5EKTA

Crystal structure of mutant-k146a of peptidyl-trna hydrolase from vibrio cholerae at 1.63a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
197
structure length
196
Chain Sequence
b'MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHADKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of mutant-K146A of peptidyl-tRNA hydrolase from Vibrio cholerae at 1.63A resolution.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
total genus 63
structure length 196
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ektA00
3KK0A 4FNOA 2LGJA 3TCNA 5IVPA 1RYMA 4DHWA 4HOYA 3NEAA 4ERXA 3TD6A 4JWKA 4YLYA 2MJLA 3OFVA 1RYNA 4IKOA 4JC4A 4JX9A 3V2IA 5B6JA 2Z2KA 4DJJA 3VJRA 4QT4A 4JY7A 4Z86A 4QD3A 5EKTA 4QAJA 3TCKA 4FOTA 3TD2A 2PTHA 1RYBA 4FYJA 4LWQA 4FOPA 4ZXPA 2Z2IA 2Z2JA 5IMBA 3P2JA 2JRCA 2NAFA 4QBKA 4OLJA 3KJZA 4P7BA 5IKEA
chains in the Genus database with same CATH superfamily
2XUZA 2YJ6A 1GA6A 1Z5ZA 3NIWA 3PKJA 1AS2A 3DZHA 1D6MA 1ML4A 2O0HA 5FWYA 1ZSVA 5K0TA 3GVCA 4P3YA 2IKQA 2ZTUA 2QOEA 3OI7A 3RIEA 4CIVA 1F9EA 4ZVUA 1V35A 2ONKA 3W2EA 2ZZNA 1VJGA 1E1RD 2Q6LA 3I2FA 3JSXA 2C59A 3NH6A 3ND8A 2WDPA 4NESA 2QQ0A 4DCPA 1NUSA 4D9FA 5JJKA 3JTEA 1BOFA 1XAHA 1U04A 4Q9JA 1ODIA 4FJ0A 2GRUA 3WK5A 2AYZA 4KRYA 1DP4A 1KBZA 4S1TA 1YOVB 2XNDA 4AG6A 4OX9Y 4JUFA 2ZSDA 4JB3A 3K1AB 2OO5C 2B3DA 2POQX 4DLUA 4WPGA 3FSEA 5K20A 4WJKB 2PWPA 1SIUA 3FLBA 1GY8A 4UEKA 4JYBA 1LTHR 1JEJA 5TVKA 3R7SA 4B71A 5K0BA 3C6QA 4QXPA 3VBCA 1EEXB 1Q20A 1MEJA 2VYND 2PVCA 2IDJA 4TSRA 4OXXA 4OP3A 4CMJA 2J7KA 3H42B 1L7OA 2FX5A 3H2JA 4FI3C 4QGHA 1FYFA 2FSVA 3A2MA 4LUCA 2N0SA 3A1UA 1TEXA 1IRXA 4RMGA 5FXMA 3RUAA 3BB3A 1XBTA 2ISSD 4QDXA 5NLLA 5AVRA 2BYTA 3VJRA 5F9FA 1VYHA 4S0XA 5DWDA 3HA5A 1ZPDA 3S2GA 1QE0A 3FPHA 1JH9A 1H05A 1R0ZA 1KKMA 5DV9A 5TPWA 2LCIA 3ZX5A 1BD4A 3K70D 2R8EA 5IT0A 4R8KA 4Y2TA 2JLZA 1B8OA 2ZSEA 1TLTA 3PZBA 1MX5A 3A10A 2A94A 1XMSA 4QIHA 2M6KA 4G89A 2VRCD 4ME6A 1Z13A 5COAA 2IHBA 4FR5A 1Y6FA 3SVLA 1EUCA 2ZIAA 1PJSA 2HMTA 3GCXA 1K89A 2RONA 1OB5A 5K8VA 3PHCA 3ZDFA 4F4DA 1KI6B 2X2OA 3KTDA 1UF9A 2OCPA 3MUOA 5H16A 1ZMRA 3K0AA 5G1OA 4BE4A 2YRWA 3V4RA 4HGNA 2R66A 4KTVE 3HSYA 1G8YA 2MR6A 2Y9PB 3D5TA 3AHHA 5CK5A 5AHRA 4FGUA 2NADA 4P7GA 4CLXA 4AT1A 3NXKA 5P8WA 4EVIA 2C9MA 3DVQX 5I7OA 2HBZA 4FFBB 1PJ3A 4CUZA 3B1KA 4XX0B 3NHLA 3DL0A 4Q3AA 1B26A 2AFIB 2WUGA 4IWYA 5BUSA 1JWLA 2YYZA 4KLRA 3CF4A 2OE2A 1V3UA 1QLWA 4FIDA 4M1TA 2HWUA 1VZ2A 3K31A 4KQFA 5AVUA 3LYLA 1XJCA 2QTHA 4WWHA 4BAZA 5SYAA 1T3SA 5MHTA 3R8CA 3KZKA 4K87A 4CV0A 2QR3A 3ZZMA 3AOGA 4G8DA 1CHDA 1FDTA 3UMFA 4HFJA 1NN1A 1I3LA 2IUYA 3H1AA 5AW5A 5ICSA 1NLMA 2QGNA 1W47A 3ZWDA 3AW8A 4O1HA 4U5QA 4HQ6A 4LOHA 5KQSA 4D98A 3RGGA 3V6LA 1UPFA 3LLMA 1F8GA 2FWJA 4NCHA 1Q0ZA 1BRMA 3ONNA 3TNLA 1SCIA 1V16A 3MXTA 3A1NA 1A95A 4LISA 1WV1A 1V4BA 4D7AA 1E2GA 2BZSA 1Q0UA 1NTRA 1GRVA 1WXGA 4TMTA 1D4OA 1MF7A 5GPBA 3QNMA 2OILA 1USUA 4JT9A 3TOZA 1UCFA 2WFAA 3KC2A 2G70A 3PRYA 2B2CA 1VHJA 3AM1A 3JD1A 1GXSA 2R4UA 3W5UA 1PFYA 1GL9B 2P2LA 2XNHA 5A05A 2UVQA 2QVXX 2YFKA 2WM9B 3V2IA 1J49A 5F7OA 4B44A 5KWJA 2ZUSA 2I3AA 2O4UX 1TPZA 3HM9A 1VECA 1NR5A 3FHTA 4ZTBA 2ALJA 3RYTC 3H1GA 1AJEA 1UK6A 3BCRA 3MAAC 4N0QA 4TRNA 4XUCA 4LSWA 1C9JA 4W1RA 1ADBA 4M9CA 4MULA 2R7AA 3I45A 1ZK1A 5IMBA 3SZGA 1U98A 3AQIA 2ZRLA 3U4MA 1D6NA 1TVMA 2CC2A 5CDTA 3HKBB 5LCXA 3GLGE 1T8RA 3T7TA 2BHLA 2JFYA 5HQ3A 1HE3A 5E9QA 4KRFA 1WPXA 3EPHA 5G1NA 2NUAA 4AMVA 1XA3A 4GBED 3DO6A 3VR1A 3FUWA 4N01A 4GF5A 2WHRA 3EY9A 3G2JA 3C15C 3VPHA 1BFDA 1TZ2A 2R0QC 1IXYA 2ACEA 4WBNB 2WU0A 4FYWA 5TB5A 1PK9A 3BIFA 4A0RA 5H8WA 3ZCQA 4BVHA 3Q0IA 4RNCA 1W7AA 2YOHA 1D0IA 4JYPA 4CNQA 1C8KA 4TTAA 4UVDA 1L8XA 4C7OA 4AY3A 1R00A 2CT8A 5FOUA 4L5CA 1GSHA 5GONF 5U4QA 1V3QE 3VTAA 4D8YA 4DJ5X 1XMXA 1EDEA 3B6JA 4NC9A 5EMHA 5EYPB 2D6FA 5MN5A 4UBOA 1CEEA 3N2KB 1M1YA 1ZAYA 2EBFX 1EWYA 16PKA 3BDAA 4JWKA 3D3WB 4S1NA 2WT4A 2GF2A 3CUKA 4RO0A 1PR3A 1E77A 4QXAA 3WLMA 4ZI7A 2UV8A 3CGGA 3IESA 1LX7A 4B3XA 4C4YA 3UHPA 3PGMA 3FOCA 5KCZA 3IMKA 5J2UA 1RYDA 4UOEA 1N7JA 3NTUA 1WV0A 3V2UA 3LHKA 3C70A 1W0JD 5L3RA 3W7AA 4CQMA 5BQOA 4CR7A 4YYZA 2IYAA 1G5QA 3MQ4A 3O4FA 5FTNA 2CWWA 2ZZKA 2NUBA 2E4XA 4RC9A 1SXQA 2BDTA 2P3LA 3WYBA 2ZUFA 4TM7A 4B6EA 2FKNA 2FG5A 1NVMB 1G6HA 1M75A 2CFSA 1I14A 1ZZEA 3MWEA 3FOEC 1C0EA 2CLMB 4RQUA 1XRQA 3M6WA 4FYMA 1DMRA 1IEQA 2DFPA 3WLLA 3PKZA 1A9YA 4ZYYA 1AH2A 4R2XA 2QT1A 4YHBA 3QVKA 4R01A 2OYRA 1QQ5A 1Z4NA 3EH2A 5FB3A 5AVZA 3OZVA 4FGJA 3TE7A 2Q07A 4A6XA 4TMYA 2DPLA 4Q21A 3CLTC 1Q1GA 2AB0A 5CVCA 4EKEA 4IIHA 4YRIA 4NXMB 1EBFA 3KYIB 1FXWA 2ZIXA 1TECE 2ABWA 4C7JA 1I7SB 4OYHA 4ID3A 5HUQA 4MVJG 4NI5A 3H4VA 4CM9A 4Z4GA 5K3OA 1ZRSA 2QPLA 3OQHA 4QUAA 4K7JA 3RODA 3SIRA 1Y82A 3LT1A 3ENKA 3ITEA 4FHCA 1ONSA 2AOXA 4TMFA 4EI2A 3ESRA 3D2AA 4IIDA 3U9TA 2Y2VA 4P38A 4EF4A 1X7YA 1GG5A 5CBPA 5T41A 2ZS9A 2GPJA 2VSXA 4GQBA 3JQEA 4QGBA 3LNCA 2EZ8A 4WEOA 5JY6A 1KGSA 1JJFA 5DEOA 1NI5A 1UEIA 1VE6A 3OZFA 3QXCA 5D3MB 4F5EA 5I4KA 1Z5OA 4GKJB 5CEFA 3G8DA 1Z29A 3A37A 3P4YA 3QA9A 1RM0A 3RRJA 3RIXA 4KYUA 3E7DA 1KPIA 4ZYZA 4YVFA 1FK8A 4NBUA 1HLPA 3ESCA 