E4EA 2Q3HA 1U2QA 1EFRD 2AL7A 1NBMD 5D87A 5TC4A 4WINA 1V9SA 2V55B 2IEZA 3FSJX 3NONA 2J9XB 4BGUA 3L0OA 1QB8A 4O4JF 4PW0A 3TBFA 2DY0A 1CQJB 1ZEJA 2G77B 3IOEA 4TQ9A 3VPFA 4G0QA 2VOEA 4EMTA 4HZUA 5H16A 3P2YA 1ZI8A 3ROXA 5HEKA 2D7JA 4ZU1X 2NG1A 2Y0DA 5DGDA 3KB8A 4ZOEA 3RODA 2IXAA 3W9UA 3E3MA 4CN9A 1W9MA 3UQYS 1JKFA 1TDJA 4AF8A 2BHNA 4FVTA 4L6IA 2BMEA 2CXNA 1U2DC 1E79D 4Y2PA 1STOA 2YOFA 3BUSA 3HY6A 4UZSA 3WDSA 1EVKA 2ZPUA 1CK4A 4F5EA 2PUWA 5JPDA 1NXQA 2GQ0A 4MJLA 1XHFA 4G1EB 2OP0A 4EVQA 3LBAA 3AHGA 3NKLA 4MRSA 4WKGA 1MTZA 3CG4A 5I9SA 3X1MA 1EUQA 1Z07A 2AOVA 1DWUA 2LV8A 4MINA 3T06B 1VHDA 5TGTA 4EO9A 2XT9A 2AZMA 1Q0TA 3VKWA 5B55A 4MP6A 4Z4GA 2AG6A 5K9ZA 5EZ5A 3OQMA 5LR6A 5D85A 4LXYA 4YDRA 5JTUA 2HN9A 4RMJA 4OXRA 4TOIA 4WLVA 3SLKA 3AG6A 3S5JA 1NA5A 5H68A 3OWOA 5SY4A 5JQWA 2JI7A 1EH5A 3AERB 2YICA 3BK1A 4PLWA 4KVZA 1Q1BA 2JJ8A 3ZE9A 5IT5A 5K3OA 1ZH2A 1J24A 3BH0A 5KDOA 3EA5A 2Q2QA 3J81A 1XRRA 4HAOA 3DYVA 3KOYA 3IHKA 2WM9B 2YVKA 3EY4A 1P39A 3MT9A 3TZCA 5J3JA 1HV8A 3LQFA 4AQYB 1V3QE 1YTLA 1IN7A 1OV6A 4TMKA 3U80A 2VPQA 4OJNA 4QPZA 4DAOA 3HTXA 4B3JA 4QEKA 3VX3A 4UFOA 1DDGA 4PSDA 4UCFA 1O08A 4G5HA 4HMQA 4KTVE 2NZWA 2R96A 4MUMA 5C1BA 3D5EA 1EE2A 3H5IA 3VPBA 4IAOA 2GEFA 2YQ4A 4ZCRA 2PG3A 3U4DA 1Z8NA 2IHVA 4LXHA 3EXAA 4XI9A 5B3JC 5BYKA 221PA 4QVIA 4AJOA 2OAQ1 3BRCA 3PUYA 4BQPA 2RBEA 3PPWA 4MO2A 4WN3A 3K9GA 4G0WA 1IY8A 2C1XA 4BFVA 2RMKA 3B78A 4W8GA 1JW9B 3IUQA 3SIXA 1XZ8A 4BVFA 2CYCA 1TA9A 3OT1B 4MQMA 3LX5A 3C6MA 5DMHA 3J81k 5CRIA 3ULKA 3I3OA 1RHMA 2Y71A 3RVJA 2A86A 3MTQA 3ILYA 3TEJA 1UZNA 1KS2A 1VP3A 3LQ2A 3N87A 3KHUA 3QX9A 3HKDA 2O8CA 1P6XA 2RJNA 1HFEL 4TN5A 1FX0B 1Z7EA 2CUNA 3ET4A 1Q0QA 4YCSA 1QWSA 3SP1A 4AYWA 3DFKA 3ZHRA 2NQ8A 1BRTA 1DC5A 4BAUA 2FMKA 3UB4A 4DVJA 1H8ED 5ALJA 4YS6A 3DHVA 1TAHA 3KUUA 1XWFA 1PFKA 4MPPA 3LLUA 1N6HA 4LMRA 2OZLA 2YUIA 1SQGA 3KR0A 4L3OA 2G71A 1T5IA 2D2EA 1K3UB 1RQ2A 1GPYA 2PSJA 5HSGA 4LHWA 2O0KA 1GYRA 2QS9A 2ZJ1A 1VHLA 2WVAA 4HF7A 1N0IA 3M2TA 4OQFA 5LZ7A 2HFJA 3CVWA 3STXA 1Y1KE 3GWZA 3UMYA 2VDWA 3L1KA 1PZXA 5LZ8A 4LQDA 2F3QA 1QK3A 4DMUB 5DHFA 3MOIA 5NULA 2W6NA 3OCVA 5G41A 4Q24A 2O07A 1XCPA 2Y1GA 3EOAI 2GK7A 5EP2A 2JLYA 1V3TA 1DMSA 1VG0B 2B5WA 4YX9A 4DQLA 1IVSA 5JAOA 2N9UA 1V26A 4CZ2A 5FO1A 4ZJPA 2FHSA 4TMTA 4IIVA 4BN0A 2AN3A 1IY1A 3R6LA 3DMPA 3RWBA 1W19A 1GXSA 1TJPB 2ZIVB 1S1CA 4D4IA 2BUCA 2XSZA 2PIAA 5EIBD 1XMXA 4OBWA 4QNNA 1TYDE 3ORFA 4J0EA 2QPTA 3IP5A 2BDEA 5A71A 2Z56A 1T4BA 4HDSA 4I55A 5AXDA 2MYTA 2XUFA 1GUFA 1JSZA 4EFNA 1L1RA 5FI5A 2D00A 2KQUA 5EHQA 1QX3A 1RJWA 2HMWA 3N74A 2XKBA 3FDZA 4OHFA 4I9HA 3KYJB 1GPAA 2NP6A 