5EKTA

Crystal structure of mutant-k146a of peptidyl-trna hydrolase from vibrio cholerae at 1.63a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
197
structure length
196
Chain Sequence
MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHADKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of mutant-K146A of peptidyl-tRNA hydrolase from Vibrio cholerae at 1.63A resolution.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
total genus 63
structure length 196
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ektA00
5IVPA 4QT4A 3TCNA 5B6JA 4LWQA 3P2JA 4QD3A 3TCKA 4ERXA 2Z2JA 5EKTA 3V2IA 3KK0A 4FOPA 4HOYA 4QBKA 3OFVA 2JRCA 4FNOA 4IKOA 4ZXPA 2MJLA 5IMBA 3KJZA 1RYBA 2PTHA 5IKEA 1RYNA 4FOTA 4JY7A 4P7BA 2LGJA 4JWKA 4Z86A 4DHWA 4YLYA 2Z2KA 4JC4A 3VJRA 1RYMA 4JX9A 2NAFA 2Z2IA 4FYJA 4OLJA 3TD6A 4DJJA 4QAJA 3TD2A 3NEAA
chains in the Genus database with same CATH superfamily
5EP3A 3JS5A 4R54A 4BV3A 3LUAA 3VR4H 3QEOA 5TGDA 4AJPA 3Q11A 4JYZA 4KSBA 4MIOA 1A1SA 1ICEA 2EC5A 4P92A 4Q1CA 3W5VA 4B3CA 4WBNF 1IN8A 3FZYA 3ABOB 3NATA 5EXEA 3BFKA 5CITA 5HUQA 3SLGA 1LPBB 4YRGA 1G7RA 3FHJA 1OXMA 2F43B 3LFHA 1V5FA 3PFWO 3P9SA 1QRTA 2LWIA 4JY7A 2H08A 3DBIA 5IJ9B 1JIJA 1E5LA 2ZR8A 3IXMA 4FS8A 3U4GA 1GGEA 1DAFA 3GFVA 3TF5A 4BL5A 1V35A 2D7DA 3GF4A 3ZZ1A 3O7MA 2KWIA 1HZJA 2HSJA 4J76A 3Q10A 2EDAA 4J4TA 3D4NA 2R6HA 1AHNA 3FZNA 3HJAA 3EIWA 4O1MA 3OOHA 4C6TB 1SXIA 2JJ1D 1SUPA 2A2ZA 2A9RA 4WEOA 4G09A 1X8LA 1RYZA 1YC2A 2BEVB 3HBLA 3LRTA 4H60A 4UM8B 3AOGA 1N0VC 3BG5A 2C54A 4NMWA 4PAOA 5MGNA 4KZKA 5AVQA 1OXXK 2O2EA 1DNPA 3A6LA 3PGLA 4J91A 3JQ9A 4DANA 2EKPA 3A3NA 1YOVA 3I01M 4HWTA 5J2UA 3OTGA 3AR4A 5AW1A 3F2IA 1A76A 4GKVA 4R1NA 1YJCA 621PA 5JBIA 1SXJE 1A7JA 1UBJS 3JYNA 3YASA 3SZGA 5EMLA 1LDNA 4O0MA 3DMRA 4WI1A 3TZLA 1L4FA 1B2RA 3WLEA 1ZUHA 3LPLA 1JKJB 1SUWA 2YUIA 1LZKA 3L06A 1GZUA 1R0XA 4HEA1 3TO5A 2Q3JA 3QENA 3DLAA 1HV8A 4YFYA 1I5OA 1GUDA 3EBOA 2QRUA 3GUZA 5IZ4A 3DEHA 4LC0A 1G3IA 1WW3A 1P5FA 3TR5A 1HE1C 