1RQ7A 3PQFA 4LNHA 5I3CA 2DAPA 4P83A 4TYPA 2QK4A 1CJVC 1NQ5A 5AK0A 1QJ4A 4ALNA 5BVHB 4ADSG 5LMCA 2IBMA 3RT7A 1IXRC 4FMDF 1V3VA 2QJOA 4U2BA 3RYHB 2R1TB 3UWKA 2ZRQA 5HCNA 1E3WB 1JX6A 2W48A 5FTWA 1VMEA 3HGMA 3Q8WA 1O6BA 4MR8B 2OVBA 3BMNA 4X6LA 1CF4A 2DP4E 4KWHA 1GTMA 3R0VA 3WLJA 3TAUA 4IHJB 4HWGA 2ACWA 3EFOA 1ESZA 2Z2YA 2H4FA 3QYFA 4GG1A 2C2WA 4CDMA 1EE9A 4XUGB 2VP2A 1JAHA 2QR2A 3ZQ4A 4UUMA 3KDAA 4NBRA 3AFIA 3E0QA 3RS0A 1N6KA 2DPGA 4A92A 2VDOB 1C7FA 3B36A 3TLCA 1B2LA 1JMYA 5MDHA 3NEYA 4M7OA 4CGZA 5G0WA 3ESDA 4E2XA 3B6MA 5JV5A 3T1TA 1Y81A 1SKAA 5TGZA 1KY2A 1W5SA 1WOMA 1NQAO 5TQ0A 4CIXA 5FPPA 3S81A 1ZWLA 4UVHA 1RI2A 4P5PA 3WHLA 1G0OA 3GJ3A 5B4VA 4XTRA 4P3XA 4MHTA 2NZYA 1KK0A 4DG8A 1M5UA 2O8CA 1IWBB 3LHIA 4Y1GA 1XZPA 1XLWA 4AUKA 3DOEA 2Y1LA 4G0MA 3IA2A 4OGGA 4ZMRA 4QOIA 1E96A 1ZRNA 1Q14A 3U4QB 5JZMA 2XMGA 4L5YA 3RFTA 3TZHA 3WL6A 1LK5A 5DBIA 1E32A 2PRSA 1TF7A 3LWZA 3F2VA 1BC5A 1VE5A 2PU5A 4LOKA 4TUYF 2VYQA 4EQ6A 2HPVA 4Y6PA 3HXMA 1ZNWA 1QRSA 3ZD8A 1J09A 2I87A 5FPTA 4YT2A 4QFMA 3FTEA 1DAGA 1MJGM 1NXWA 4E03A 4G36A 4BVEA 2XQIA 5K8IA 4UU7A 5EI5A 2J6CA 1F06A 1UT6A 1DO2A 2DLNA 2YY6A 2BAGA 3GJSA 4QATA 1E99A 2GA8A 4D2IA 2AGVA 4GUDA 2M1XA 1PEDA 4FHDA 3A4MA 2DFNA 1XI2A 2A88A 3ETCA 4MKXA 1CUZA 3NT5A 4E13A 1RWNA 3D81A 3QFHA 3S99A 3VDNB 3CLHA 1L5GB 2PR2A 1WBDA 3W04A 3VKGA 3MVEA 1YU6A 3QYPA 1QHHB 2R6CA 1A88A 3AFHA 2PMDA 4OD0A 1F6DA 1O6GA 2XMZA 3FPEA 4NWIA 1ETUA 3V00A 3ZDZB 4IUDS 5JPDA 3O84A 1D0SA 1NVTA 3TCXB 3CNNA 1VSTA 5F4BA 1BD3A 4MQEB 1EXVA 1BHO1 1WRBA 3AP2A 3DD5A 1HXHA 1TX4B 2OB2A 2CF6A 2QGZA 3QVSA 4RPIA 4FE7A 5TS3A 2QT9A 1TM3E 2RBKA 1TO6A 4B6PA 4KQIA 4N47A 1II0A 1V1MB 5KNDA 2DF8A 3KU1A 2GDJA 1IN1A 1C3JA 5DN6D 1DRKA 4DJJA 4GLBA 3UV7A 2UXCB 1RXIA 4CLRB 2OD9A 4R7GA 5GGXA 3VVBA 4YT4A 4KOEC 5DGXA 5TNXA 4C5BA 4IRMA 1I3OA 4WX2B 3TBFA 1QKJA 2A58A 3MS7A 3OMXA 3ERCA 4U7GA 3DOIA 5DHFA 1Y4UA 2QI9C 3IRUA 1CUYA 2CJYA 4G1MB 3PF8A 4MAAA 1Y5NA 3TO5A 4ZCIA 3AX6A 5AP9A 3VC3A 3IMFA 3QX9A 1UODA 5F33A 1YXMA 3MW8A 5KSOA 4ZOLA 5EXPA 1JHVA 3P97A 5AOBA 4GQIA 1T6ZA 3MRTA 1SIOA 1G59A 2P6MA 3GFBA 3C0KA 1YB1A 1E4YA 2P65A 2QAJA 2RH9B 2JHPA 4TWRA 4AJ2A 2WSLA 2UU9B 2BDUA 1H6CA 3DCYA 3USZA 5L7TA 3BKXA 2COEA 1CTQA 2R4TA 2CVQA 2PZ8A 5D3QA 2WTXA 4NMMA 1OYVA 4XPIA 5TY0A 3AKCA 2X86A 4P36A 4NZZA 1ANKA 3TDMA 4YCSA 4ZFNA 2Q3HA 3JQAB 1Z5VA 5CYGA 1RAGA 1ZYUA 4FGKA 4I99A 5E6SB 3HSKA 2BFPA 4BBPA 4A73A 1PJ2A 3W06A 1U6IA 1YI1A 2O52A 4B83A 1MPXA 2V3CC 5J58A 3DVSX 1FLNA 3H16A 2FQWA 4P3KA 4MI3A 5AK5A 3HNOA 5ITWA 1GZUA 1KEEA 1JJVA 1QJCA 4DGQA 3ZGNA 5HDBB 4X41A 3HQ4O 2FX2A 2RKWA 4UUPA 3ZNOA 4CM8B 1QDLB 3UJ6A 4QUJA 2XCRB 1C1HA 1DBRA 3ND6A 3M4NA 3OUZA 3PNMA 5TSDA 2GAAA 1P2SA 2VXOA 2PS9A 4J1QA 4NS1A 4A0FA 5BUZA 2GZ3A 5AW6A 3T9DA 3AYXB 4MA0A 1RMYA 3DDHA 4QNNA 3B6ZA 1G8AA 1E9VA 2FFJA 3IURA 4GZ3A 4B9EA 1YVEI 3F9CA 1NVVQ 4JHLA 4ZVVA 1YL7A 1UZNA 2GHIA 4DCTA 1DL5A 3EZLA 2PUJA 3DWGA 3FNIA 4DMUB 3FYCA 5KQPA 3INYA 1GPMA 4KRXA 1HETA 1KI1A 4MIKA 3WQSB 1ZUWA 3H17A 2CVFA 4XYGA 1PYOA 1M2FA 1O6FA 1E8DA 4WGFA 3DE7X 5ALPA 4D46A 5AVSA 1JYFA 2WG0A 4KSBA 2FR8A 5DRTA 1OH5A 5LQKA 1YZYA 1J2UA 1ESMA 1PZHA 3ZTTA 2RGNC 4N3NA 4KHZA 4XWKA 3DH0A 4WESB 1K92A 1WY5A 1ATIA 2IHJA 4OXNA 4LMAA 3BWYA 3C3XA 3K8OE 1TTPB 2XPCA 2VJMB 1JDUA 3HJHA 2OZLB 5A0FA 1K4KA 1UC8A 2G63A 5B2ZA 5EXDA 1DC5A 1SG6A 3L4SO 3STUA 4YUWA 4ARCA 4Y1RA 3LNTA 3CZAA 4RTSA 1Z8HA 2CFRA 3LOQA 1MB0A 4TYMA 1WA5A 4TZ0A 1ULAA 1ZMBA 2WLTA 3AM3A 3MLEA 3PENA 4NULA 5B7GA 1FVHA 2PUAA 1FTYA 2ZSJA 2R8XA 3DV0A 5CEEA 1Z3CA 4M0DA 1HTWA 1TC1A 4KN9S 4QICA 1GQOA 1T6YA 1C8VB 1FSZA 1YIOA 2R7NA 3LKZA 2D2IA 3PNSA 4F8YA 4UTVA 2VIIA 5FWYB 3OVMA 4DILA 1K6MA 3CZ9A 1QWOA 3NTXA 2NSDA 4EH1A 2Q3CA 4QXRA 1KNXA 4JL8A 4IIBA 1A1VA 1OUMA 2FEXA 3CCBA 2CMDA 3NHUA 4HNQA 3U3XA 2OHVA 4R69A 4RH1A 2ECQA 1EFLA 4IP0A 5IJXA 1VA4A 2QTTA 3TXXA 4EA7A 2UUOA 1P4GA 4KIJA 3SOZA 1Z0DA 4EITA 1CR4A 1KY5A 2ZPTX 3LX8A 4DGSA 4K9OA 4E5SA 3IHWA 4PN3A 3I61A 4I7EA 2H65A 2AMLA 1PDOA 3IUPA 4D9HA 2ONYA 3G0HA 2VHTA 1F4LA 3HCDA 4PGHA 3A6FA 1H1TA 3L4EA 2XB9A 4HYQA 3AYZB 2R6R1 4JROA 4J4HA 1N2OA 2QMZA 1E9EA 2XQGA 3ETGA 1CJTC 5I5EA 10MHA 2A0WA 4F2WA 4KXVA 4EQZA 3IUNA 3IUQA 2HJ9A 2SICE 4ZODA 2I4IA 2ZRDA 3UUGA 2AUNA 4RY9A 3WAKA 2J59A 4REQB 4ZDWA 3QXJA 4R8VA 4BEBA 4HX9A 4UBKA 3JV7A 1GQYA 1NUAA 5TPWB 5KAMA 4ZEOA 4F12A 2IYPA 2VAMA 2B69A 3FFWA 1I1QB 4ATNA 1KA9H 2AI2A 3LZCA 2PUCA 3VV2A 2JI8A 4OJNA 3BEDA 2BMVA 2OC4A 4KU4A 1QE5A 2PHZA 4QASA 1GTSA 2J3LA 2ZWIA 1DT5A 4QUGA 5L3QA 2WSSA 1YFKA 1W5EA 2PA0A 3PUVA 4QDJA 1EUCB 1YJ5A 4H35A 5DGTA 2HF7A 3ZHUA 2H08A 1L8OA 2WE7A 2P9EA 3E7XA 1Z8FA 3G2HA 4IKOA 5EIOA 5IJ0B 3BK1A 2V4UA 4ND1A 4MW5A 3K0AB 4R31A 5B4TA 3KZMA 2WK1A 3HVJA 1HG0A 3UB2A 3E3LA 4CTMA 2JVKA 4DDUA 3CRRA 1V8BA 2YHIA 4BQIA 1ZD3A 2WWYA 3PU6A 4LHZA 5CB8A 4AS1A 4AYXA 1UBMS 2HUPA 2AYXA 3QHAA 4B5KA 4RFSA 2QQFA 3DMTA 4G67A 1TMYA 1WUYA 2EX1A 3ZXUB 4UE6A 1YZVA 2ZJOA 3G9UA 4MK4A 1ZI8A 4M21A 4AL4A 2B7BA 3KQPA 4OI2A 1NNI1 2OZKA 1XE3A 1LLFA 2EQ5A 2PSEA 4E7OA 1UWKA 2EWMA 2IUTA 4D9KA 4MX8A 2A1UB 5FOQA 1VG0B 3HI4A 4Y2XA 2YNMC 4XEHA 4TXMA 1X7HA 5A4IS 1V7PC 5BSHA 