4N5HX 3OU2A 2QL5A 3NVMB 4A27A 1JQJC 2ZBEA 4XM0A 2E0IA 3ROZA 3NORA 2ZJAA 3MILA 2P2LA 5D01A 5BQPA 3M83A 4C1BA 4DM3A 3KE8A 1YVEI 5KSYA 1OUMA 3LZ6A 4RXTA 1MZPA 1Y8ZA 3CLUD 4YPFA 2GUGA 4ZT3A 3T41A 2XWBF 1AQUA 4RCVA 4MDHA 5LB4A 5JZOA 2ONCA 1UQUA 1Z2CA 4L9RA 1EX6A 2BEVA 4GWKA 5KNCH 2QUBA 3WJ1A 5HKKD 4LF7B 3EDCA 2Y92A 1XZDA 2EIHA 5B6JA 3MD0A 3GJTA 4JI4B 1V39A 3UJAA 3A1FA 1KSHA 3PDJA 1KYTA 4XQCA 1YDEA 2JD0A 4CKEA 3EY9A 2V1UA 2BMWA 1D2CA 1UOOA 3DMNA 1EAYA 1SMKA 1X6VA 2ZJOA 4OGKA 5AKEA 3E9ZA 4MUBA 1Z6YA 1MX1A 4IXTA 4TLAA 1YIDA 1TVKB 4FMCB 3V34A 5K5EA 3L7KA 5HOQA 3TQFA 1V8FA 4XIGS 4M7RA 1LPNA 2YMLA 3HJGA 7YASA 4PO3X 4XB1A 2MT9A 2MCFA 1ZAYA 4ZU3A 1FJGB 1A4RA 2F1HA 4DJTA 1Z2AA 1QUEA 3BEDA 1ADFA 4RS3A 1L4UA 4RVSA 1VJGA 4NHEA 3LCRA 5GVRA 3ZI0A 3GD5A 3FKQA 1E8DA 1KI3A 1L1EA 2W6JA 4KKXB 3TQTA 2H07A 3Q3GE 4OH1A 5K6TA 4GS5A 4C4TA 3IX7A 1ISPA 5A1TA 5HTOA 2Y9PB 1M1YB 1C3VA 5HCUA 1EXNA 3NBYC 1PSDA 4H0NA 5IMBA 1Y8QB 2QQFA 1P4JA 3A3PA 1GL9B 3CRQA 3FPEA 4B3CA 1FIUA 3PFFA 5P21A 2W93A 3FR7A 4MW5A 4EL0A 4BL5A 5KHLB 2RC5A 2E82A 5KU7A 4V2IA 5JS6A 1PTJC 2D1SA 4CIYA 2GTPA 3TTVA 3AUXA 4NATA 4X8HA 4FR0A 1OWOA 3PCXA 1K68A 1P2TA 3EGOA 1WNFA 4TTAA 5ADUS 4GSYA 1L5LA 1XZJA 1ZX1A 3KU4A 5E9QA 3ZLUA 4CM8A 1QTNA 1EX1A 2RFLA 4F45A 1E2DA 4H6PA 1NI4A 4XGIA 3QVJA 4BO2A 1FBNA 1PNTA 3QU2A 4MICA 4TMXA 4NXNB 1QHHB 3PPVA 5AHRA 2FR0A 1ENPA 4B2IA 4LVUA 1VSTA 1WD7A 1RXEA 2MYNA 3PPXA 1I7PA 2ZUSA 4GEKA 4MH0R 4NBTA 5FLYA 1JPNA 2PH7A 3IAFA 2R86A 4DILA 5KJCA 1C1DA 4S1NA 4JJEA 5CJ2A 1HT1E 2QMHA 2B3TA 3EC2A 1TA0A 1ZC3A 3DJFA 5BSRA 3STYA 3TAHA 3KZVA 1OX5A 1SK9A 4BQRA 3WQBA 4NDAA 2PGAA 2YBDA 3IPYA 3RT7A 2AFIB 2Z0MA 4JA0A 1T91A 3S40A 1RXCA 4IGEA 2F9LA 3AIIA 3FOCA 3IV6A 2JI4A 1J0EA 4IOLA 4HWOA 2XA2A 4ROSA 3C5HA 3ZW7A 3AL0C 3LS2A 2C9YA 2V5AA 4TKUA 4ARBA 3UMFA 4F6RA 2XNHA 2FUNB 2VNKA 1TCVA 2V5VA 1WVGA 2P69A 4U2CA 1G6OA 4C05A 3SLRA 4D9CA 4JT8A 3BJEA 3P9RA 4AZ0A 1E92A 3ZJVA 1G3RA 4AQDA 3NTUA 1VGVA 5KQPA 1MO2A 1R2QA 1R8QA 1IMJA 2IELA 2JJMA 3Q9LA 3K8QA 1F7VA 5JEEA 1A5TA 2OQ2A 3O75A 3WBFA 1BEUB 4K1LA 3LUDA 4WGFA 3LVBA 1FTGA 1PR1A 2NV2B 3DWGA 2HUNA 4N76A 4RHYA 1BGWA 1G6KA 1L1QA 3CA8A 1SCIA 5BN4B 2XTJA 1TVEA 1OC2A 1NATA 2UYGA 1U4NA 1YQXA 2H31A 3JYLA 4G07A 3VTZA 1FS4A 2YX1A 3DDNA 5AICA 1MMFB 5H80A 1NT2A 1ORVA 1N5KA 3NR2A 1JKJA 3JWGA 1UWVA 1GQSA 1HNNA 2Z9CA 2H2IA 3M6FA 3KEGA 1VSVA 5F7XA 4GOKA 3ZZ0A 2OCGA 1W581 3O8QA 1E60A 1XD2A 2GAIA 3RSLA 4X95A 4I9FA 1E9SA 3FTNA 3WX0A 5IHPA 1W36D 3K0KA 2GPNA 2JIOA 1PQYA 4IX1A 1B43A 1TAQA 1ZJ6A 2C3YA 2O20A 3LLCA 1E5XA 5GVSA 3T9AA 4CEJA 1T8TA 1XTUA 2UZ1B 4IXMA 1AB6A 3V80A 