4X91A 4X7BA 3F7OA 1AURA 4OKNA 3IJEB 4FLEA 4EYKA 1YB6A 5DCWA 4JLAA 3MT9A 3JWPA 3T7RA 2QD3A 4PW0A 4ALNA 2V96A 3LT5A 2WQ7A 2QRJA 1QB8A 4LOKA 4ZVPA 1B4DA 2ABWA 2GN0A 2INGX 1L5VA 1XMSA 3HUEA 4MVJP 3RM3A 4E5VA 3GBVA 1O5TA 4R2JA 1IBRA 3A3YA 3EF1A 1UL1X 3GEEA 1IOZA 2C2WA 1O0BA 3TXYA 3PNPA 2BCJQ 4C0BA 1YZHA 2W7TA 1YR2A 5CXQA 4IH9A 3SYTA 4DOMA 2Q6OA 4LJ6A 4BB5A 1F5NA 4TXLA 3MWKA 1EDEA 2WJHA 4V0LA 4DG8A 3LQYA 2Q2WA 2XW6A 4HH0A 4AJOA 4JQZA 4PPYA 1H0KA 2EX0A 4IWNA 4CFZA 4DCCA 2AFIA 4CM9D 3IPAA 4GU5A 2ZBUA 3SQMA 4UOZA 3BL8A 4Q7EA 4WASA 1R9MA 2JFUA 1BFUA 2C9YA 2OCKA 2W5UA 3ETHA 3R6DA 1Z2DA 2A5YB 3MGBA 3NR2A 2NU9B 1P7CA 1HM5A 1UBLS 3LVRE 2JI7A 4Y2RA 1R6BX 1N9GA 3VR0A 2ZB3A 1PUJA 1SQSA 3DV0A 4LCEA 4NV1A 1Z56C 4PGFA 4WNAB 3UOWA 4F9EA 4RTMA 2AG8A 1LX7A 3GAFA 2HXGA 2PNFA 4Y1RB 5FUMA 4IOKA 1DV1A 5JSFA 1DQPA 3HDHA 3OQNA 1YUBA 2ZTHA 3PUWA 2OLEA 2UZ1A 4JFRA 2GK6A 3TCXB 2J1LA 2ZOSA 3QOWA 4I8XA 4NNOA 3ZXYA 1T8WA 1WMEA 1LQUA 2REQB 4ZOCA 4AKGA 1HK7A 4Y1FA 2GASA 1UK8A 3L1UA 3ZDDA 2WJYA 4OG2A 1W73A 1BS1A 4WOCA 4AT1A 2J5RA 2W4MA 3RYCA 4I5FA 2W9XA 1P60A 3MQ4A 5LD2B 4M3NA 4BBAA 2AFHB 4XE5A 4KXUA 2BMJA 2JEOA 3TR6A 1Y6QA 5B1YA 3VDXA 5CNIA 1M2OB 5CX1B 3RSHA 2F3SA 3BAZA 3ZXIA 4LS3A 4MARA 5HM8A 4URYR 4TL8A 4C0HA 4YCLA 1J06A 1QP0A 2DTXA 3RWOA 2DWUA 3GLSA 3OZVA 7MHTA 1H3EA 2BLNA 2YH2A 3PZBA 5J40A 1JHPA 5L4SA 2C82A 3DGFC 3BK7A 3CJQA 1BN7A 2A1TR 4UVGA 3ZGNA 2NZJA 3PRHA 3CRVA 5AWFC 4WOBA 2H4WA 5K6AA 3G9XA 2ZWAA 3F67A 2MHCA 3N07A 3TIVA 2XUQA 2ZB4A 4AECA 4ETIA 3PCRB 3RIHA 4JEUA 1LTQA 4JAVC 1FMLA 4P4TA 5ANRB 5FUXA 5LBTA 2GCGA 5ALQA 3WB9A 1HFEL 3HXTA 2RGYA 3GFGA 4NPHA 3RIGA 1TUEA 5AKZA 3P94A 1QU2A 4BX2A 5C18A 3P19A 2WINI 2F9FA 421PA 5C1DA 4ZEWA 4PNPA 3IILA 1ZH8A 3RS3A 3CCFA 5CFQA 2PU5A 1VSVA 3HFRA 4BKOA 1G3MA 4ENPA 1JPJA 4RWZA 1PQYA 2AJDA 4MITA 4X85A 2FXVA 3U4CA 4NXNB 4H1UA 1W52X 2CVQA 3EH2A 2Y76A 4B4KA 4BFYA 1GZ4A 1X19A 4H3KB 5JNWA 2WWXA 5CBPA 2PX0A 1C7RA 2C2BA 1Z6GA 3CEJA 1WB5A 2AZDA 1YHNA 3OFVA 4IL5A 4C4ZA 2OKCA 3AHFA 6ABPA 