4RZUA 1W1UA 2O2HA 4QLAA 3EXIA 1L7NA 1KZGB 3E5NA 3L7AA 2ZJ0A 2RGBA 1WBBA 4BVGA 1L3IA 2WOOA 2I5PO 2UXDB 4KQGA 4TSFD 3EODA 4PPYA 4O3MA 1COWA 4KPUA 1WZ2A 2VT3A 5H59A 1LBSA 2XLBA 1E7RA 1L5VA 1Y80A 2GHRA 4B2YA 4E4YA 5JUWA 1Q7BA 3KJFA 3UV6A 5JMTA 4G23A 4I55B 4UUOA 5FQNA 3GARA 4CU2A 3NEAA 2F3PA 5JCOA 2R6DA 1LWOA 3N6VA 1WPGA 1JDVA 1FYEA 3GLFA 4GI1A 2I9KA 2JLQA 3VNBA 3R7NA 4FYKA 3LQFA 1E1QD 1GXSB 1BKDR 1RQGA 2YN4A 4C5AA 1ZM7A 2AG6A 4KAFA 3EF0A 4PTZA 4Q4LA 4JR1A 1X8XA 1XD2A 2TMGA 4RF5A 4EFNA 5JHHB 7GPBA 4RHXA 1AC5A 2R6FA 4UULA 4KQJA 2XGSA 4MYTA 3K5WA 4HH0A 2D7DA 5AI6A 5E38A 1INLA 1Y8QA 4PLZA 4Y2JA 1RRVA 1WAMA 1XVUA 3H18A 4CDGA 5BPHA 2P79A 5DHRA 2V6BA 1U7TA 1YQTA 4KLAA 4UQPA 2EJWA 3VZBA 3IDOA 2PQ2A 4JELA 3T7JA 2JC3A 2SCUA 2ZULA 5HQ3B 4PLWA 2QD3A 2BEWA 1J5PA 4YB8A 2NTEA 4X1OA 1ZD5A 1WNFA 4L15A 2NUAB 3O94A 1SK8A 1UZAA 2QXTA 4RAOA 4UTRA 3HM2A 1FFXA 2COKA 4ID9A 4V3BA 3VNRA 3AVYA 4PC6A 4ICIA 5CK4A 1O58A 2DT5A 1NZJA 3FZEA 1EIZA 5DHAA 3C3WA 3NHKA 1AS0A 3LX5A 4C4RA 5FLKA 2FSIA 3D54D 1Z0AA 4MAFA 2G7ZA 4JSRA 4QLBA 2UUCB 1X86B 2EBHX 3G2QA 5DCUA 1CS4C 5KJ1A 4B7ZA 2Q6TA 2I7XA 1WU8A 5J1SB 4O25A 1XQYA 3V6MA 3BH7A 3ZQJA 3M1YA 1U2ZA 4JXXA 4ILKA 4XQEA 4NNPA 2YRFA 3DOHA 4PZPA 1PS8A 2JFBA 3BORA 3HJNA 3MYRA 4IDOA 4LRQA 4RTRA 2DQZA 2EIHA 3WB9A 1CNFA 4EY7A 3M6UA 4OMUA 2V7XA 2D1RA 1VMDA 3B1YA 1M1YB 3A4VA 3AONB 4GBGA 4J6EA 3OF3A 4ZK6A 1PO7A 1MB3A 3C1OA 1U0NA 1GWNA 2R65A 1HYBA 3K0KA 3SDBA 1H65A 4ZI7B 4CDRA 4W5QA 4RQAA 4TKUA 4ZRNA 4XCVA 3VH2A 4M1WA 1WG8A 4TPKA 3ESYA 1RMQA 1YC5A 5EXEA 3RSOA 1GYQA 1XNGA 2BSAA 3FKQA 3MJHA 4I6GA 4MYCA 4AYWA 4ESOA 3SM3A 1CNMA 1XGKA 2F1OA 1Q50A 3BK2A 4G63A 3BA6A 3H5IA 5D8DA 3WMFA 4Q3KA 5I9TA 4CODB 1MC8A 2WMDA 4L0QA 4XLTA 1G0NA 1NLZA 3A4NA 4I50B 2FV8A 2Y1EA 2VQSA 2W4QA 3FAZA 3ISVA 1ZUD1 3MA0A 3NLLA 3BRWD 3MWEB 3SSNA 1E9AA 1H2ZA 1PBNA 2EJVA 3O8OA 1OXUA 4IX1A 3TQTA 2L0XA 2Q3LA 4A2PA 3VGJA 2Z2KA 3AJ8A 1TYEB 3DHWC 2MSWA 3V1TC 5C8XA 1HDIA 2NTJA 2BFCA 4HWKA 3P96A 1Z6QA 4H27A 1W8DA 5EMMA 3OZGA 1A8SA 2FZKA 5GVSA 1KZ7B 3RS7A 2IUSA 2VHQA 1ODLA 2IIVA 2Z09A 3QVGA 2D3TA 4CL0A 5BR1A 2GCPA 3E23A 4QQ8A 5B53A 3TQFA 4B2LA 4P84A 4EHNA 4TZTA 1AV7A 2Y1CA 2JS7A 2JCVA 3G89A 4YRBA 5EE9A 2A59A 2QJTA 3JS5A 2WJIA 4KWEA 3ZH2A 1TM2A 1NNUA 4IJWA 4MUBA 3S0JA 3TD9A 4YJFA 4DLNA 2Y1GA 1ADJA 4QARA 3MJCA 5ALMA 3KJHA 4DXDA 4Z49A 4KZPA 1KFEB 3NYIA 4YQYA 5CW1A 4PHHA 1CIJA 3MGCA 3QVXA 3U7HB 3UMGA 4TLBA 5TLSA 2F9LA 3IT3A 3MWJA 5A4DA 4YXWD 4W5NA 2Q5JA 2R87A 1EP2B 3FM9A 1U0GA 4P58A 3WNVA 1VRVA 1YD7A 4MWTA 1C4KA 1Q19A 4IQFA 3JQ8A 2W6JD 4JWTA 3T7IA 3ZNPA 2WICA 3LBFA 1GT6A 1XMPA 2JGRA 4IGIA 3PNYA 2VH1A 1BE6A 4N41A 4M8LA 4POAA 1O89A 3N0RA 3IOMA 3RC9A 4KQHA 1KYZA 2UYGA 3I23A 1Q15A 3LXUX 5AKEA 4ZCPA 3TIVA 2ONCA 2JFHA 3ND5A 3HYSA 4PC7A 1JTVA 1L0BA 3B9QA 1OHHD 2J9ZB 1P0FA 1C0PA 2ZJZA 3L49A 1G17A 1MHPA 3IOCA 3BMNB 3QOFA 1I7DA 3DGEC 4GKBA 5ELMA 2WTNA 1FUEA 3IBYA 4IIJF 5F4ZA 3LPLA 3EFOB 2EEZA 1XKXA 2IZ0A 2NSYA 1I2MA 2R1UA 4LHYA 3GLIA 2W7TA 4YT8A 2XB8A 4X3CA 4W8HA 2MTBA 3LF1A 4Q19A 1QUFA 4DZTA 5JYBA 2G4VA 1ZZGA 1WOYA 1P2GA 2KPOA 3H9BA 4US2R 4DUZB 5B6JA 5F98A 1HE1C 2PLFA 1RPZA 4OHWA 5HA5A 4O2BF 5FNZA 4E3ZA 3ZVNA 1VI5A 1FA9A 3L43A 5EHNA 5TQ0B 4C4OA 1JB9A 3UT6A 2YR0A 2V59A 3FJYA 1Y7PA 2O48X 2OYCA 1E2QA 2GD2A 2JF0A 4LCJA 3WQHA 4DJFC 3JYHA 4GOND 3PTLA 3O38A 3ZHVA 1QANA 1QFZA 3LI2A 4PZAA 2XE4A 3KXLA 3OZEA 3GB9A 3WWZA 5JAPA 1EM8A 3B70A 1ZN8A 1YQGA 2HREA 1BMFD 2WBLC 4KOAA 4B82A 4LJ7A 2A8YA 3DHVA 1PJ4A 4BNGA 3LL7A 3AXSA 3P2MA 5INTA 1Y89A 1TFUA 1OXBB 5K0FA 2OXFA 3RBAA 2YS7A 3ZLUA 4PYNA 1Z16A 4ZKDA 4FSHA 4DV7B 4EQ6B 1GPYA 4PZ9A 4IWNA 4Q48A 4GO1A 1KERA 4AZTA 1Y7TA 2IX3A 4WBXC 1N2GA 3R3YA 5GIPE 4FZRA 3I6QA 3KNZA 3B3AA 3SHWA 3DTNA 4DNOA 3PIRA 4EZBA 4OJKA 4P80A 5HX7A 1PQ4A 4FYXA 4BP8A 3PDUA 5DO9A 4D9MA 1ZD4A 2P7IA 4QO8A 4ZO9A 2H2FA 5KU1A 3PT5A 4OFWA 5EUBA 5CBKA 2B25A 1Z37A 1NP3A 1H2FA 4M87A 3FDZA 1V6SA 4U9UA 1NDHA 4YNBA 3OUUA 4ZAZA 3WICA 4IIEA 3SKXA 3WK7A 2GI4A 4U2EA 4UJ5A 4A91A 1XHEA 2BTEA 1MOPA 4LOJA 4D25A 5A9SA 3P0RA 4RHUA 5JVDF 2AC7A 2AJ8A 3P1JA 5EINA 4GP7A 4CF6A 1JXMA 1PGOA 2WA1A 2AX3A 1AKNA 1FRFS 3P9IA 5JCJD 4G84A 3F6SA 2GBGA 1SU8A 2HU2A 3BXFA 1F0YA 1FZQA 1ZIDA 1YQ9A 2V4ZA 3GUVA 1YZQA 2W8BA 3LC7O 3MUEA 2E4WA 2W98A 4AP9A 1PEKE 3AF6A 5JXHA 3T38A 3UXHA 4L02A 4P7FA 5C1BA 3V8BA 5JCXA 4QG7A 3JX9A 1G8MA 5ULLA 1DKMA 3AJDA 1NM5C 5FFMA 1LC0A 3JQ9C 3OQPA 5B3JA 3QQPA 3D8SA 2DPXA 2ZREA 4LTDA 3BTUA 4L5IA 4MQLA 4F3KA 5JJIA 3SYTA 4JR0A 1B0UA 4Q3DA 1ZONA 1WCV1 4A2WA 3W79A 5FOVA 1UWCA 4ZOAA 3VMMA 1NNSA 4P4SA 2AE2A 4BZZA 3TXAA 3AKEA 5U4XA 1ACLA 1R0YA 3DUFA 4OBWA 4DLRA 1G7SA 3DDNA 2B37A 2X0NA 1UH5A 3E81A 1N78A 1RI3A 3HB7A 3MD9A 4YR7A 1LBTA 1VJDA 4IO0A 2NU9B 2CUTA 3C24A 2LPMA 2O2JA 1I2ZA 3R7BA 3RVKA 3KLPX 3ZEIA 4ZOLB 1KIAA 4EF5A 2XKBA 4RZ3A 4NICA 4JXZA 2KS6A 1ISHA 2H59A 3HZZA 1ZGGA 1LA2A 4I1OA 5JMPA 4QTUB 3ER6A 3IQDB 1I36A 1DBQA 3PCTA 4LIPD 2GOYA 3QVJA 4J1TC 1U9YA 1SXJA 1KY3A 2FGKA 1TEVA 2GFQA 3NDIA 5C0OE 3WRYC 1ORVA 1KDVA 1O03A 4G1UC 4XPIB 3NUZA 1U5AA 3GOQA 3LL4A 4MROA 4PC2A 3TR0A 4BEWA 1GARA 4G0NA 4OQMA 1U6KA 2H8KA 1UBGA 