1QIMA 1PG0A 1Z62A 4EUKA 1DQZA 4ETNA 3SSMA 4FS8A 4MI3A 4BGEA 4R69A 1VG1A 4DN6A 1Y9AA 3MT8A 4NG5A 4TKLA 5L8VA 2FMTA 1AUQA 1ECCA 2HF9A 1YBFA 2X42A 4MO9A 1N5OX 5LZ5A 3O8CA 3GNSA 4YJGB 4RACA 5LPNA 1XMOB 2A92A 1J23A 2OD9A 4AS3A 3I4CA 1T0HB 3IOYA 3N0XA 2HK8A 5JJCA 3V7WA 3K0AA 2Y68A 1N8NA 1S7CA 2BKUA 3BDIA 2ADMA 4ZQFA 4FCVA 4KYIB 4DA7A 3I64A 3GVPA 5EWJB 5EXDA 3SQNA 4QM7A 4DC9A 2J09A 3PEVA 5AJVB 1XJ0A 1DJLA 3T61A 4JJ8A 4KMMA 1GT6A 4F7WA 4HMPA 5IZ4A 1M2OB 3E9QA 2O2DA 3EVCA 4N5IX 1YZNA 2AIRA 4Q4AA 4TVKA 3UENA 4E0BA 4NSNA 2VDVE 3QBTA 2Q0HA 3WQQA 3SPXA 4HAXA 1OPRA 1WG8A 2WNSA 3AYXB 3BDVA 4BVHA 4YAIA 3VR4A 4ND8A 3KDSE 2ATVA 1S8NA 4WVFA 4B17A 2C97A 2W0SA 2EW2A 3QG5A 1D2EA 1G8HA 3QM1A 3R0QA 4P0QB 3DC7A 3E2MA 4UTXA 5CT6A 3RVDA 5LQUA 2FX5A 2ZANA 5I7FA 5TF4A 1CY6A 2Q21A 4YAOA 3SKYA 2QIOA 5CNKA 1DADA 3HZOA 4X8MA 5EA2A 2YRWA 3AW9A 3K0HA 6ABPA 4AJPA 5SYNA 1EVZA 2C2GA 1HDCA 3WAJA 1SURA 5FBWB 3ZQUA 3IHTA 3FVVA 3NRCA 3DCYA 3WSWA 1USGA 4WBSA 2ABWA 1LLQA 2QDXA 1GKUB 1ZSYA 3CT6A 3M6IA 3OZSA 3HNOA 1ZLXA 3FUXA 3P9QA 3BGSA 4AZSA 4COOA 1W8DA 3H5RA 2HTFA 3MAGA 5DHRA 2Q1WA 1MEJA 3PFNA 4GDMA 4OQ4A 2I66A 3H2GA 1CYDA 4DR1B 4YRCA 3X2SA 1JG1A 2WU3A 4I0WB 4R5HA 3O31A 2JAQA 3CUKA 2C03A 4NBRA 2PH5A 1JEOA 3M49A 5HILA 1LJUA 2A33A 2ID8A 2PY6A 4QDUA 3Q5EA 4Y2SA 5L7TA 1AKUA 4RL6A 4XGRA 2WSSA 4CMEC 2XB4A 3SMVA 1EZ1A 4KHZA 3VBEA 1IHYA 2XQFA 3PITA 4V03A 3O47A 3BF8A 1P7CA 3DE5X 3H1FA 1UKCA 3EARA 4QU9A 1L5ZA 3WG9A 2B1GA 3NP7A 1RWMA 3G8AA 2FPXA 4LC0A 4LNHA 4RTSA 1K88A 5DLEA 3FVQA 1Y9EA 3K4PA 2EF1A 3F3MA 5LP6C 4ARCA 2OUKA 4G25A 1Z2EA 1P9LA 3QU4A 1XEWX 4N5MA 4RDCA 1DPGA 4P2GA 4TYQA 2PT7A 2FOXA 1U0SY 1PR9A 2HTEA 4H3HB 4NOJA 1P80A 1V1MB 1EJ0A 1S1MA 2M2IA 3C8MA 4GBMA 4S1PA 5I3ZA 1UBCA 4LJRA 1Z5UA 2QJRA 4IQFA 5ALUA 2J3LA 2BSQA 4O4LF 1BH2A 2GDZA 1M34B 1MORA 4YCLA 2YHBA 3CO5A 4GLFA 1U1FA 1XXHE 5HM6A 4GMKA 1E3MA 2BZSA 2CLIB 3LZDA 3QPAA 2PCLA 2WRZA 2IPMA 4XPIA 1G0OA 3HVHA 2BFCA 3NT4A 4AJHA 4D3XA 3ZPXA 1GNVA 4ND2A 2X4DA 4XVCA 1Q1GA 3WDKA 1GNQA 1E7QA 2DSTA 5LYJB 2G9NA 4XVUA 2P9JA 5AOVA 4AUMA 4BLPA 4CG1A 1PG5A 1EE9A 4Z0PA 3A6KA 4PINA 3JX9A 4U2GA 1BQ3A 1L7EA 4F85A 1SU8A 3C7TA 4AP6A 2UUAB 3AR8A 1QP8A 1QB7A 3IH5A 3ZJ5A 4B32A 4EFKA 4LRSB 4O5OA 1QYDA 4F84A 4OQQA 5CPBA 2VUTA 5K0FA 2PPVA 3KJEA 1JR3E 4MW4A 5JD4A 4HWSA 5F5XA 1T9ZA 4RPIA 3FLMA 3L4KA 1LNZA 4OXXA 2QSZA 3SHOA 1B74A 4PSVA 2R4UA 2WLTA 4HPXB 1R8YA 4FLFA 1HE8B 4A7PA 2HF7A 5JS1A 5KNCD 3MS7A 2PTHA 2ZGVA 3FGZA 4EHHA 1UC9A 2BUAA 3BQMB 3H5TA 5D3ZA 4X8OA 1MB4A 4IJUA 1NWHA 4PICA 1MVNA 4X63A 3UAOA 1RMYA 1XD8A 4B6QA 2P9HA 4C04A 4IZ6A 2A9RA 2L19A 1U7TA 