1U3UA 3PLRA 1TIBA 3JYHA 3VNUA 2XUDA 1Y7IA 4BIMA 3ZKWA 2OCAA 4MMZB 1UZUA 2O8CA 4L6IA 3GGDA 3IV7A 2O8FA 1RBZA 2WC1A 4J16C 2V1XA 3LO5A 3SBXA 3D6VA 3ESRA 3R3XA 1PYGA 2VDWB 4PNHA 3TX6A 3E22A 4LX0A 1DFHA 1Q1BA 2E7ZA 5L4LA 5HVNA 2ATXA 4Q1AA 1V6CA 4ITVA 1JPVA 2QQFA 1DUIA 2ZRCA 4KP7A 3Q85A 5EINA 5DM70 3TEFA 3C41J 5KSZA 4G0UA 3FSRA 3JZDA 2QAJA 1GKUB 3GPCA 4HATA 1XL0A 3HJUA 1E3SA 1AH2A 2O0LA 3NUQA 2DJ5A 2FETA 3ADOA 4OU5A 5CDUA 4IINA 3QVUA 5DCLA 2O8NA 3O8QB 5AHOA 3OIYA 3X44A 3L8ZA 2GBGA 4HWGA 2BGKA 4ZRNA 3FRIA 3T4XA 1GZ7A 4OJKA 1FXSA 5JEDA 2H7XA 3ECCA 2UXDB 3QWFA 1SOMA 2V7UA 1QB7A 3A37A 2M9MA 1IJEA 3HK2A 1E2BA 5IEBA 2ANCA 2P11A 2HB6A 2ZJAA 4O3MA 1IM8A 1YZLA 3GAAA 4FHZA 5AK5A 4OHPA 3EOAI 2C07A 1E2IA 3N2GA 2Q1UA 4JYCA 4RV4A 4YV7A 1NNEA 1RMTA 1WA5A 2V03A 4DLRA 3S1SA 4HOYA 4WK0B 2VK2A 3ZLTA 2GCOB 4I9UA 2VP6A 2BW0A 2GDJA 2R5FA 2JH9A 3R3WA 1USUA 1EBFA 3AU9A 3EDRA 1T0BA 4LPSA 4YAUA 2AW3A 3HSKA 4RF3A 3K1AA 3GPLA 3N2NA 1JEOA 1RHUA 5K51A 1SNYA 3SJCA 4QICA 1PTJC 2ZJ5A 2QMYA 2YHBA 3K9GA 4YP0A 1UQTA 5ENZA 1JFSA 5K8UA 3NRBA 3ZN2A 1MH9A 1W46A 4QQRA 4ZICA 1LRLA 1EUQA 5LD2C 4E5KA 4P7GA 2ZI7A 1GUFA 3H2HA 3DZBA 4YRBA 3K9FC 4LV6A 4Q5IA 1NR5A 1TW3A 3CF6R 1PE0A 2I2XB 1V9LA 3VPXA 4HZIA 3ELDA 1GNQA 3IR5A 4FI3F 4R0NA 1A2BA 3C5VA 3IJPA 4RZ3A 3V4VB 1T4CB 5A4MS 3FOZA 3G8YA 3GD5A 1ZCZA 1H93A 1YKSA 2WMDA 3KEGA 2FW7A 2HT1A 3CU5A 4OQ4A 4J4HA 4RIIA 3TIFA 4AYWA 2IHYA 4B7UA 1ID8A 3CM0A 3A0RB 4ZMBA 5ETJA 1YIAA 1YFKA 1CB7A 3HM2A 3GL9A 5AVYA 2XYGA 3SFZA 1E32A 3A9SA 5CU7A 2HIHA 5GONA 4KQWA 1Z82A 4PG7A 1O95C 2DT8A 3H3JA 3W8FA 1YZQA 2GESA 2I2DA 2J5XA 1U2RA 5BNIA 2F8MA 2UUAB 4OGKA 1FXUA 3NXSA 4DR1B 2YJGA 2B1GA 3QEBZ 1R27A 1SCBA 3EC2A 2HSDA 3TR0A 2BJVA 1Y5LA 1EAYA 2DLNA 3IQWA 4BRUA 4UCWA 5TLSA 4BEJA 1NN3A 2KX7A 1NXOA 4F0JA 2P68A 2HNKA 2ZIXB 3FPJA 4GAEA 4HFRA 5DCYA 4R8RA 3S70A 2J9FA 3GUVA 4BNDB 2ECQA 3WDSA 2FPLA 3EIOA 5FPQA 4WOKA 2F3TA 2AXQA 2P9YA 2QL7A 1QH8A 3A1SA 3B1KA 1AF4A 1D8TA 5CUQA 3ULKA 4IDQA 1HE8B 2NUTA 2PK3A 1C2YA 1REQA 4ZIRA 