1YZHA 1UJBA 1X80A 2C8JA 4NBNA 1GG2A 2VT6A 3LUCA 4W82A 1KJYA 2ZBVA 1PZNA 3TTWA 3R7WA 1WXHA 5C4IA 5B1YA 1E1RA 1L7XA 2H7CA 1IG3A 1RPNA 2X5NA 2G80A 3DKIA 1VJ0A 1CY2A 3REFA 3T3HA 1A71A 4GFDA 4KNYA 2IDKA 5JNWA 4Y98A 2R8OA 1QO7A 1JN0A 1QYXA 2FZ4A 1IDOA 3BZUA 3CLVA 4ZARA 2F55A 1Q57A 3R74A 1R8QA 4HPWA 2MINA 3A1DA 3G0BA 3HZRA 4RDIA 4CM1A 4DLSA 3O1JC 1ORDA 5LLDA 3NXSA 4GLFA 3OESA 1GADO 4ZTUB 2C9CA 2IEAA 1GRCA 2E5LB 1KFBB 1S9DA 4JK3A 3CJQA 3OQ1A 2JZCA 2YFQA 1MGPA 1XTIA 3N0XA 4HT3B 2GJKA 1U4OA 4N76A 1M3SA 1ODSA 1ES9A 1DBVO 1W44A 2WAYA 3B12A 3A3YA 3IAEA 3JW8A 5EPUA 4F3NA 1HT3A 2AEMA 1V71A 3IAXA 1Z06A 5DLEA 3KV1A 3DEZA 3G0DA 4EB8A 2LGJA 3PBKA 2YBEA 2AOUA 4OHVA 2YVQA 3RH0A 3R3VA 1T5LA 2HMWA 3PUJA 4RJKA 3HE3A 4L78A 3UPDA 4P4LA 3TMKA 2C03A 2V98A 3H7IA 2FUKA 4KXUA 4ZREA 2YFHA 3SQOA 1RYHA 5A4MS 2X9NA 4TLMB 4RY2A 3DB2A 3AI1A 1HL7A 1J2TA 2WPNA 3FPSA 2FZEA 3N28A 3RC3A 3WGLA 2CVPA 4C87A 2VRCA 4AJ4A 2JIQA 3N58A 3SJBA 4HWOA 2GR9A 1CY1A 4JOSA 1PT8A 1NC3A 3OURA 5CXXA 4OXYA 4Y1RB 3VZDA 3BGVA 2PUDA 1KC3A 1QRAA 3ENNA 2FW9A 2X77A 1FYDA 3LPCA 4TTVA 1TTTA 2F8SA 2QSYA 5EHZA 4XXHA 4UPVA 3ADCA 1YQQA 1ZKDA 2CXHA 3DV0B 4M37A 3UF0A 2JAOA 5GADl 3I5YA 1LFDB 1VLMA 2QW8A 1BCRA 1G98A 3KOYA 4CXMA 1JDBC 4HNRA 4L6AA 4X63A 4HZIA 1SEVA 2A3RA 4YJ3A 4UATA 3SXUA 3KJEA 4C2AA 2OXIA 1CY4A 4HXEB 3NNNA 3R9XB 1ZCJA 4Y8VA 2EP5A 4QPNA 3B9BA 4HWTA 5HGJA 2EWVA 4B6OA 2V9PA 2RKOA 4TX1A 1L5HB 2GJAA 3I3OA 4Q03A 4TWAA 4KFSA 4Q9HA 3CR8A 1NNLA 2VF2A 3K92A 3C45A 1Y6QA 3LA8A 2AQIA 4KYIB 1N77A 3V8RA 3KDPA 4EABA 3OF2A 4EG6A 4HEHA 2HA2A 4ZVTA 5ABPA 3F5SA 3MMSA 2C9BA 3ICPA 4QREA 5EKSA 1F0PA 4FONA 1LSJA 2OBXA 4TMVA 5DYYA 4PBSA 3RFXA 1N2CE 1NQUA 5SYMA 3KVNA 1HDXA 1CUAA 5IJAA 4L4RA 1NMYA 4E11A 1M0TA 3I4CA 3UCEA 1AOXA 3UAYA 1TDJA 2H63A 2O1XA 5HMLA 3IUJA 3IVXA 1A5TA 3IP9A 1OX5A 2DY0A 1N9ZA 1EK5A 4K86A 3E27A 2Z4RA 2P6NA 3CW8X 3EJ6A 2ZE7A 4GMGA 1HDGO 1KJ9A 3GL9A 4F2PA 2BFFA 4RD4A 1IJEA 5ALXA 5JEDA 1HNXB 1LPNA 2H5IA 2PJRA 2QZ4A 2O2XA 3LIPA 3I05A 2CZQA 5ICMA 2ZVDA 1T9HA 3F46A 3HWRA 3H0KA 2WJ3A 3MNFA 3SJCA 3UA3A 1Y9DA 3AUYA 2Q5CA 3SQNA 2CXXA 2QE7A 2YV2A 1JI3A 2FTKE 4MPRA 2XB6A 3OICA 4ECEA 5L3QB 2BT4A 2C4MA 4LE1A 2XCLA 4PBRA 4IDBA 2X0KA 5J5CA 3WNZA 2YMQA 5J2TF 1H0KA 3L6CA 4LNAA 4HF7A 3ROXA 3T7CA 4AY4A 5EL0A 4B3HA 4M60A 4B73A 4OYYA 3UMVA 5JYCA 3HN6A 4EHFA 2J3KA 3FIJA 4HD8A 2IU0A 3QI7A 2XTZA 3CLTD 5HQJA 4BX8A 3OX1A 4P82A 5D00A 4A0SA 5K0EA 1RQPA 1DBPA 2QEQA 4P2BA 4X93A 4HDNB 4O8ZA 2O8FA 2EC5A 4KXFB 1D3AA 3HO6A 1L5LA 1DX4A 1E1KA 3W3AD 3I53A 1EFRD 2BIFA 4G86A 3MTBA 1U1EA 1ZK4A 4IFBA 3U3KA 1O0BA 5AM5A 1R9MA 2R6JA 4KVZA 4KODA 1SUDA 3SHVA 3B8HA 5A6VA 2HHCA 1MEEA 4M1QA 2AKYA 4OOEA 4UEOA 3GEBA 3ES9A 4JA2A 4NENA 4LG1A 1L8LA 1Z62A 4MLCA 5JQGF 3E1GA 3WXMA 5LIPA 3OLVA 3LKBA 3TD2A 4GC5A 3OQIA 4IQ4A 2PX8A 4LYYA 2OCIA 3B7WA 4KEAA 3UN1A 1EHCA 2BGJA 2C31A 4KXYA 3ZIDA 3TRFA 4KITB 2ZWMA 4KPUB 2H0AA 2H5EA 2DQ4A 2XB2A 1XHFA 4JB2A 5K2OA 4WOPA 1SAYA 4FE3A 4G41A 1X70A 3SSOA 1IBKB 1AUXA 5EJ2A 2QJRA 1H5NA 4BLTA 3AH8A 3NR2A 1RJ9A 1KMCA 1DG1G 2YOGA 4RCZA 3EH1A 2PL1A 3AY6A 4GDFA 4WSOA 4MP3A 1ML3A 1MVNA 1M1UA 4FR2A 2FG7C 2HPAA 3M89A 5BW6B 5FWXB 1ZVVA 5AFSA 3OJXA 3WIBA 4WZBA 4CW7A 2Q5EA 4G0QA 1XD2B 1HQYE 2IVZA 5B1DA 3FUVA 4AD8A 1ZHFA 3OM8A 2XMQA 1XP5A 3PE4A 4RGQA 5E6UA 1OAOC 5F5XA 6CHYA 1AGNA 3L1IA 2YXDA 3FRIA 3IPXA 3BICA 4BNIA 2L82A 2BJWA 2NVUA 2QD2A 2Z3ZA 1XTKA 3NWEA 3P32A 3FSGD 4GGPA 4ILEA 3ACCA 4PPQA 3UAGA 1XR3A 2H4ZA 2XVXA 2GNOA 3FD8A 4DCNA 3P7MA 4RIFA 3GGGA 3PNQA 1X1QA 2SCUB 3M4XA 3I04A 3LECA 3MGGA 2J30A 2BEWB 4FMBB 4OK3A 2ZTSA 1SBZA 2X5XA 3WSWA 4TTJA 2PCLA 4EHJA 1M2NA 5AM0A 1DDGA 1FFXB 1SC9A 2GEVA 2JJ2D 4DWWA 4OQYA 3PLAE 2BFEA 2DC1A 3DAOA 1OBHA 3QEJA 1VG1A 3DHEA 4J03A 2HWXA 5JFTA 2A92A 3D7MA 2OFXA 3GFTA 5MFPA 2P1RA 3BM5A 4U0KA 1UK7A 2VBCA 4OLBA 1RHQA 3GV0A 5LVAA 3NAGA 1YI0A 2Q8PA 4MMXB 1WF6A 1X8KA 2EJBA 2O23A 3A31A 3RF6A 1B23P 3B78A 3O9ZA 4K5QA 1F1BA 2H1CA 1G3RA 1UBTS 3PV0A 1B16A 3E9YA 4YI3A 1LRJA 2ZSKA 4HYYA 1E7WA 4QVKA 4D82A 1JG3A 2J3IA 5DWVA 4K81B 2IU3A 3PC6A 4JJFA 4MUAA 5CPFA 1E7SA 1X9HA 1P9WA 2FZWA 2P2CA 3IV6A 4FYHA 3TGWA 4HDMA 3KZOA 3RVJA 1C7RA 2LVBA 1R16A 1YASA 4NHEA 4U7JA 4CWAA 3NDBB 3K09C 3X1DA 1GITA 4ZQFA 4Z6KA 3MWDA 2WAOA 2NUPA 5CLJA 4TKUB 8ABPA 1CKEA 3URKA 4IQ8A 1P81A 4ZZIA 1LWNA 5CFNA 1FRNA 1JYSA 1P9LA 5HKLA 1QIGA 2ZT7A 4F11A 3ORRA 1G1MA 2C7RA 3E2MA 3PDJA 2ZGVA 4R5HA 4PZLA 3TLMA 3UOGA 1P1RA 4HNVA 3AIKA 2HRQA 1IVSA 2ZJ3A 1DEHA 1BW9A 1Y6ZA 2O3QA 3VKHA 4L57A 1SUAA 4YV7A 3X1WA 3V48A 3KUDA 2LV8A 2QB5A 3CF6R 3GEMA 4ZQCB 4L2IA 1I33A 4NZPA 4UUAA 3HYRA 3VO1A 3X1XA 5ICCA 2ID8A 4UCQA 3EQZA 1GFSA 4ER3A 1KTVA 3NYQA 1KFKB 4J2HA 4OHBA 4BKRA 1J8QA 3O0TA 1QR6A 3G5LA 4ITRC 3B1JA 4YCBA 4YRLA 4V24A 1CZLA 1S5PA 2FWNA 3F73A 2BFCB 4IR7A 3SGLA 2RHOA 4P0PB 1RC0A 1YU9A 3FLMA 3QVGB 4KZKA 2X14A 4I4NA 3WAGA 5F35A 2X8AA 3AWIA 3QRWA 2C2MA 4B85A 1EWRA 2BGLA 3GDHA 5FR2A 5H3LA 4Q9DA 4G4SP 1C1XA 1LC3A 2A5GA 2VDRB 4ZGGA 5JROA 3EOZA 4RXUA 2GWRA 4YJFB 4NCAA 3GJZA 4RXMA 1G1AA 5AIAA 5LYJF 3FNFA 2DKOA 4DUGD 3THWA 4QUKA 2G82A 5AO9A 3K7EA 4L75A 1FDOA 3H2IA 3CV3A 