4FKBA 4D8WA 1L7QA 2CZCA 2I6TA 5FPPA 1BJKA 1AGNA 3PXBA 4ZYTA 4P86A 1O97C 4U39A 1V1RA 1GNLA 2BIFA 3SDBA 4W82A 1O4VA 2ZUWA 1KH3A 4U6SA 4IDOA 4BKUA 5A4KA 2PV0A 3UT0A 5F5NA 3PYXA 4PNZA 4P92A 1JMYA 5ISMA 1C4KA 1ACJA 1GNSA 3IUMA 3B5JA 4E7PA 1I7SB 1B41A 2GO7A 2O57A 3ISTA 5IAOA 2B8NA 5MGNA 4A10A 2EZ4A 1KZ4A 4HNQA 2R68A 2ZIXB 3DE6X 4RV4A 4D9MA 2QX6A 4LISA 4YJ3A 4C89A 3OFKA 4I2VA 3IJPA 1JAHA 4W1QA 4RZ2A 3IJ5A 3IYLW 1QGOA 1T0IA 2Z4SA 3ZUPA 4FN5A 4PC1A 4KR3A 4F86A 5EVJA 1V7ZA 3USES 4A82A 1A5ZA 5C4IA 5JALA 3O1JC 2XXAA 1PS9A 2VUIB 1Z83A 2ZI3A 4TRJA 2JBHA 1H4QA 2BVNA 2NVUB 1LPPA 2DWQA 3SQDA 5CA0F 2R79A 1UPTA 5JJLA 3D6JA 2O2JA 5LZ9A 2MSLA 3WXMA 1GEGA 1J2TA 1MAWA 5JDCC 1Z5VA 1A9TA 3PC8C 1PFGA 4DCSA 4RM3A 3AF5A 4JLJA 1QGUA 2C83A 3QBVA 1H8HD 3LT2A 4IEEA 2QX8A 4XWAA 3AEKB 4WBNB 3Q0IA 5FV4A 1N8KA 4R6XA 4L8LA 4R31A 1ZINA 1N57A 4LHVA 2C9CA 2X58A 2CXHA 3UKOA 5U1PA 4DR6B 1K7XB 2NAFA 2WK1A 3PQ3A 4ZICA 5JZ9A 4INOA 2IOYA 2JHAA 4R1QA 1C1XB 3I23A 2BZ0A 1A04A 3OLWA 5TDHA 4C0JA 3I9MA 4US2R 2Z83A 3Q6NA 4JLNA 3KSBC 1A9ZA 2IH5A 1IBRA 3SF8A 1MO4A 4Y2VA 4HNTA 2ZVDA 2A2ZA 2GF9A 4EGFA 3E70C 1HZJA 1GQ2A 3RFFA 1UK6A 1B6SA 4EYEA 1NVBA 2C61A 2HA2A 2X2FA 4NABA 3OEYA 1XVTA 5EOVA 2GFIA 3EIQA 3I0ZA 3SD7A 4Z2AA 4WI1A 1WIWA 1BKSB 1NXXA 3FRHA 4GKJB 4FZ5A 4LBYA 3WGYA 1QOPB 5FLKA 4BGDA 5D3MB 4MKXA 3W9YA 1BS1A 2AF3C 3KBBA 2AFRA 4NC9A 2BSAA 4B3IA 4DG5A 3LL4A 2QLJA 4WN9B 3CF6R 3FMIA 3O93A 4BBZA 2GRUA 3ICCA 3O3OB 3RHZA 4KO3S 3MQ4A 5A9RA 1S0UA 5ER6A 1PKEA 1JEJA 2WHPA 4PVCA 2ORWA 2PZ8A 2YBEA 5KBYA 3GDOA 1I0ZA 3SQLA 1RWVA 1ZD9A 2C3UA 4D8VA 4EH1A 1LLDA 2GF0A 3L9XA 3OTQA 1PNOA 1G8KA 5ED0A 3O4RA 5ADVA 1QU2A 2N42A 4ZGGA 3IVXA 1VCMA 4MWGA 1YS1X 1W87A 3JQ7B 1M7GA 3M9XA 1NUUA 2GZDA 2NNWB 5E6SB 5LP6B 1XCGB 4XFKA 1XKQA 3NBKA 3IMCA 4NENB 2QD1A 2IDJA 2WIDA 4UXHA 1GADO 3IQFA 2DKNA 1KYZA 1M2KA 4Q1BA 1GNPA 1NVTA 3K0FB 3TQSA 2A5FA 5EUQB 2H00A 4RVDA 4CHTA 1YACA 3DVRX 3BKWA 4FZ3A 4JFAA 4LMPA 3TDNA 2AOUA 2P67A 3WLKX 4D56A 5IUJC 1Z8HA 4N48A 1JR6A 3T95A 1BO6A 4H15A 3Q3VA 1F20A 3TVYA 2IHNA 4GYJA 5DF1A 1OBOA 4C2TA 3EXHC 1NXTA 1QGED 1RI5A 2P5TB 2Q6IA 4E14A 4CMIA 2YUTA 3GVIA 3U9LA 3RK4A 3FNGA 2B98A 5BNIA 2FPIA 2NP7A 1XQYA 3BICA 2OQIA 1SVLA 5A4FS 2WWGA 1NAHA 4V0OA 1U2GC 1HBJA 2XDAA 2YXNA 3JU3A 3IAM1 1UP6A 4ZANA 4P3KA 1V7PC 3VDXA 1TEHA 1R0CA 4CUKA 5CB4A 5E4JA 2OHOA 1L7PA 2J45A 2O8CB 2FQYA 2E5FA 1H6BA 1T2DA 4R98A 3E53A 2XLBA 3AINA 2GAJA 5AW2A 1OZHA 3QH4A 4MQ5A 5KTYA 2H7YA 1U94A 2Q2WA 1MB2A 2AN1A 4KRXA 5TQJA 1A82A 4MRMB 3CLTD 1CRWG 3RG8A 2WUFA 2P1ZA 3EGXA 3U31A 3ONDA 1G5IA 2EOAA 2EX1A 4R16A 4IKPA 3L7YA 3I62A 3SU8A 