4KBYA 3FFBA 2VP5A 4AS2A 2DJIA 1RXVA 2ZZNA 1F51E 3CX3A 1JG6A 3KVNA 2BFAA 1JH8A 5IMSA 2IHTA 2XZTA 5KKNB 3DBHA 2JRCA 3K0AA 3G7SA 3VHLB 5B4UA 5AW0A 1FZTA 5EE0A 4WZBB 3R0IA 2QGZA 1Y8AA 4YJ2B 3I9MA 4FGSA 4ZAZA 4AUEA 2NXJA 4JUCA 3TUIC 4MV7A 4Y6QA 1U4OA 3OFKA 4DMRA 1ZXBA 2RGRA 4EUEA 2VUTA 1SBTA 3ZNQA 4ENTA 1ESMA 3L6EA 1KERA 2CEKA 5TMBA 3U0BA 3OF3A 1BE8A 1NNLA 2WUGA 4LBVA 4BO6A 3WG9A 4OLAA 3RS4A 4A8PA 2PPVA 3CGGA 1UT8A 4MV4A 3W9YA 2ADFA 5DZSA 1K4KA 2V0GA 4F1JA 1XDUA 5JS2A 3QUAA 2IYZA 5FULA 3L7CA 2X2OA 1J0XO 1TM2A 4CUKA 3VFDA 3AI2A 4RENA 2RI0A 3RG8A 2BFFA 4RGYA 3AYZB 3G5UA 4ZT7A 1QMPA 1SKAA 1DOZA 1F2TA 1XUOA 2DUUA 3BSSA 3T8YA 2NADA 1PS0A 2C2YA 3IE2A 1JSRA 4RA9B 5CAEB 3H16A 1D4FA 4TTSA 2R7AA 2PMDA 3PCXA 4I2NA 4ACBA 1V11A 4V0NA 5H3LA 2DFTA 3FTPA 4WN3A 2OEPA 3VPDA 3UB4A 1P91A 1SZJG 3CEPB 3DTYA 3GRAA 3FJYA 4FYJA 4QGAA 3VSAA 5LQMA 3H7AA 1UMKA 1ZH2A 2F9MA 3KQWA 1Z35A 3VZDA 2NTVA 4RVHA 4EDFA 2B2NA 1Z3CA 3MCWA 5KDDA 1TF2A 1EVJA 3EVGA 3NBQA 3M4XA 4P4UA 1PFWA 4ARZB 4LY3A 3P7MA 3O4HA 1AA6A 1W85A 3UMJA 3K0FB 4YRJA 4ND6A 3S40A 4CLOB 1WVIA 3PU6A 1IM2A 1EXNA 3G6WA 1O3YA 3QKRB 5EIAA 3M5CA 4TKZA 3A6PC 4FNGA 3TUJC 3V7YA 3PCTA 3O4GA 1XP5A 1TZBA 1M2VA 3G7NA 4LEIA 1I3NA 1BCSA 2OHXA 2A0YA 3JPYA 5KOHA 3LF2A 1UP4A 1GRRA 1RBMA 4WACA 1W36D 2J4FA 1ORRA 2C5LA 4G5XA 1EK2A 4AJ1A 3PIIA 1KHHA 3H99A 2CWWA 3HBAA 4X61A 1FTQA 3AERB 4DA6A 4K9PA 5JH7A 4I5DA 6PFKA 2WFMA 3SXJA 3L7AA 2GTIA 4KR3A 1CJUC 2O4UX 3BMXA 3E82A 1F6BA 1QRDA 2EFGA 1G18A 3FI0A 3HA3A 2G0NA 3T1OA 2XUGA 3I5XA 4KN9S 1SKYB 2FE4A 2NT4A 4U3JB 4E7PA 2BGUA 1M9NA 2HAEA 2JW5A 4FT2A 2X8JA 4GR9A 2JGRA 4EHLA 4GE3A 1UOOA 1ESZA 1DQSA 1NI4A 3FFXA 2OOSA 3QF4A 2FWMX 1SBIA 4WNYA 4M1WA 1VFPA 3SS7X 1ZGZA 3UJDA 2BV3A 4E22A 1XMJA 1RI4A 3VKWA 4E2YA 3GT0A 1Z0IA 5HKOA 5CGZA 5I7FA 4XYMA 2FX3A 3C45A 4MKFA 1KYVA 4QJ4A 4PO1A 3P0IA 4UTZA 3VISA 5IT5A 1V37A 1ZOOA 2UDPA 3MTQA 5DTRA 1QO0D 4DA7A 1HDIA 2X5XA 5TPZD 3Q7QA 3D54D 4RTSA 1Y37A 2AI2A 1N2HA 3K35A 2BBOA 4Q1BA 4XX0A 4FCCA 5DHFA 1PDOA 1R0SA 