3ETJA 4K6HA 2Q3MA 3G7UA 2FUEA 4B2PA 4P22A 4Y6RA 3M6IA 2Z1MA 3DEJA 4ND2A 4NV0A 4TQUS 4YMLA 2PZJA 1GPJA 3K6RA 3JQ8B 3WAJA 3IIKA 2P6UA 1JHDA 4KC0A 1JLMA 3LRPA 4J0IA 1S2LA 2JEZA 4G9BA 2FEKA 2VQDA 3L8MA 3OCWA 4FYJA 1LDMA 2PXXA 4R2JA 1VLZA 1HLFA 1ESEA 2DG2A 5E1BA 3WWPA 2ZYUX 2DUWA 3PC7A 1R50A 1F9AA 4OHMA 2AKAB 1QYWA 5FI0B 1X2BA 2WVGA 5KYUA 3OZCA 3SDZA 4J16A 4KO2S 5JNVA 1WX1A 1OIVA 3F9IA 3HLTA 4RD3A 4IHJF 3CRNA 2B9VA 3W7BA 1VOTA 1MZVA 2ASVA 4M0MA 2K4MA 3W9BA 1RQ2A 3I5UA 2D1FA 2BP7A 3EZ2A 2EGHA 2OQ2A 4OATA 2J33A 2XGMA 2PTGA 1TZKA 2LTAA 1V39A 1ELOA 1D2EA 3GNQA 1OBVA 4IW3B 4LJ9A 4NYMR 4AI6A 1K9VF 3G49A 2B8TA 3AHJA 4HDCA 3V4PB 3GLIB 1AXGA 4MA5A 2QX6A 4FM9A 1IJKA 2WUEA 1H2AS 1ONBA 2XUJA 4K9QA 1F8UA 5EJFA 4JI1B 4XB6B 5FYDA 1RAEA 1KS9A 2WP8J 3NBFA 5DN6A 1Z7BA 1Z15A 4C0SA 2MSLA 2PYZA 4NCIA 3NONA 1Z73A 4V0SA 3B48A 4V2UA 1VQ1A 1K3UB 1L5QA 1DUIA 4KQ6A 1CJBA 1HV8A 4KV9A 3CXRA 3H6GA 3KWMA 3N70A 1AK1A 2FFQA 2J1LA 4FEAA 4TRRA 5FWDA 3S5JA 3ZWQA 5KX5A 2JHCA 5CP8A 2QM8A 5LB4A 4AJLA 4C89A 1EM8B 2HTEA 4UE3S 1K7CA 3G82C 2KM1A 3KFLA 1ZDMA 3CVVA 3TQHA 2H4XA 2GTPA 4Q3BA 3GYGA 5KQRA 1EA5A 3THRA 8AT1A 4F4JA 2P9JA 2IOQA 2RJ3A 1JQAA 3J81A 3ZQKA 3F6BX 3NTQA 1JQKA 4UEJA 4WVFA 2UYHA 2NXNA 1A7JA 1LXCA 2H31A 2NN3C 2F6RA 4ZV7A 3PFFA 5H82A 2F90A 1DV1A 5LM3A 2I29A 1AKUA 2Q5QA 3Q3GE 4GVLA 1Y9ZA 3OU6A 3TSAA 3LBHA 4HNGA 2JJMA 5K51A 1KO5A 3ZI7A 4Z7OB 5H02A 2C2BA 1MG0A 1AXRA 3S44A 5LPNA 2W8ZA 1EU1A 1S1CA 3H0EA 4XIGS 3UC9A 4B5LA 2EL9A 1PJZA 2FUCA 5A9RA 3FDZB 1IEVA 1BE1A 4QHTA 3EPKA 1OC4A 2HTFA 3I3SR 4R1PA 3WHIA 4EJFA 5A9SB 4BXOA 2XA1A 3DBHA 2AJBA 3M9LA 5JJLA 3H84A 3MWLA 2FPSA 4EB6A 6YASA 1GPAA 2IELA 4V3CA 1J25A 4HAZA 4PIPA 3BTOA 1K98A 1QHIA 3JWIA 4L9WA 1U0RA 5AQEA 5TQJA 2W8BB 2P2GA 3RFUA 4MQUA 1M2HA 2BW0A 1IH8A 4DVJA 3BHJA 3WLRA 1KJ8A 1CJSA 1A9PA 3KTOA 5A3SA 2W6QA 1GSIA 3KR1A 2KW5A 2QG4A 1ISGA 2JI6A 1XZIA 3M5DA 5DHUA 1WDMA 4ZJYA 6LDHA 2O05A 4XJTA 1GN9A 4M98A 3GGJA 3O4RA 4B7UA 4FUQA 5KZMB 2C8VA 5K4GA 5E4YA 5BURA 1CF9A 2C4TA 1WNTA 4WY8A 3LKDA 3P9RA 3RUDA 1T5SA 5CD9A 5JC8A 3THXA 2KYRA 3QW4B 4DLWA 3KKNA 1BHQ1 2DUUA 4B75A 4P4SB 4UU1A 4F97A 4UARA 3NV9A 4GWKA 3O1HB 4LC0A 3DUFB 2FZ5A 721PA 2D0OB 1FMJA 3F6PA 3TRHA 1Z39A 1DAEA 2DJ5A 5K6AC 3WY9A 4JGIA 3D6NB 3PWZA 1UXHA 2HCJB 1SUFA 1SCAA 2PRZA 2HA4A 1A82A 2DULA 4I1UA 2R48A 4R41A 5LFAA 3JXEA 4C0QC 5DZSA 3T54A 1BKSB 1DWQA 3FCCA 4JX9A 4JLUA 1NZFA 3DZKA 2ZANA 1KHHA 4E21A 4HPXB 3RUHA 3PDCA 4D3ZA 5A3VA 1AGPA 2WM8A 2I6FA 1UOPA 4JXJA 2W00A 1SXJB 3TCKA 3HDVA 1XKTA 3LTNC 4XWTA 1G3UA 4UNIA 3ZS8A 1V8ZA 3W2GA 4LDRA 1M6VA 1NPYA 2OCYC 2QKYA 4RDXA 4BU1A 3R7AA 1SU7A 4S1PA 1RABA 3B2QA 3TJRA 4QFCA 2ZJ7A 1CDZA 1UJCA 4GXNA 4DZZA 5DTJA 1WSBA 1HR0B 4ZVNA 1GPKA 5KI6A 4K9DA 4KLNA 1BQ4A 2P62A 1PR6A 1F5SA 1X6VA 1B6GA 3FWYA 4M9QA 4B2IA 3GHYA 1RU3A 2ZT8A 1T3GA 1Z0JA 3O03A 1IM5A 4UCXA 1A4RA 4Y2GA 5ALWA 5C53B 1L7PA 2AL7A 2PD4A 5CX1A 1R4MA 4HATA 1QIMA 1JLHA 2MINB 4PLHA 4PYOA 2P41A 3HP4A 5IK2A 3L8YA 2ZI4A 3ADBA 4BLWA 1EVJA 1S8OA 4NPCA 3Q1KA 4N3CA 1BJTA 1SQGA 4E5VA 5I9IA 1Z4QA 2Q4DA 2YRXA 2VP5A 1IN5A 2J85A 4H2DA 4WUVA 1GFWA 3WGGA 4CMEA 2Q21A 2YXBA 1CFJA 1M2VA 3A9CA 2AFIE 2AOUB 2ID9A 2ODWA 1P5FA 4QL3A 5B55A 2JBAA 4WKNA 2AG1A 1RYYA 3PNVA 4FKMA 4U4AA 2Y67A 2XDWA 3K70B 2BEVA 2EYQA 3QY0A 2OFFA 3TJZA 3WSVA 3ZUPA 1TXGA 4RF4A 4Q9LA 2HSGA 2CLSA 5FOWA 3DE5X 2HU8A 1DAIA 2HH9A 2PZBA 5JZOA 2AK3A 1JL3A 2I67A 4BC0A 1T43A 2CNWD 4NBSA 2QZZA 3C87A 3LBAA 4FQ7A 4B4KA 4DDHA 1O97C 3LQ2A 4C6RA 1EH5A 5C3MA 2VYCA 5HPYB 1M8PA 3QITA 3JTMA 3ANTA 1C81A 5KWSA 2CJXA 4DJEC 4MKHA 5KPDA 3LQ1A 1MA3A 1N2XA 3DTYA 4GSYA 4A82A 1F38A 2O3RA 1OWLA 2X6RA 3DWIA 1X1TA 4Q16A 3TEFA 3AL2A 1KOGA 1OY1A 3EMKA 3LUJA 2GXUA 5EHIA 4JIMA 5HJ2A 5JNSA 1Z2PX 5HSGA 5FWAA 4EL5A 3IDSA 3M49A 4Z4IA 4YJ3B 2Q6OA 2CD9A 3SXUB 4ZEVA 4RK0A 1JIXA 2QENA 3DCNA 2JEOA 5ALHA 3KEGA 4KQEA 2Y1WA 3UT5A 2RKBA 3GZNA 1YAJA 4JJ7A 2XUIA 4AURA 3BDVA 3TNDA 4UBIA 4B4UA 3VNUA 2QN6A 3MTIA 1HNZB 1Y3HA 3EMBA 4IMPA 4RE5A 5DW0A 5A9TA 5TRTA 3DE2X 1RWWA 4GICA 3F47A 3GN2A 5G41A 3ADDA 2H16A 1PL0A 3GJTA 5DULA 4DV1B 3PXCX 3DBRA 4LJYA 1QV7A 2UYYA 3LUAA 2WJVA 1RLJA 4INPA 4AJHA 1E94E 3BXZA 3EUFA 1AN0A 2N47A 4OKSA 4ETWA 2XDQB 5BR8B 2CZCA 4EGCB 4YLYA 5HZGA 2HLHA 2AR9A 4RHYA 1SRQA 3A8TA 2NLOA 2UYQA 3E15A 3EARA 3T3PB 3LP6A 1R0XA 3FSRA 1EK6A 2RC6A 1NF2A 4B6JA 2C5HA 5H5JA 2VJKA 5LA6A 2DERA 5THQA 4CKYA 2VTVA 3GJ8A 3T7RA 1U2DA 4DQUA 2K2QB 3EX7C 5LP6C 1KYVA 5CD1A 3CZQA 1O87A 1I5OA 2BFFB 2QYSA 1U8TA 4RIEA 4C6HA 2W6CX 1L5SA 2MU1A 1E1QA 1Z35A 4MVJA 4J6FA 5DNUA 1IC6A 5JJBA 1JE1A 1ZQ1A 2XUHA 3WL8A 2FPPB 1XMOB 1G5RA 3C5HA 3TK1A 3GN1A 4FGSA 2C9OA 3W3ZB 3IVMA 3HFRA 1K8QA 2NV6A 2JD1A 4N3GA 3RK4A 4O33A 3SI7A 1FW6A 3ZWNA 3ZV7A 4Z4HA 2QYHA 2HEGA 1PL8A 3IEPA 3DQQA 1NZDA 2RH8A 3C39A 1R5OA 1QAQA 4G01B 3KT3A 3T9CA 2XW6A 2YZGA 3NVAA 4KMSA 2R6ZA 5JNLA 1WMAA 4BNTA 2JIPA 4QECA 2ZJ6A 3MIZA 3IPRA 1KR2A 1IQ0A 1WDKA 2ERCA 2NXWA 2OHFA 2R4QA 3IXMA 3C4QA 3UOAB 5B7QA 3R5SA 1E6WA 1J00A 1ONOA 1QG2A 1TZCA 2OBMA 2E4YA 1C8LA 3V9PA 3USCS 2FK8A 5ECGC 5G02A 3KQSA 5JARA 4GOOD 5JRZA 2O8FB 2WKRA 2R85A 2IZ6A 1KO4A 3TLJA 