3B48A 3SNKA 5TSDA 3SOZA 1DC8A 1RLOA 3V46A 2PUTA 4U2KA 3LYHA 1LZKA 1PT7A 1WOYA 3Q2IA 4UC0A 1L5VA 3T52A 4KVGA 4P82A 3UK2A 3S2SA 1JEQA 5KYWA 1ZW6A 2QUJA 5JADA 4D45A 5CVEA 2R1VA 2IV3A 3GRZA 5J47A 2K4MA 3ZOKA 3K7EA 2IT1A 1SBIA 3I6IA 4J0CA 5AUPB 3U81A 1V16B 4JI1B 4EPWA 1KXZA 5L45A 3WIBA 2BISA 2Y1CA 4GLBA 4HVTA 1ODSA 1EFAA 1QLJA 3M81A 3PKJA 4G0NA 4ENPA 3LWDA 4KXUA 2XA9A 4RFVA 2UZ0A 3BVPA 2FE1A 5I7RA 2I1VB 3EX7C 1T5SA 5K2MA 3PGA1 4DSNA 2PKEA 1RU3A 1XWWA 2QPOA 1R6XA 5EKUA 4AKSA 1IHPA 1PD1A 1RP1A 3BN3A 2PEZA 4GQBA 2GRAA 2H2HA 2D0OB 3ZZ1A 1W85A 1G3IA 1NMXA 3PXUA 1K08A 2CJWA 1ORWA 3FTCA 1ZLYA 3DOEA 5C8DA 2ZRMA 2V96A 3PNBA 4CWAA 4YDSA 4XWTA 4ZOBA 5DBEX 3LPMA 2PL3A 1C7RA 2H1IA 4TWJA 1KAQA 1E32A 4WXPA 1VJ5A 3M5DA 5BOVA 2AYZA 2O2EA 2ZATA 3G6KA 1J07A 3FWNA 2WJZB 1Y89A 1ODCA 1E2JA 4MCJA 3SI7A 5E9AA 5BWCA 3IL2A 2F64A 3TTTA 4U2BA 1PJSA 1YQGA 1TCUA 4KOEC 4NBNA 4RX1A 2ZUVA 1QR2A 1OFIA 3V1YA 4KPGA 2O2ZA 2ZU6A 5JS7A 2HW8A 4G9GA 4HUTA 1N6PA 4NJMA 1XTQA 1KZYC 1NKVA 4KXQA 3RNLA 5IAEA 3OG9A 5EEHA 3E18A 2OCBA 4FEEA 4N49A 3GVHA 4RPCA 2NXJA 4XLLA 4J0HA 2I6QA 4I3FA 3N70A 1NF3A 2OGTA 5KJEA 4A0RA 4K26A 3F6EX 1VL6A 4P7KA 5G40A 2HK7A 1Z08A 1SC4A 4BFXA 2IE0A 4IJKA 1G21A 5CBPA 1DARA 5FUXA 5BQ3A 1JJAA 3ZDFA 4KLZA 1SUDA 4V0MA 1P61B 4JH0A 3CT4A 1F5SA 2C57A 3EW9A 4EG1A 1LX6A 2V6MA 2JDID 2R8RA 1CUCA 4HDAA 3I04M 1BA3A 2CVOA 2FYTA 1G42A 2OD7A 4DRXB 2O8BB 1ST2A 5IC6A 3NHZA 4P6VF 3P0HA 4GR9A 3T38A 4AM8A 4CL8A 2MSDB 3HBFA 4LV5B 4AIRA 2YXDA 1CUHA 2QY9A 3R3XA 3HADA 4PANA 1VIVA 2YTZA 1YS2X 3M6VA 5GPBA 3GJ0A 4DUZB 2R44A 1ECLA 1AC5A 2JA1A 3EGWA 2O0MA 3QEMA 1HOTA 1QTIA 2AG0A 4LE0A 4QTXA 2OK8A 4F4IA 3BL5A 3OLVA 2G08A 3A1CA 3F1LA 4O02B 1ISHA 5DXJA 2OFPA 1OLOA 3KYCB 2JIZA 2P8SA 3OUZA 3S4YA 4RD2A 2C82A 4YRTA 5JVDB 1OREA 3SEQA 3KLNA 1LRKA 1X0XA 5IVKA 4FLMA 4HGPA 4WDRA 2ZW9A 3U44A 1Z5ZA 1QYWA 1UPUA 1WF6A 4OXKA 2K87A 3KKNA 2IHTA 3NNDA 4Q4JB 4RNCA 1IPFA 2OHXA 4AG3A 3H19A 1PL8A 5CM8B 3UV3A 4XZ3A 1UINA 3GCXA 3UJCA 1HDEA 1FMJA 1RM0A 1I9CA 2FFQA 1QBKC 5T7BA 2IX9A 3LE8A 2A9KA 1U1DA 1QPBA 3PXGA 2KSQA 2XQKA 2G63A 3VSCA 5CXQA 1XDBA 4D4HA 5KYYA 1UBMS 1R18A 4X7PA 1OLUB 1V5IA 1VBMA 2AC2A 4Y67A 2PWYA 1UEXC 1NJ6A 2B83A 5DYWA 4MMXB 2DBQA 2OB2A 3F46A 3ZHXA 3KXIA 2HWYA 4ZIRA 2X3UA 1OVGA 1XKTA 4GFDA 1NSTA 2IU3A 2E9SA 1IL0A 1ZQ1A 1WQ3A 4DJAA 4ZZ3A 3RQIA 1SCNE 3K6SA 2A4MA 2QYOA 2JI6A 5T4FA 1E6WA 1T9HA 5K6RA 1SA0A 3IPRA 3KCQA 4AF6A 1FUEA 4E5DA 1RQXA 2Q50A 5I5GA 4B6PA 4CR6A 1HSOA 1AMNA 3LOPA 2NUAB 2REQA 3KTAB 2A78A 1C7JA 1NG1A 4KFRA 3F96A 3O94A 1F06A 3RLFA 4MGHA 2BGTA 3UMGA 4GI3A 3JATA 4P4TA 1UFQA 3W6OA 1Y1SA 4CNBA 