1O58A 3PPIA 1FYFA 4QHYA 2C7PA 2FZ4A 2FEPA 1A2QA 3AR9A 5C46F 2Q99A 4EG4A 4ZO9A 5IWAB 4REMA 2AWNA 4RFSA 5KSPA 3QE0A 4KLCA 5B1HA 3RKUA 3CZAA 4JJ4A 2IELA 4G85A 3C6MA 1OFUA 2YJNA 3Q72A 5DLQC 1N1EA 1M8FA 2E5FA 2A0KA 2V7QD 4INZA 4Q21A 2RHJA 3OE1A 3K70B 4DLWA 2IDMA 2ZTSA 4ZYTA 1NL3A 5H81A 3SS9X 3DE2X 2GPTA 4HNGA 1N3LA 2R62A 1R50A 1H2HA 5IBPA 3W2EA 4JEMA 1E18A 3CONA 5TQJA 4C1NA 1THZA 4NOMA 4C0JA 1RVDA 4OCZA 1U2PA 3H5NA 3WGOA 2F9LA 4B6RA 2G63A 3K6SA 4V0MA 5JMPA 3F2VA 2OXCA 1C1HA 4FJ2A 1ULHA 4DHEA 2X6TA 3DTNA 3PRJA 4FFLA 4FD3A 1B1CA 3U2QA 5A6VA 3ASZA 4QIHA 1KI9A 5ALGA 3COSA 2PT9A 3WLSA 2O9JA 3WGGA 2HF7A 2LCIA 4LDJA 5H1YA 5KYUA 4A1OA 3I32A 4RTOA 3LMKA 1PG0A 2DERA 4QASA 1KO1A 1GTG1 5AM5A 2O20A 5LFAA 1MMFB 1QGOA 1PJ2A 4BN5A 3EAQA 3RVSA 4PGAA 5KS2A 1FDIA 1P2GA 4U1RA 3FCYA 1MO2A 2OAEA 5E38A 1ATIA 4RF5A 2CXPA 2O3UA 4D46A 2WVHA 2D5AA 2JI8A 3AC0A 4O2LA 3TRHA 4EA6A 4D5GA 2E18A 4I9NA 4YP5A 4JN6B 2UXCB 2AFRA 2VPZA 1E6MA 3KFLA 5IDWA 1DC6A 1TTTA 3V7NA 1CS0A 4FFWA 4MWOA 2XYPA 2BBWA 4FYKA 1KZ6A 1NMYA 4C0XA 1N0WA 4OQNA 4DW8A 1JTFA 2C88A 1S3IA 4BLQA 3DVAA 2D3WA 4KIGA 3AETB 3AR8A 3KL2A 4EMUA 5FV4A 2H1VA 2R6ZA 2YNMD 3DCNA 2YRXA 3I45A 4JKOA 4B7ZA 1CE8B 2WIJA 3KPWA 2C94A 3DEJA 2XX3A 3K8ZA 1UBTS 2HFJA 4ZAFA 1YRAA 4M99A 2V6MA 4QXRA 2O19A 3GBPA 5TPWB 5A9SB 4G5SA 4LSZA 2M6RA 4OM7A 3PNOA 1G1AA 1PWXA 2X7JA 3TECE 2Q5OA 2C5BA 3PGKA 1H8HA 4DMCA 2J32A 3H4VA 4C4AA 4CKCA 5A1TA 4MA5A 3D4BA 5TDHA 1LS6A 3PNSA 1R66A 3UJNA 3F4LA 1AE1A 4CF4A 1UKBA 4QTXA 1XYYA 2FQXA 4JROA 3R9XB 2IZ5A 2GN8A 4Z7NB 3QI2A 5IF3A 1RZRD 4N82A 1N2OA 4LYAA 1GG2A 2MOKA 2B1JA 1HX7A 2R6CA 2ZBGA 2QXYA 5FF9A 4QATA 4PC7A 1T15A 4GQAA 2QM7A 1ORIA 1DHTA 2ETXA 4UNPA 1R1DA 1X7DA 2MSWA 4Q9KA 4WA7A 1AXGA 1P4GA 3LUJA 3DOHA 4C30A 1W5BA 2ATVA 3GA0A 5GVSA 5HW0A 1IN7A 1U1GA 4LWQA 1GUYA 4Q82A 4JLBA 1X7ZB 1YBMA 2NSYA 2I6UA 1IG0A 1QUEA 2ODWA 2R47A 4RH1A 1TCVA 4DLKA 3HDJA 3D5TA 4IDGA 5J59A 3P9IA 5DHPA 3EIXA 3FROA 1LB1B 3N75A 3V8RA 4ONEA 4CHTA 4YR7A 5CDFE 4DLYA 4D8VA 3GLFE 4P53A 