4NOJA 4IIGA 4F06A 4KR7A 2AI3A 1H3EA 2YKGA 2OMKA 2WU8A 4L6IA 5IEBA 1EYZA 3W8EA 1Y63A 3ROMA 2PZFA 4MTCA 4BVFA 4DMGA 5K3EA 3GLGA 5CXSA 5DXJA 4D02A 3H2YA 4EVSA 1EVEA 4PFQA 5FLXA 4K9PA 1IJBA 3VKFA 3DZGA 4FQ5A 4NENB 4KXMA 4DMKA 4F91B 3TECE 1AX9A 3LY5A 4M8SA 2AX4A 3TLKA 1H8EA 1Z0UA 1OBFO 1U94A 1HUQA 3PQ5A 4K6FA 4FGLA 4Q7LA 3W9YA 4DNXA 3RJ9A 3N3AC 3OQIB 5HIJA 5JS8A 2XYPA 2D5LA 1PD0A 2GBLA 3MCVA 1VE7A 2GK7A 1AQ6A 3A4TA 3EVCA 2G4LA 4Y9DA 3UNXA 1KJIA 5BORA 1NATA 1GVHA 2BTQA 1MABA 1E9SA 4CKEA 4EPRA 5M5BA 3W5VA 1ZY2A 3RKRA 3FPJA 1H6AA 5L3SB 3OZWA 2V7QA 3CY6A 2PJDA 1EHIA 4V0ME 2M9MA 2LR0A 1RJ9B 5DM2A 1V6AA 1Z4LA 2HNKA 2Q9AA 2QU7A 3D6MA 2OMEA 1PX0A 3R6TA 1KNQA 2OZPA 4MWDA 1TM7E 3L0BA 1DOAA 2VEOA 1I51A 4D57A 3ROFA 3NEJA 3BRWA 4WKOA 4N48A 5LQRA 3HWSA 2AR7A 5E6UB 4M83A 2FPGA 4BE7B 2PX5A 3VTFA 4PYIA 1GR1A 1QCZA 4H6VA 1CUHA 2WNHA 4N0EA 1AGXA 2ZR8A 3HYTA 4BLOA 2VPQA 4F6RA 5JXWA 5M2QA 3OY2A 3TIGA 5CXUA 2NVUB 2WQ6A 1EB9A 1F2UA 3UK7A 3WJAA 1TU3A 1UDCA 3DF9A 3PT9A 1E3QA 1NOIA 1X14A 1FVXA 2AFRA 3E70C 4UHCA 4BKQA 1P4RA 3T5CA 4M0FA 4CT0A 2VTDA 5CCDA 2HJWA 1YONA 1SY7A 2O2CA 2OTCA 4J3NA 3X43A 5BMOA 1NJ5A 3AGPA 3TKLA 3X2EA 4JC5A 3ZU6A 1CZHA 4HADA 4NARA 1DTSA 2VZEA 3S70A 3AVPA 3LBNA 1F0KA 2BFEB 1AZLA 1BVUA 2ZE5A 1BA2A 2FLWA 4OMDA 5D85A 2IWRA 4R83A 2H1OA 4G25A 3NG1A 1AKVA 4LF8B 3KAJA 4FZVA 4N8DA 4BB0A 4EUEA 1SCQA 3ANYB 3DT9A 4I6JA 2P2DA 3JAMA 3M6VA 3L0CA 3F4LA 4HQRA 2HBQA 4YFVA 5IVPA 1OH7A 3KB8A 5ERYA 4MRSA 2W6JA 3TIXB 3LUHA 3HLKA 3T3GA 2Y6VA 2CLKB 3K9BA 4DJTA 3G1WA 4DVGA 4FQ8A 3IQEA 2CDRA 3RC8A 2X0IA 4E31A 1GV0A 5IC6A 1HG1A 1MVLA 3CTPA 3HXLA 3ESXA 2HNBA 5C4GB 4S1OA 4B33A 4UXHA 4D43A 5C7LO 3MCUA 3BXXA 4JODA 3BREA 5J2UF 3BMCB 1S2MA 4ZT4A 3RSGA 3EPJA 1LPAB 1QG4A 3NNDA 4A5SA 4DUPA 3W5SA 1AT1A 4MUFA 2SKEA 3MWDB 2NUPB 4IDEA 4POOA 5BV2P 4FLEA 5C7YA 1RZUA 2WV9A 3EF1A 4HNTA 3SHTA 1GKUB 1SCNE 2H2GA 4HFNA 4DG5A 5CH3A 5ALDA 5AVVA 5GJVC 2A1IA 2ATCA 1CR2A 4YK7A 4XRRA 2I2XB 3MMXA 4XUDA 1A8QA 4JEUA 4K28A 1PN3A 5AK4A 1BW9B 2NO6A 2Z95A 2B5VA 3UPUA 1WIWA 1I6WA 2F3TA 3OBBA 1KSFX 4GRIA 4JJIA 5L6MB 3OX4A 4L2IB 4X7RA 5C7IO 5HM8A 1R74A 2FI1A 5LBUA 2V7EA 4DSAA 4HI0E 3IQHX 1LJLA 1SVNA 2W90A 1XV5A 4BASA 5ER9A 1IQRA 2W5UA 1Q1EA 1YUMA 2JD2A 2F59A 3BFVA 3EN0A 3OE7D 4M54A 4QGAA 4YAWA 3UICA 4AWBA 4GEGA 1ND6A 1NGSA 3EMVA 2X19A 5CB4A 3PQ4A 2PIDA 3C6YA 4YRQA 1CJUC 3QLJA 4UM5A 5H1YA 2NNLD 1M76A 3EQ9A 3L8CA 3VKVA 1EFUA 2G77B 4ZU1X 3TG2A 4FCTA 4HQFA 4BWGA 1JA9A 1SQ0A 2WU4A 3P9YA 4DS3A 1OA1A 1C1XB 2DBRA 3Q7QA 1GPBA 3KB2A 3LT5A 4FS8A 3GT0A 5ALOA 3ZE2B 4WY2A 3OIWA 1T4MA 4XTCS 1G3MA 4PICA 4N5IX 1U3GA 1AKMA 4IIVA 4UHDA 1EFHA 1I4OA 3ECCA 2QF7A 5BOVA 3U48A 3THWB 1II9A 3DV9A 1NULA 4RVHA 3C3AA 2DRIA 4R2WA 5EXTA 2OHGA 3QBTA 4QBHA 3WS7A 2V7TA 2QLLA 1TF5A 3IFSA 3L0PA 4CMKA 3L0YA 3O2QB 1LSOA 2R60A 1VPTA 4XKJA 4H7DA 4PHTA 4QPDA 3E7FA 4UE2A 5A03A 3LCCA 5EIWA 3JQBC 5JAQA 1Q84A 3L7IA 4C3VA 4WBSA 4V0OA 3U09A 2CUZA 3BKWA 6AT1A 5KYUB 4L0CA 2NSJA 1ZP6A 3D4PA 3NS7A 3GROA 3GAAA 4P31A 1DBWA 4BATA 4X3PA 1VI2A 4MPJA 3R0JA 1W48A 1NE7A 1PJAA 2FPLA 3VTZA 1EHYA 1MNQA 3F90A 3OQNA 1RW4A 4J75A 1VXRA 5KQLA 2OHHA 2OO5A 5ERXA 5J43A 5EKTA 5FBHA 2BP7B 1JH8A 4AZ3A 5ILOA 3NHJA 3L4KA 1BKYA 2CCKA 3OHSX 1E0AA 3R3HA 4Y2SA 2A9FA 4XFJA 1TQ6A 4XVQA 1T2UA 3WKDA 5C5CA 4MS1A 4D3YA 3JSAA 1RWKA 3KKZA 4G5QA 1C7ZA 3W6ZA 3SXJA 4EUSA 1K8XB 3OTQA 1OXMA 2QMYA 1D07A 3RBZA 3U4CA 4X90A 4D8UA 4L8WB 1Y1QA 2BFMA 1JQBA 4OQDA 5SZIA 3NV7A 4G8JA 1HFEL 3KQQA 4ERXA 1XRLA 3A1WA 2PIAA 3VMFA 2YY7A 4URYR 3NHSA 4HL6A 3ZHYA 1EDOA 2EOAA 2G0NA 3DF7A 3GPLA 1ULBA 821PA 2XTMA 3BSYA 3IAHA 5ANRB 4DYDA 1Q0TA 3T94A 2O3JA 1ZUNA 2FNAA 3CVOA 5KX5B 1K7SN 3OEHD 3QW2A 5AK6A 4D8WA 2VHCA 3JU3A 3GJQA 5TVGA 3RHTA 5K05A 1RXWA 1U3WA 3OPYI 3K9GA 4YN3A 2O3UA 3TLGA 2NZUG 2FR1A 4OQ4A 5EPEA 2E7ZA 1Q12A 4OXQA 1SJ9A 3RAFC 1O3YA 5BYAA 3G0OA 2ZROA 4LJRA 2A9QA 2BKLA 2XQKA 3LCMA 3LHSA 4RFLA 1H1DA 4JEHA 3L8HA 1ZK0A 2I80A 2W2XA 3TRJA 4H18A 3AY7A 4MGIR 4RPCA 3JQ6A 2ZM6B 4YRDA 5CVUA 3UBTA 3KFXA 2A5LA 3ONFA 5CNMA 5TS2A 3WJ7A 2CV1A 3FTDA 3U44B 3ZHXA 1W6RA 3C6XA 3D4IA 2JZNA 3KZCA 3TSOA 3AF3A 2IU4A 3W34A 4RMJA 2IODA 2XVYA 4PC3A 3ZTWA 5CG1A 5JXGA 4IF4A 5C34B 3BT7A 4BXOB 2AXQA 2ENWA 3TUIC 1ZAKA 2A30A 4W9NC 4EB6B 4MRPA 2C2GA 4F4UA 1GKKA 2H2AA 1L3CA 3RVLA 4DLZA 3TF5A 2PAFA 1K6XA 3AUKA 3QWAA 4J07A 3S5UA 8GPBA 4MV7A 1NY6A 1W2GA 2A0KA 1H85A 3PFWO 4PYKA 4ZU3A 5JFOA 3I9V1 3EZNA 3RYFA 2HO5A 3UUFA 3F98A 1URPA 3M4JA 5BY2A 2WD9A 5HP4A 5I9SA 4KAAA 1JIIA 2DFLA 3PUKA 1IWPB 1QHSA 4ESEA 1THZA 1UDRA 4RJ2A 4H15A 2XYVA 4F0JA 2FWBA 3THXB 2ZJ2A 3KCNA 4V2IA 2XUAA 4H1VA 1JU4A 1WWKA 4EEKA 2PL9A 2RH4A 3J80A 2BEKA 2MYTA 4IH9A 5AOAA 2XY4A 3N0VA 3RJMA 4BDTA 3V8EA 4Z1MD 4CLOA 2C7VA 1RIIA 3FCAA 4RESA 2H11A 5JSZA 1XQ1A 1RAIA 4KQ1A 1DARA 4MQ5A 4YAOA 4ZOLF 5DTMA 3PDHA 1ORHA 4YV1A 4A03A 4HGZA 1AGYA 1Z2AA 2QRHA 3ICOA 5IFLA 2JFUA 1H9CA 3R5JA 2WA2A 2Z3WA 2OKGA 2XQFA 3NDPA 4OL0A 4PX3A 4BECA 3HEAA 4GMKA 4Y6QA 4IXWA 2H8GA 4V03A 3WNBA 3U7GA 3KJIA 1L4LA 1H3FA 1W36C 2J9FA 3IILA 2IEYA 3GG9A 1N75A 1PNVA 4YH1A 3TZBA 4BNFA 3ETHA 1EX1A 2GPAA 3WC4A 1KVSA 4X6UA 