5KIAA 5FB3A 1OWMA 4AO8A 4BFSA 1KI7A 2ZJ7A 1MOQA 3DF7A 4HB4A 5JYDA 1TU3A 4Q7LA 1Z12A 3PD1A 5IJ0B 1P2DA 1QTRA 3M8KA 4JEUA 1VLJA 1BWSA 4NG4A 3V6MA 4AF7A 2EGGA 5ECYA 1KO4A 1XCBA 2BLNA 2RK6A 5K7SA 2YYAA 4TV8B 1DCKA 3Q8LA 3L92A 3UQZA 4DDKA 1JQBA 1OXKB 3MUFA 4JOBA 3ESXA 1S2OA 4O8CA 3P9YA 1QJCA 4Q9NA 2HHJA 4D79A 5LBTA 2ZKIA 1BKYA 1GPJA 3HA2A 2IDMA 5DV9A 1XRNA 1E4EB 3GUCA 3K9BA 3PUXA 1IQ0A 4LFBB 1V11A 2B99A 5JSQA 4RK1A 2PGJA 5KCZA 3RW9A 2FW0A 2JHFA 3CLRD 5BQ5A 3ESQA 1P0QA 3GJ3A 1HC7A 5C7IO 1E62A 1BQEA 3G2MA 3QUTA 4HZUB 1IM2A 3HDVA 5AKGA 5FL3A 3RBZA 4PN7A 3DZHA 3G5UA 3NHAA 4PX3A 4D9GA 3IOCA 3ZDAA 1GQFA 3PA8A 4N41A 2IS1A 2CNBA 1X92A 1ODJA 4ZOAA 4EUHA 2NACA 2X0JA 1BFDA 3C74A 3BB3A 3NW9A 5AFSA 3FSRA 4II7A 3OETA 1C4XA 1ABFA 1KI1A 3MPOA 4B5LA 2GXAA 4N12A 1JLHA 2UVDA 2Z2IA 5ALLA 1KERA 1NPYA 4YRGA 1VYVA 2QVGA 4O4IA 1NYQA 3IUPA 4Y7DA 3BIWA 3OQOA 5AHKA 3OZAA 4TKVA 4TXJA 1RHJA 3A1UA 3OD1A 4H7HA 3II6X 3H18A 4HDNA 4LOAA 3RKSA 1E8NA 2WEKA 3JWIA 4EPXA 4WK6A 5EFOA 3JYPA 1LDNA 3P26A 4UD2A 5B7GA 3QA3E 3UBTA 1VXOA 1DZIA 2B61A 3I37X 1MPTA 2B5VA 3ECSA 1R64A 5EZYF 3K8ZA 4IJ6A 5CEEA 4JMLA 1GA1A 2JA2A 4H6XA 4QFBA 2IU0A 3ROKA 1CRQA 5H4HA 1NAIA 2PHZA 1CB0A 2Q5HA 4JBLA 4JJIA 3GF4A 4NH4A 4B85A 4UU7A 1U04A 2YZGA 5BSUA 1FY2A 4Y2XA 5FKJA 1UPCA 2AHRA 4UTNA 2R7LA 4LYHA 4UEJA 3C3PA 2ZIAA 4PS0A 5H7XA 1M1ZA 1CQIA 4EB6A 3QLUC 1K3FA 3MEQA 4GSKA 1IVNA 3NU1A 4G84A 1N1EA 4L0CA 5FUBA 3EMDA 2RG7A 2Z2JA 4KW7A 3ZHVA 2R1ZA 1W73A 3S2UA 4A8TA 1Z56C 3BGDA 3VYUB 3PRJA 2AK3A 5JASA 5FUVA 4BOYA 4E3WA 2BP7A 2YZ7A 5EMLA 4O6VA 4BRSA 1ZHHA 2YFKA 4D8TA 3KAJA 4P7BA 1DL5A 2ZB7A 1T29A 1EEHA 2QM3A 3ZZMA 4O1MA 3UXEA 4GWGA 3WSVA 3LDAA 4IV0A 1F8GA 2Y76A 4Y2RA 2E48A 4F3YA 3JQRA 3HFRA 4M38A 4MRNA 4HFJA 1KBOA 2P5SA 3KV3O 5BSVA 3H84A 3TGWA 2EJUA 3FSGD 4I4NA 4DNXA 1FJ2A 2DQKA 4UQOA 2G7MC 2XUJA 3HBMA 4AJNA 1F51E 4L1KA 1MR3F 1TUGA 3BA6A 1F4LA 2JFOA 2Q5JA 4R0NA 3WGOA 2FN7A 1E3DA 1QIFA 2OO7A 1L6RA 2WYHA 4F9TA 4W9RA 1E1RD 4M3NA 5ESWA 3TZQA 1FP6A 2PGXA 1YFKA 2XWQA 4LYFA 4PZPA 3V8NA 5JY1A 1GZHB 2A1IA 2R5NA 3FAZA 1U9CA 1EP9A 2C0QA 3RARA 5TEWA 3HKDB 3SYTA 1DINA 3NTRA 4O4LA 4NEHB 4M1WA 4QICA 5KC9A 3JPYA 4FHDA 5TB5A 1NTOA 1G60A 4L78A 4FOLA 4P9NA 1Y9JA 3OUTA 3F6SA 2RJ3A 1S2GA 1EI9A 1HE5A 3IT2A 4PPNA 3SC2A 3Q5DA 4OU4A 9ABPA 1K66A 1GGFA 1H05A 4ZRDA 3S99A 1JLMA 3AY7A 5FWNA 2OZLB 1SBCA 1TK9A 3O1HB 4H7KA 4N5LA 1KXJA 4ML3A 4LSGA 4XVHA 2FSIA 4ZO4A 5DN6A 5DM2A 1R7RA 4UTRA 3NWBA 1Y6QA 1NN3A 3KOXA 3N53A 4V0SA 1PZNA 2W2LA 1JKIA 1ZD8A 5MF6A 4EARA 4YO7A 2C2KA 5KJ6A 2VDWB 1XCMA 3L7BA 1MJGM 2P4SA 3OF3A 3IMFA 2ZT5A 1XR3A 2QL6A 3A6FA 