1GOTA 3DZJA 1LLDA 1KH2A 2J0UA 1Z16A 3E70C 4GD3Q 3CUEF 1P77A 1SOVA 2HK8A 1XEWX 2HLPA 2OCPA 3SSAA 3WIEA 2B20A 1DO2A 3VJRA 2DG2A 3FY4A 3IKMB 4ENSA 1RQ7A 4V0OA 2GHTA 4CFYA 2O6LA 3UK1A 2IL1A 3L4EA 1YIOA 2C04A 2UYHA 3HFJA 2XVMA 1EB8A 3G6KA 2P5SA 1H4TA 4I2VA 2UZIR 4TOIA 5JVDF 2FZLA 3U4MA 3BRWD 3S27A 3TW8A 4M49A 3EX7C 3KXKA 1V5WA 4NDNE 5IRCD 2ZUUA 5JVDA 3I64A 3QLUA 3BE8A 3A9UA 1V8DA 2A1UB 2VDKB 2OQRA 1RJ9A 2GVNA 2CFTA 2FN9A 1T8PA 1V8PA 2AMFA 1ZNXA 1GLGA 1TQ6A 4PBRA 4BNNA 2B78A 3PC3A 4M7WA 5BN4A 4DIFA 6GPBA 1MO6A 3N7UA 5BPHA 1M8JA 1Q3TA 5C7IO 3BX1A 4URUR 3NGXA 2E1PA 1WV0A 1QHSA 3X43A 1INLA 2PT5A 2V7WA 3SF8A 4J2OA 1T3LA 4OKIA 2DFDA 3TD2A 3CMCO 1T9DA 2WWHA 3TVDA 3ZV3A 1NFQA 3A9VA 4MS4A 1OLXB 4GF5A 4C2TA 3ROMA 5EJ9A 2Y0BA 4E21A 4IRMA 3CHYA 4CM4B 1L5NA 1Z3IX 2CFOA 5IM4F 2WF5A 1MABB 4I6EA 5E9AA 4YCDA 4LYDA 1GILA 3ZNPA 3TEMA 3HH8A 4EZIA 2EFEB 1SCUB 2IIVA 5I6DA 5DBHX 1JHZA 4I0WB 5KHLB 1NT4A 1XNHA 1RLUA 4C76A 3PC2A 5FR2A 1LK0A 2OYSA 3RBXA 3WK8A 3U7QB 3LDGA 5A9RA 3GH1A 1MU0A 1I3OA 6LDHA 3KWJA 2ZUCA 3VKUA 1AS0A 4PIPA 5DNVA 3FPAA 3QTLA 1Y7HA 5J4YA 2JHFA 2PKWA 5D3ZA 1Z25A 3WGYA 4KO8A 5KYYA 1QR6A 1WDKA 5A7GA 1NYRA 1PZEA 1T4DA 1GTMA 4L27A 1MC1A 2EXXA 2YS6A 1QIHA 2ZRJA 1Y0BA 2AC2A 1KH3A 4TZ6A 4QJ5A 2G70A 4RHXA 4HX5A 4RD6A 1D09A 7GPBA 1YE3A 3UANA 5IKMA 1IONA 3N53A 4CKEB 5ALDA 5DBFA 2OXEA 1E8NA 3V2GA 1JECA 3UZUA 3CO0S 5CW1A 4Y6RA 2IZ7A 1E0DA 2CDRA 3W5SA 1D9XA 3GFSA 4DZZA 5IDQA 1FUKA 1ISMA 2EX4A 3V6LA 4DVJA 1IN6A 3UWPA 2FW1A 5JWRA 5F3WB 4EUFA 2W2QA 4K8OA 4HVLA 3LDFA 3Q40A 4KOAA 4F6RB 4YROA 3CKLA 2FRVA 1LFDB 4TM7A 3KDSE 5FBWB 4JI6B 3L5OA 2AG6A 3ROQA 1XTTA 4RXMA 5LUAA 4OI2A 2HL6A 2RGXA 2B6HA 1ZIOA 2DQKA 2DSNA 3H11A 4TUYB 4JUFA 2FXIA 3V1UA 3WHKA 3E9QA 1QRUA 4Q4JB 3KO8A 1LWNA 2OBNA 4GP9A 4KHZA 3WI7A 4D9KA 1IDOA 3OIGA 5L40A 2HW8A 3HYSA 1Z0FA 2PJDA 3D3WA 1V9SA 1W30A 2C0QA 3QELB 2A9FA 4YRMA 3E3AA 2HKIA 2RBKA 5IFKA 4S1OA 3LOQA 3HADA 3X1KA 3B70A 5DLDA 1DEOA 1M0SA 2WKSA 1KMCA 1OX4A 4Y98A 2YWFA 2EERA 3O92A 1VCOA 2DPMA 