2W2LA 2YVLA 4Z7QB 3LFUA 3TVYA 5AJZA 4LX8A 5A04A 5F1KA 3GLSA 1M6VB 4FZ3A 1P39A 5FBZA 2JFGA 1RJGA 3JVEA 1PI3A 1JZSA 4KO8A 1H23A 5DN9A 4XWWA 4JI8B 4JLAA 4F71A 3GK3A 5KNCD 2IEGA 1E7QA 3L40A 4NYMQ 1W93A 2JAPA 4MVJH 2HCBA 4H17A 4JOBA 2WIFA 3KUUA 3NHBA 4UHKA 1ZG3A 3BH0A 2B1QA 2PH7A 1O95D 3NOQA 1LJUA 4MYSA 4I3FA 5F2NA 4L0MA 5KTMA 1CZRA 4YAEA 5CURA 1X7XB 3H5VA 1R4MB 1QH8A 1PIWA 2C88A 2FF7A 4I19A 5CX1B 1A7UA 2O7SA 1QGOA 2VHEA 4X44A 4ZK2A 1FYWA 1SB9A 2P3SA 1FTNA 1B93A 3SFZA 2Z4SA 1CYDA 1XDDA 1XKLA 2Q2VA 3B5JA 2EU8A 2JHAA 2VJNA 5EP3A 1KZHA 4D5GA 1W30A 2Z1NA 1U80A 1UEXC 3DYIA 3BTVA 3BOSA 3AHCA 2OM6A 4JQOA 5EJ8A 4TMXA 3S2EA 4AW9A 5BQ5A 4DY4A 5E8RA 1R15A 2Q49A 4ARAA 5K9ZA 4BVBA 4X6XA 1NUQA 1RP7A 4LF4B 3Q8KA 1OI4A 1V7CA 4L4SA 1R64A 1M2VB 4RSRA 1JHRA 1SRRA 3CGWA 2O7QA 4Q1AA 1IUOA 3VR6H 4DIBA 2JBAB 5A7GA 4RH0A 3KOUA 5DYIA 1MN6A 3SZMA 4RZSA 2FSPA 3EEBA 2BEVB 4HVTA 4JJ4A 4UVIA 1N1EA 2YXNA 2D8MA 4IZ6A 3ZOKA 4IMJB 1QOQB 1IN7A 3I39X 1SQSA 1OI2A 4YGYA 3QLEA 3ROTA 3PSHA 3QKRA 1NXTA 5A3JA 1NJSA 2OBFA 3SBEA 3L1UA 3WISA 4TTSA 3LTEA 5CA1A 1VP9A 1OSNA 1JNYA 2H1LA 3R23A 4MICA 2VNAA 2HSEA 1ZVMA 3CIOA 2IPLA 2X2PA 4UQLA 4OXKA 3VAYA 2C0QA 3MSXA 1Y1TA 3H5RA 1DRJA 1T9GS 3K2IA 1TGVA 4IIXA 5GM2A 3MXOA 3DSRA 3HA3A 1CW2B 3M3HA 3K1ZA 4RTMA 5ESXA 4RADA 4BRWA 3R8XA 3GFQA 2AN4A 4QOGA 1Z47A 3DBLB 2XUQA 4YCDA 1OAKA 3HACA 4PLPA 3ORFA 3EUWA 5ALZA 4YPVA 2NTVA 5IM4A 3T1YB 5AUQA 2GH1A 1E9BA 4GPAA 1H2BA 2GAIA 1POWA 4WFJA 3WJ1A 5DM70 4H1WA 1ILWA 1G6Q1 2XTAA 3EULA 4BV8A 3UT5B 3GZNB 4PFJA 3W3AA 1K8RA 1N6OA 4R2LA 1KQOA 2FMXA 2ZB7A 4EY8A 1NRXA 4BLPA 2HQ1A 4W1SA 2ZCVA 5K4HA 2F43A 1UJNA 5F51A 1TUGA 4INZA 1PJBA 5A62A 3DBRB 3HU3A 4YO8A 3PD0A 5HHTA 2OFOA 1DXHA 2I4RA 3HV2A 4DV0B 4NFLA 3P9ZA 2ZK7A 3DLAA 3PA8A 3C14C 1MIOA 4L4ZA 4ZAXA 1XD8A 3HJCA 4KFRA 1M8GA 2VJYA 3QYJA 3FHLA 1L7DA 4K6KA 5FO1A 3CRQA 3FVWA 3NU1A 3SK0A 2AW5A 5LA6B 1ZJ4A 2NZXA 3EPLA 1U0TA 5JW6A 1VL8A 2FFHA 3KKOA 3LQ4A 5AXCA 3LU1A 4O2LA 5I7VA 1P0IA 2DWOA 4PQYA 1UUFA 2FOXA 3KELA 4J0GA 4LVNA 4JI3B 3RVQA 1TB4A 3WGJA 1PL6A 5KS2A 4E5PA 1S7GA 2FJ0A 2WZQA 2C77A 3GQVA 1JLKA 4ZZ3A 2XVAA 1T2CA 2FSFA 2VDJA 4PR3A 4EDHA 4Z7NB 5HNKA 3NTVA 2BLNA 3CW9A 4LY9A 4KI7A 4OHOA 4E5UA 1GNQA 2RGEA 3DA8A 5TQVA 2PRYA 1RJWA 3X2FA 4PS1A 3DVLA 4PG4A 1GRRA 1F2DA 1M1YE 1WKCA 2BGNA 5FAXA 1PJCA 3FSGA 1JG2A 4JU9A 4N3AA 1FFGA 1YB7A 3KT6A 2X15A 3OLQA 4UTOA 5AJWA 3FMOB 2C1XA 4LQLA 3WIUA 2YASA 4DPMA 1YBAA 2ZTLA 3A0UA 5KSYA 2W43A 5LMUB 4AZVA 5EJAA 2Q0HA 3QE9Y 2J9GA 5BSWA 2I0FA 1G38A 5KMGA 3DYBA 1QVVA 4WNAA 5F3DA 4RGBA 1EFCA 1L1FA 1YSCA 1V11B 3C7TA 4YBRA 4TVBA 1ND5A 4EYKA 5AVJA 1UZMA 1MJHA 1MJGA 3Q4GA 5IDXA 4EENA 1ILEA 1W4CA 3A6LA 3KT0A 3PHIA 2WV7A 3PUZA 4V0RA 1KQ3A 4PXAA 5CT8A 3U7EB 3W5IA 5BWLA 3V1UA 4UAGA 1COZA 3ZCXA 2VWQA 2CDCA 4KBFA 4PAGA 2OV8A 3IQZA 3BRSA 3I8XA 3STHA 4D99A 4DUYB 2NZJA 2Y1OA 3AF5A 3JWGA 3UJHA 3X1JA 1NSFA 5JI2E 1I2AA 1MV5A 2C58A 3QK7A 1M8FA 4UFNA 2C4HA 2HYDA 1MAVA 2PE5A 3H3XA 1SD2A 4JJ6A 3MFYA 3C74A 5D87A 5BV0A 1JXOA 2IC5A 1FS4A 3AB3A 4WOJA 2ZR7A 4O4JA 2YWFA 2NQ2C 4DEVA 5LNK6 2B35A 2BJVA 2FN8A 3JALA 1BA3A 2VPPA 3PGVA 3SF0A 4DNFA 4GLLA 5PNTA 1UMDA 2BTQB 2QSUA 1MABB 1O08A 1Y5IA 4DCOA 1E61A 1HDCA 4IJVA 1MQ9A 4CKEB 4C0AC 1FX1A 1GU1A 1PF7E 3WVNA 3P5SA 1E6CA 2ZAIA 4WNCA 1YO6A 2AFHE 1EM6A 1KZYC 2BVNA 2RGWA 4DEYA 2I1QA 3A2LA 9GPBA 1OXXK 2R6AA 2XBLA 2ISCA 2Q1WA 2F1RA 4Z99A 4BTVA 2P1ZA 3CUVA 1JJ7A 2IZOA 2JANA 2Q3BA 2WMOB 3KKKA 4PC1A 2V6IA 4UXIA 5KQGA 1NWCA 3CX6A 3SDSA 3IKMB 1FP6A 3QVMA 5JTUA 2FPGB 4N6OA 1RAHA 4BBAA 5FUXA 2DTEA 3DLIA 3FG9A 4E32A 3SEQA 2QTZA 4F6RB 4RYLA 3SFVA 1TEZA 3A06A 3W05A 1Y98A 4XD2A 1F2UB 1IHXA 2YV5A 3BXPA 4Y2PA 5BUCA 4HS4A 1JHMA 2J87A 4I5FA 4A7PA 3P9PA 1D4ZA 1L7RA 3CH4B 4YY3B 4KBGA 1OE0A 3GEGA 2RHMA 3Q5GA 4LHVA 4EVQA 5CITA 2BCJQ 2PH1A 5THXA 3EG9A 3VYUB 5L95A 1I2CA 4ETNA 1PFWA 2G4CA 1K5GA 1XXHA 5KQMA 2AWNA 5JT1A 1JDTA 1SHTX 1FL9A 1Z22A 4HQ0A 4JKOA 1HQDA 1UXGA 1VLVA 2XA9A 4E30A 4IHAA 2QQGA 4L08A 3O8BA 5UKDA 1UMCA 4IVPA 4DUGA 1JHYA 1EGHA 1XDUA 2QDKA 3EIXA 1OWOA 1KPGA 3AM4A 4KMOA 5AI8A 2AUMA 2QZSA 4NJEB 2P9HA 4DMRA 4CKWA 1DAKA 3KPUA 1MOQA 2PD3A 4L51A 4W9MC 1ISSA 4CT5A 3CE9A 4JAVC 4MO2A 5CIYA 1J7KA 2FE4A 2SHKA 5CT6A 1LPSA 1P91A 1YUNA 3O95A 4Y2HA 2X0EA 1Z2OX 1TIPA 4NYJQ 4W6QA 1EVLA 5EWMA 2WB4A 4OQQA 1SUEA 2ZE6A 3CPJB 1U0BB 2LDBA 2H9IA 2YJNA 4H7KA 4EI7A 3WLKX 2HPHA 5KSPA 3EIHA 4NS4A 5B58C 4DE5A 2GQ0A 1Y42X 4KN5A 5JAUA 1OZHA 1T4BA 3F7NA 4J29A 3A1CA 3R7FA 4A1OA 3DMPA 4DBVO 1ETHA 2GETA 4U63A 4H1HA 4LECA 3SX4A 1QQTA 4Y9UA 4JJ8A 1RKVA 2OENG 3QE4A 2PQMA 1ICIA 1V45E 4YCLA 3AVUA 3R6LA 5BNIA 2HWWA 1PHRA 5IBPA 3HYCA 5TIIA 3WGMA 1GGFA 4LFBB 4PU0A 4X85A 3PHBE 5ALIA 1ZH6A 2ORYA 3QFCA 5CB4B 3G2KA 3CX3A 4Q18A 1XDGA 5LKRA 1CRPA 5TF0A 1LVHA 1KI9A 1RMTA 2IZZA 4H6PA 4UAUA 3SXPA 2EZ4A 2CYBA 5ALUA 1JEEA 4HTAA 2GASA 1OKKD 1LPBB 3BHMA 3MAJA 2RGNA 2GZRA 1CUBA 3AINA 4MYRA 3ANNA 3MCWA 3TN7A 1E1YA 4DWJA 2RHGB 1S2NA 4RH3A 1TD1A 1RQNA 1FSPA 2ZJYA 3CG0A 3I01M 2CHGA 2GX6A 3LAWA 4G07A 4G6ZA 4IF6A 2FQXA 2QTCA 3U49A 5B6IA 4V1CI 4H7JA 4EKDA 1W4RA 4NJOA 4LXQA 1N6LA 3UHJA 1N6PA 3UHFA 