3DOFA 3FX2A 5ESRA 1RYNA 2VR1A 5KKAA 3SJBA 3O7WA 3VUFA 4NBUA 3FLEA 5FUQA 4CDRA 3QA9A 3T5PA 2CE7A 3MLBA 3U7QA 1DEAA 1Q6ZA 4FCWA 5FYDA 2VF2A 2X1MA 4G5OA 3PI6A 2R1TA 4YPVA 4MVCA 4Q39A 3FPKA 5EINA 4F3RA 3P1JA 4FCTA 4NBSA 3QBDA 3OIVA 4KXFB 5IYZF 3W5UA 4DIEA 1U65A 5C8XA 5J2TB 3I9JA 3O3NB 4H7PA 3RGGA 3HWSA 4BLQA 5BURA 4NOMA 2FGJA 2X14A 1Z6GA 4L6CA 5CP8A 2I4LA 4AJ9A 5BW5A 1F9AA 5KQRA 2V7QD 3HGTA 4V0QA 1HXHA 4PXSA 1ZA1A 4EA8A 1TC2A 3DMRA 2A5DA 4QC2A 1RBZA 4HDSB 1IRIA 3U3KA 4I55B 1U3UA 1OAOA 1L5QA 2PLRA 3CTPA 2X0NA 2JFXA 3HEAA 1Z22A 2P9BA 4URFA 1LLFA 3QXSA 4R8MA 3H4MA 1OTYA 2Q8NA 1WBDA 1YNSA 4X00A 3RASA 1Y4DE 3CUVA 3S2EA 3N8GA 5FBLB 1EP2B 2W83A 4F4JA 1QHSA 3LKZA 1E8MA 3MJTA 2R4QA 5ELXA 3EMBA 3L6CA 1II9A 2XXJA 5KOJA 4NVRA 2NO6A 3W9BA 1RWXA 3FR8A 2PAAA 3A9CA 3BK2A 2XCOA 3OZDA 2D13A 3HXLA 4IV5A 4JQOA 2J5KA 1EVYA 1P2SA 2JF0A 3TYXA 2GBFA 5KMGA 3LX4A 4MR8B 1AF7A 1CPYA 4H18A 4JU9A 2YINC 2BEVB 3E7FA 2HNKA 1GTZA 1O58A 1VMIA 1UT5A 3AFIA 1OPXA 4G5GA 2OZEA 3LLSA 3TXYA 4YRMA 4K86A 3DM5A 3QW4B 4M7OA 2L69A 1ESCA 1NJ8A 2V6GA 4OXIA 1WLYA 4I1RA 4ZA2A 4CKEB 1LV8A 4E5MA 1BKDR 3CXRA 2VK8A 1XZKA 4FMBB 4N3BA 1E2IA 4QQFA 3IIIA 1UBRS 1FFEA 2P9GA 3B2QA 5EXTA 5LDGA 3OH8A 2OHJA 3I9KA 4QLBA 1JDJA 2O9JA 4OK3A 4ACAA 3NRBA 4E2WA 4YAFA 4EYKA 3PTLA 4HLQB 2P4QA 3PFBA 1UMKA 4D4JA 4KWCA 1I2MA 2HLDD 2R25B 4F4DA 2HPZA 2CLCX 4PTYA 3BX1A 5AVQA 4Q3EA 1CJCA 1BXGA 1E0KA 3RKRA 3V4SA 1VKJA 3MIIA 2WTNA 4IDQA 2CDNA 1Q0LA 3TM4A 2BBSA 1DHRA 1H4VB 1N5RA 3A9UA 4R9SA 2XRMA 1F3OA 1FQKA 1TM4E 1HLPA 1CUVA 1WU8A 2GPYA 5K4AA 3RS9A 4YYZA 3UT5B 5B30A 1BZYA 2EJTA 1LK5A 2WJPA 3A28A 3WLIA 1VHWA 3HZRA 2OGZA 1NJ2A 3KXPA 2CFCA 1DIBA 2JPDA 3F7NA 3INNA 4G89A 4FXOA 4GAEA 4QAQA 2O5RA 4XH9B 3W5SA 3TXAA 1NJGA 1NKSA 1Z18A 2QUZA 2WT4A 2PNJA 2Z6UA 4G1BA 1A8HA 4CM8B 3CZQA 1K9SA 2YYZA 1KORA 3QHAA 2X15A 2VN8A 1O3YA 2OXIA 1NI4B 2W22A 3GV0A 4Y2YA 4MPJA 3OKPA 3UYLA 1CG6A 1JHYA 3OKAA 5HA5A 1LWNA 4D80A 2W2KA 4G26A 1L7VC 3WBBA 1Y6GA 3CISA 3COYA 4FEGA 4YWHA 2NO4A 3F7MA 3G9ZA 3PX3A 1KEWA 3WV4A 2WSYB 4ZCIA 2XYQA 4GP9A 4MEBA 1N9GB 1M6HA 3QPBA 4M7WA 4X54A 2AQHA 4B8WA 5J63A 4FB4A 4JLOA 1F0KA 1HPLA 4PEVA 1G55A 3RRMA 2GHQA 2R1UA 1C9DB 4WKOA 5LB2A 3UJNA 3G2JA 1AGXA 4TKUB 4FJ0A 4DQUA 5K8CA 2XOEA 2W2NA 4F6RB 2P79A 3BL8A 1PK8A 3EVAA 3I5UA 1EWRA 2DPGA 2E4XA 4AI6A 1OAKA 3DJYA 3T7SA 3B89A 3BZBA 5K3FB 5KWJA 2G06A 2PX3A 2J41A 3A26A 3TRDA 4DWWA 3RS7A 5JAPA 4OB6A 3GLHA 4BCBA 2F1IA 1SQ0A 3I76A 3LY7A 2PL1A 3Q41A 4Q02A 4DSTA 3QX3A 2AXEA 3U1VA 1W0JD 3HBLA 4P54A 1WO8A 4LTDA 4M8LA 1NVVR 5BNWA 2C4UA 5ANRB 2X0KA 4QGSA 4KQIA 4FNGA 4F2HA 1KRWA 4B3MB 