4DKXA 1M2WA 1ZK1A 4JBYA 4YCBA 4ETWA 4Y8VA 3AIMA 2B25A 2I3AA 2CCKA 3RLFA 1XTBA 1ZLYA 2ZS8A 3RTDA 3ZZNA 2R3SA 4NAHA 4Y9SA 4IBOA 5AKGA 1VP9A 2EYUA 2XQFA 4J7AA 1UOQA 2EFHB 3GMIA 4EFDA 3KYCB 4LMBA 3Q0TA 3I53A 2WD8A 4IDCA 2HNAA 2Q2OA 4ZCQA 5HTKA 1T8UA 5BNZA 4OA8A 3WOHA 1ESDA 2IBTA 1DLIA 4RAOA 4D42A 4D8WA 3S5JA 3F73A 1YBVA 3CE9A 2ZYGA 3KR1A 3WWDA 1F14A 2P0AA 2W2KA 3L1VA 4UUMA 1X1BA 2P9HA 3IAM6 4GOJA 2NU8B 4CMIB 5JBNA 1EFPB 4PRZA 1LW6E 2CGEA 3D2BA 4RSHA 2FX2A 2HIGA 5K8VA 1IZ0A 1L4GA 2WHPA 2YWRA 3U62A 4XSGA 3WNCA 1P3DA 3JQFA 5ICGA 2GZ2A 4NBUA 3AHEA 1OX6A 4TWIA 5FUWA 1D7OA 2OZKA 1CHNA 8ATCA 2B4KA 3MBKA 2NQTA 3WLHA 2I4IA 4AY2A 2I3DA 1Q1GA 3OEEA 3G23A 5CVJA 3AB7A 4GZ3A 1JJFA 3PGVA 5JZMA 2JATA 3HUDA 2H2HA 4EW3A 3EIEA 2Z1NA 4OL9A 4B3BA 2XDQB 5EPEA 3TI9A 1NBOA 4NZYA 5JDIC 1J0BA 1D2RA 1TLFA 2B9VA 1KK1A 4MGIR 3W05A 2PS0A 4N8DA 4EY6A 5TQ2B 1CETA 5K8JB 3DZ8A 5LLTA 1Q0ZA 5AVXA 4ODIA 5LOVA 2NPFA 4BJHB 3I04A 3SE7A 2QZSA 4OBEA 4U0JA 5FUYA 5EIBD 1J21A 4YLGA 1I3KA 4FNOA 3GUCA 3KKLA 2HOQA 3R6LA 1LSJA 3GIDA 2EV9A 5B3JA 1RABA 2CE7A 1CR4A 5DYYA 3TIIA 2BHSA 3Q7SA 4AAYA 4LFCB 4H7FA 4K1XA 4FCTA 2ZWVA 4UQPA 5B58T 1E5XA 1SKYE 3H87A 3F9CA 3MXOA 4JWKA 5ESWA 2AOUA 4LIPD 3N59A 3A14A 2CXXA 1HNNA 1IJKA 3GBSA 2XT9A 2GBPA 2HNBA 1O4VA 5K0JA 4XR4A 4KXVA 4DPMA 1L6RA 1ECLA 5JROA 1JXOA 2CHGA 3VVMA 4M37A 5L3QA 4FM9A 4AZVA 1Z88A 1NRXA 1XTZA 5EESA 2BT4A 1N2IA 2RIPA 3CH4B 2Q49A 1B93A 3LQ1A 1ZNWA 4MVYA 2I66A 5L95A 3JXEA 5JJKA 4CM8B 1X38A 2UUOA 3CTMA 1SXPA 4D25A 2O2DA 1EEXB 2IGTA 3RRBA 4G26A 2F1HA 2Q4EA 1BG6A 5LMZA 2AKEA 1NQUA 5DBIA 5KOYA 3QHAA 4IF6A 1KDTA 1U81A 3TH5A 3IR7A 3NLLA 3JAMA 1NX6A 5K3OA 1IOWA 1WB6A 4WQMA 4LXIA 2WP0A 1SC4A 1SCIA 2DWPA 3FUWA 4TQUS 1I0IA 1FFDA 3H1PA 1OI4A 2BI8A 1DB3A 4NE2A 3NC0C 4JIMA 5ALRA 4JGGA 4KDEA 1JAYA 4N6NA 1BJRE 3SYMA 2XXAB 1DLJA 2QLBA 1W2WB 3DFFA 3RAGA 3TE7A 821PA 4K86A 4B3HA 3GZNB 4PGHA 3EFHA 5ALSA 2YRFA 4UEQA 2B7CA 2J7KA 2W8BB 2D5IA 2OC4A 3GP5A 1CQWA 1U2SA 1S5PA 2X6QA 5FUBA 1WXXA 3MAJA 2AS0A 4TN5A 