4BZPA 1E3JA 2RK4A 3JWPA 4KX5A 2WKQA 2JJYA 4YO7A 1GDDA 2HLDD 3CLSD 4GNRA 4D9EA 2OD7A 3CX7A 2ETXA 4PONA 3E1KA 4DIUA 1YNSA 1RQRA 3KLOA 2ZUVA 2PO7A 1ZH8A 3CKLA 5IC5A 1IBMB 3O4HA 1ZNQO 3IXQA 3SQLA 2Q5OA 1OR8A 4QWMA 1U5CA 5C37A 5IG2A 3H86A 4II3A 2BCEA 2GDZA 2FJPA 4C4PA 1XHLA 3UV3A 3K8QA 3NM5A 4B7XA 3PX2A 2W6IA 2CVZA 3BMOA 1GTL1 2GGSA 5AKXA 3P8ZA 3TRDA 4JLBA 4CUKA 1ZJWA 3TTSA 4KXXA 1N6NA 4UTNA 4W5HA 5K4AA 5LD2C 2REQB 5I8PA 5LXTA 2B83A 4AZ3B 3OPYA 2IXDA 4OKIA 1UDWA 4L72A 1RPTA 2B3TA 3N9IA 2J6IA 2X1VA 2AZMA 3EIOA 1YNOA 2VPWA 4JASB 4HB3A 4QEDA 4YUAA 3U60B 5CYOA 1GTG1 1QORA 3DOOA 5AWFC 5K45A 2ZRBA 1NU8A 3ZKWA 4QDZA 4C1NA 4E88A 4OU4A 2H17A 2J4CA 5B64A 1M2EA 3GT7A 2HV8A 1VI6A 2WYUA 3HRKA 2J0EA 1KQPA 2ZS8A 4ENWA 1OLOA 2QHXA 4Y0NA 2ECOA 2AE1A 4EBBA 4ZU6X 3SR4A 4H08A 3EAQA 1GAEO 1ZUNB 1BYUA 1E2HA 1SVKA 3BH6A 3CH5A 4MP8A 4IXTA 1IFXA 1LDYA 3DDZX 3QBDA 1T8YA 3RW9A 5FP0A 2DR0A 3G2OA 4JH0A 1JALA 4X61A 1XC7A 2RDMA 3UK0A 3PICA 4QRDA 2O14A 3DZCA 3TLGB 4U8GA 3E5RA 1RWBA 3U44A 1O97D 3GJXC 3FYTA 5DSTA 2O4CA 3DVAB 4XGIA 3RHFA 2VYVD 5HRAA 4O0MA 2VBFA 2NWQA 4NHOA 1LVUA 2LIVA 3ZU3A 2ECFA 3NHYA 4JJAA 5CPBA 3OFKA 3MILA 2FZCA 2WIDA 5C31A 1JAIA 2DFDA 3R40A 4BQSA 2WTUA 4WMLA 1RKBA 3K6SA 3PD7A 5IKPA 3WB0A 4V38A 4AG5A 2WU3A 3QF7A 4BQEA 2X2EA 3UM9A 5TMPA 2DFKB 2EBWA 4IYRA 4EFMA 2OGTA 3GBSA 4OQFA 4AY5A 3NBQA 2XUDA 1ZU4A 5T6BA 2EFYA 4R6XA 2ZTMA 1TNDA 4QPJC 4A27A 2IXAA 2X3YA 4G2NA 3IJPA 2PS1A 4IXMA 1NFFA 5JWOA 2IE0A 3H99A 3BSFA 2J9XB 4RZXA 4G5YA 5DX1A 1SVWA 3WLQA 1VHQA 4MUNA 1U6JA 4N18A 4B3FX 3OLYA 3F5FA 4IGEA 3QBEA 1FUYB 2XB4A 4KI0A 5IT4A 1Z25A 1CC1S 2CHQA 4MV9A 3RYFB 2J09A 2CB9A 3CRVA 1ZUIA 3KAQA 3B1VA 3D6JA 3NANA 4IEEA 1QIEA 3TMAA 4Q3OA 2ZM5A 1GSOA 4BO6A 2NYVA 1J1UA 1V9SA 5AW3A 2V7UA 2D2FA 3C6ZA 4G37A 5BSGA 3IMEA 3WIVA 3F6RA 4CLOB 4DCCA 1YIAA 3B7PA 2GZ2A 2WFLA 4IOMA 4D3XA 3OM9A 5HF8A 5DKFA 1XAIA 3CMMA 3PFKA 3O1LA 1KZ9A 4KKXB 4GR4A 2GLTA 4G4GA 1V95A 2R8PA 3QA3E 4MV6A 4ZEWA 3S4YA 1QHNA 1C1DA 2FFRA 3SP1A 1CK4A 1G6OA 1LW7A 2D5AA 3FVTA 2XMCA 4XD7A 4DMFA 5KYNA 1BXRA 1NY5A 2RGAA 2Z58A 4LHWA 5BUQA 1WB9A 2XBMA 2J9FB 2YN0A 3L46A 4QAJA 3M3PA 3OTOB 3CZPA 3J81k 4ZYLA 4PPFA 5EHQA 4BIIA 2D13A 3BX1A 4ND5A 4PBTA 2YYSA 5EOVA 1C0IA 2JIZA 3CRMA 3GPBA 3MBKA 1F6WA 2EZTA 3IDAA 3BB4A 3GAFA 3KOZA 4OAOA 5BSRA 1KE2A 5IANA 2XNDD 1G8HA 1T1JA 1NBME 1HDRA 3ABSB 1SVUA 3BWVA 3HUFA 3K4QA 4J3FA 4EFDA 2IS2A 4RORA 3L6DA 1XRRA 5E4TA 1KO8A 1GZ6A 1TI7A 2HRBA 2E21A 3AHEA 2R00C 3O3MB 5E4FA 3CNQS 1J70A 2VPZA 1DJPA 1YJQA 2NU7A 1AA9A 5JXIA 1NW4A 4Q6BA 2W71A 4PANA 3VR4H 2I91A 4OQEA 4TOIA 5BN1A 2WHQA 4Z9XA 3QH4A 3FCOA 5KKNB 1KK2A 4RV9A 5KUTA 2RGCA 1ODJA 3HB4X 4I08A 4QUHA 4MI6A 4UJ3A 1MAUA 2YDYA 2PUTA 2EX0A 3ZQUA 1QH8B 3L5OA 3HB0A 4KIUA 4QOSA 4TN5A 4BVKA 1EG2A 3E2IA 3EXAA 5EJIA 1PR4A 1DCKA 1IHOA 4FNMA 4WLFA 3GMTA 2JI9A 4OM8A 3LCRA 1ZK3A 2ZE8A 3ORQA 2HCRA 3ZX4A 1J5EB 1IPEA 3LOPA 1UPBA 2BHNA 1N6RA 1ECCA 2D0IA 3EGWA 4H4EA 2WWRA 1WUKS 2JJ1A 3RREA 4K8RB 3WDMA 1PS0A 3U3JA 2E0IA 3LQRA 2Z5GA 1W34A 3H7AA 4AX4A 4QOJA 3NP9A 4QSHA 2WWXA 1POXA 1KZ6A 2QTVA 4HXFB 5CLLA 1VPDA 3M2TA 4X62B 2Z3VA 1MC5A 2Q1XA 4OJTA 5KIAA 2AA3A 221PA 2VJAA 1JU3A 1K7YA 5B5SA 3RHSA 3R5KA 1J1IA 4IICA 1FDUA 1M0WA 4KW7A 4H6WA 4DPKA 1PDWA 2YQ4A 2OP0A 1SHZA 1V6CA 2HEIA 3CBGA 5JO0A 1XU4A 3PWKA 3EWAA 2GZDA 2OAP1 2WPDA 5AHOA 5JWHA 5HTOA 4KXQA 4RK4A 4HVCA 2QG9A 1UKYA 5J4HA 2DFVA 1P0PA 2OGZA 4MXDA 4KXLA 1A97A 2BBWA 4HRXA 2GVNA 4NCKA 1N5IA 2JJQA 2Z8XA 1YQEA 2IK8A 4MKGA 4DC9A 1ESNA 3KIPA 3ZHRA 3TPFA 1BSVA 1CRZA 3UKOA 4DAOA 3DL7A 5B12A 1NONA 3U19A 5E1DA 4OJQA 4TWZA 2GSWA 1ODCA 4B47A 3FUCA 3PDWA 2D1QA 3NAQA 3OP4A 5I48A 3C3CA 3C6KA 1NVFA 3JPYA 4FYVA 5ALQA 3WGKA 3CNBA 2NVWA 2Y4OA 2PS0A 3UAWA 4O8CA 1NMZA 1QSGA 1A9ZA 5KYTA 2IS1A 2JGAA 1DS6A 2Q2QA 4FBGA 1ZJ6A 2YVKA 1P4JA 3SICE 3HYLA 1QO0A 1RBYA 2C99A 5LZ8A 2F43B 2L17A 1EJBA 1XCJA 2CFIA 2EG9A 3HCOA 3ESAA 1O7JA 1M2WA 3AR3A 1ZM2A 4EHLA 2F3QA 3W5HA 1K0UA 2Z04A 1C9KA 1OROA 2VKTA 1QNFA 1U0OC 3R3XA 1MIOB 4AKTA 4LYGA 2Y66A 5G53C 4LDQA 4YRFA 1E92A 1SBYA 2ADOA 3LBIA 3K0FA 5CX4A 5JS2A 4ARUA 2ORWA 1U3DA 2ZJFA 3MJDA 1YZ3A 4L8YA 4PQEA 1D2CA 2JLVA 4YRSA 2AHRA 1GUDA 2LBPA 4WKGA 3D3JA 5GWXA 1AV6A 1ZR2A 4G0OA 1Z83A 3KR2A 2ZT5A 4TWJA 3FDIA 4IVQA 4LRWA 4P5EA 5E6RA 2UZ3A 3UH0A 3VGPA 1FXUA 3ADOA 2VSQA 1CP2A 5JO9A 3KG2A 4TV9A 1R9NA 1YT5A 2AUTA 2K87A 4C88A 1QKKA 3R6GA 5A5VA 2GESA 4J2TA 2HU5A 2CZGA 3D7NA 3KBBA 4JBLA 4YJ2F 2UUBB 1K86A 5FFNA 1PKEA 4M38A 1MB2A 4EZEA 3UMMA 3FSJX 1DTEA 1T8TA 4JLMA 3O5AA 5FL3A 3K4HA 3ODGA 1N92A 1GGJA 2I4OA 4GPIB 4ZV4A 5JH7A 1ADYA 1WDLA 1XROA 2OHIA 2Q4TA 2Q5IA 3L1HA 1Q22A 3STXA 1HNNA 3DNMA 3ML1A 2C7BA 5KMGB 4WNAB 2JLBA 5JNRA 7MDHA 3JQCA 3WI7A 1ZMOA 2BEUA 2XLCA 3TB6A 4TRMA 3GAMA 3H2ZA 5BP7A 5FLEX 4FSXA 3A11A 4QU8A 4X1YA 4DN6A 3RRXA 1T35A 2J3DA 4HY3A 3HJAA 3GY0A 3LIIA 1TE2A 2J5QA 4O2AA 2WYHA 3H4TA 3B51X 3S2IA 4EYQA 3A1SA 1EWKA 5T4FA 5TXGA 1EK1A 4I5DA 3NBUA 4RS3A 1SELA 3OOYA 3OPVA 3ZV4A 5IULC 1VMIA 2JLYA 4JUAA 2Z5VA 4ACAA 3EF3A 1JR4A 2YMMA 2B4TO 3DXYA 2E6UX 4G85A 3JARA 1HRDA 4PZZA 2I78A 4A26A 4XWOA 3EBOA 1QYIA 5EE0A 4Z3KA