4KIFA 4XYBA 3LTEA 5BO5A 2C7PA 3CJRA 4IUDS 4I81A 2HSDA 2VAPA 1KL7A 1NX6A 2INGX 2J8ZA 1G2IA 2JW5A 2ODAA 3HB5X 3L7CA 3MLEA 1I6MA 3EN0A 1S8FA 3I42A 1SCUA 2XQVA 4NMXB 3C3BA 3JRNA 2VYFA 1MQ8B 4WZZA 2OLEA 4G23A 4EEXA 5CH8A 1ZUNA 4OQPA 2BONA 4BO5A 3DPIA 3A3KA 1ZNXA 2FOIA 2Z04A 3KPJA 4KCGA 5GONF 3TE7A 2HEIA 1JKJB 2M6RA 2QX9A 1ZPDA 1JQDA 4US1R 1JL3A 2FZWA 4Q19A 16PKA 2IU4A 3CZCA 3O8QB 1V4NA 1XD2B 2XUDA 3TTWA 3IVMA 2Z1DA 2ODPA 2OB1A 3ZGOA 1TTPB 2VP4A 3AZOA 1YCHA 4OQMA 2W6ID 4F8EA 3OU7A 3PFIA 3QEOA 4U1RA 1Q0ZA 3EEIA 3ESDA 4CEJB 2E7ZA 3BRQA 3PE6A 2J3HA 2EHJA 4OQYA 4Y6GB 1UIRA 1ZK0A 3E35A 3TCKA 2I2AA 5BP7A 5KWEA 5LP1A 3HCFA 2Q1TA 4B79A 4EYGA 1XP8A 2P4UA 5JXGA 2QPLA 5F21A 1H2ZA 5HZHA 4O5AA 4IILA 1EUZA 4ZYWA 1ZG3A 1X9IA 2Q5FA 5AJZA 1ATIA 4UOQA 2GETA 1Q3KA 3DTNA 3GRKA 4EVIA 5CB6A 1UPXA 2DJIA 3DXFA 4CLEA 2QQEA 1UMDA 3K0AB 3WSTA 1JA0A 2BBOA 2BGUA 1FFBA 3D4LA 2CL0X 4M0LA 5KNDH 4L9SA 4DCJA 3IE0A 5FEUA 3D4IA 3JARA 5KTKA 1K63A 1TMGE 2C2YA 2H51A 5CURA 1V9CA 3A1SA 4Q4AB 3S2IA 3AMVA 4L5AA 2PRJA 5TMBA 4FFSA 4BTEA 3ZDYB 4ILKA 4MYTA 4BE4A 2D1QA 3GFFA 3AUAA 1BCSA 3ZIDA 3RRNA 4K28A 3AGPA 4JITA 4MKIA 4ZC1A 4KXWA 4EPYA 1VE6A 2IY8A 3R76A 1JAXA 2JI8A 3E03A 3AILA 5KREA 1YDGA 4HDRA 3BILA 1PLKA 1NVXQ 2QNBA 3ICWA 4NU0A 1VMEA 3B1ZA 3DOCA 1QO0A 3KALA 1JR3D 1ZS9A 4G0PA 2W4MA 3AVPA 1TB4A 1TU4A 2QTFA 3DTYA 1TCCA 4MHOA 1N77A 2XAAA 1G9XA 1M75A 1PWHA 4BLUA 2Y77A 3FY4A 2OYCA 1B8PA 1EK2A 1RYBA 1XPRA 2YS6A 2CF6A 2ES4A 3RRYA 1TTHA 3ZTTA 3OTOB 3QG1A 4M87A 1IHXA 1NBOA 1P6UA 1I24A 2L0XA 1YO6A 1S9HA 3THWA 4UJ5A 5IJWA 3GO4A 4YRRA 3PDWA 1Z25A 4MKRA 4B7AA 4NJOA 2V7TA 3NRJA 4LJKA 2OGWA 3HEMA 4K9RA 4QPDA 4EGSA 2VYNA 3UT6A 3S0JA 2OFFA 2O1XA 4BMOB 3IHWA 1KMNA 4URXR 1WPGA 5ERYA 1P2BA 2A0FA 2GD6A 3EVBA 4JC4A 3WWCA 1DDIA 1X1QA 3HI4A 1G20A 4KR9A 3RS0A 1Z5OA 1O2DA 1XNQB 3HSSA 4IM7A 2YJGA 1ZXXA 3MK31 2Z58A 3PU6A 4LZNA 5KQMA 4OB7A 3QOXA 3LHDA 2ECQA 2YCBA 1GAEO 2FPKA 3IO5A 3IV7A 1ZUWA 3B6EA 1M2GA 4C0HA 1BS2A 3KXDA 5EEGA 1FFAA 3U13A 1WTCA 2XVMA 4KQGA 3LIPA 3DXZA 3U1BA 2XUQA 1YU9A 3NTOA 2XPCA 1PTKA 4JJFA 3LHFA 3VNSA 5L7WA 1WVMA 3SYMA 2JGLA 5EJ5A 2Z3WA 4F2WA 2Z3ZA 4OSOA 3HCWA 4UARA 4W5QA 1QS0A 4WASA 2EP5A 1EWKA 1M33A 2JGMA 3OP4A 2QY6A 3QWHA 4RJ2A 5DXFA 1JHQA 4Y18A 3T4UA 1B2RA 5DSXA 5GWXA 2E6UX 3HVUA 4IS2A 2GZ3A 4NV3A 1IOVA 1E20A 1HF3A 1H2BA 3BXHA 3VNBA 6NULA 5KSWB 2O8FA 1E18A 2BFCB 3N0RA 4JYPA 3S28A 2TECE 3KJXA 3DKPA 1BHO1 3L8FA 2H4WA 2QG4A 1D9ZA 2HXSA 4QQRA 3TZEA 4LJLA 4LK3A 5JG7A 4AT1A 4D3SA 2DT5A 4CIDA 4EIWA 3WGTA 2C42A 1MDBA 4RH3A 4Q16A 2XGJA 4WKCA 4ZQCB 2LCQA 4RQUA 4XIFA 1M1YE 1YA8A 2WQ7A 2NYUA