3WLQA 2COUA 1G5FA 1CFZA 2MYTA 1R64A 3D3JA 3OPNA 4WFJA 1C4KA 3RNOA 4C04A 1PX2A 3IDFA 3LQQA 5B64A 1KJIA 4IW3B 1FFEA 1ZPDA 4OL0A 1QAOA 1U3CA 4TYMA 4PPNA 3JRNA 3X1DA 1PIWA 1Y6FA 3K5IA 4G1MB 5EQFA 3X3HA 3ZD8A 5B55A 4A6EA 3D3EA 1BVYF 4BO2A 1NF2A 1PR3A 5DNEA 3VU8A 3QKSA 5D01A 4TL7A 4QKQA 4MNTA 4R3UC 3V2UA 3C5EA 5KIAA 1PVDA 4H6PA 1SN7A 2FP4B 1DAMA 3KFXA 3DOFA 3KYIB 4MVJI 5HR5A 1C30A 1E9EA 2FZ5A 4OQLA 2HK6A 2MYUA 1AUOA 5IJ0A 1VJ0A 2NZVG 2XNSA 3FVVA 4ZTBA 4BQIA 1K6JA 1NNI1 3LD9A 5JI2E 5A05A 4BXOB 1VJRA 1ONOA 3WL3A 3SZLA 1JV2B 4KR7A 2V3VA 2FSHA 3B1FA 5EIFA 1T91A 2M2IA 3P52A 4ZOAA 4QM6A 3W7BA 3ONNA 4B8YA 1MAHA 3GUUA 4BKQA 1T0JB 1AX9A 4JELA 1Z5GA 2XNDA 3ZXUB 1IUNA 3KKEA 4GI7A 2NNLD 4PZ0A 4TMTA 1CXZA 3RASA 4FOPA 5E3IA 2OAP1 4IRXA 4BVEA 4IV0A 4UMEA 1KAHA 3RFUA 3QV1A 2I6XA 2IDJA 4BCDA 1Q0SA 1E2KA 3KKNA 1JDPA 2AJCA 2YOHA 2PWPA 1Z08A 2RCYA 4QLOA 4AJLA 3HRIA 1WF3A 4LHXA 3ZWQA 2L2QA 1FTYA 3SE0A 4U7DA 2WTNA 2VTBB 1Z45A 9ABPA 3ABIA 3OZFA 5E95A 1BX3A 1GAQA 2GHIA 1O7JA 5HF5A 4IKEA 2Q7OE 4CMEC 2I1VB 1WUTA 1DKNA 3PNBA 9LDBA 3HJRA 4FUTA 4P81A 3DUFA 4PSVA 4REQA 2NO1A 4WX2B 4XQ9A 2IEAA 2QUZA 4AKSA 1JI3A 3KD3A 4UDYX 1NR1A 5T6MA 5JIBA 4PSDA 1M7BA 4HQOA 3UK2A 4P86A 4FYYA 5LDHA 1VMKA 3V2HA 1L5WA 5EZ6B 5BP7A 4JU8A 5IDXA 2OGUA 5FORA 4LZJA 2HO4A 1ZUWA 2YIVX 3D5EA 3PXCX 4C7KA 1YA6A 3EE6A 3GW8A 4J9VA 5ALMA 1XZKA 5FJJA 5DIZA 3FH0A 4OHKA 5DLPA 3AV0B 1T4GA 4NJMB 3RC2A 5LSAA 1YS2X 2Q3BA 2OXTA 2VJAA 4DG9A 2IA5A 3HB1A 3U3RA 1E4YA 4C78A 3E03A 5AVOA 3AEXA 5DI3B 3BFPA 4MKRA 2P6RA 1DJPA 4RTQA 2J9XB 2WVGA 1HDZA 1CDEA 2GGSA 2QAIA 3MWEA 2X8AA 3AEUB 3PSHA 4R9NA 4B0OA 4EHIA 3X1YA 2I76A 4F9TA 1T8RA 2E48A 2XPCA 3GJ7A 3SIPA 4KTTE 3MK31 4MRPA 4V0KA 1C4OA 2NO9A 4EOGA 3P9CA 2OHJA 2PUFA 1HORA 3B7WA 3RANA 4MJ3A 1R0YA 5H7XA 4HVAA 1P29A 5AXDA 1E3DA 2FPKA 1MV5A 3JASA 3UXEA 4Q1EA 4Y2TA 2C7OA 3DEAA 2OVBA 3TTSA 1Z15A 3PFIA 5CLQA 4XVCA 4MHOA 3R5SA 4XQ0A 5CA0B 2K87A 4G84A 1B00A 2Y1EA 1FUUA 1O8CA 5DX1A 2NN3C 4FXOA 2QK4A 3NDBB 2CN1A 3A06A 2H92A 1X7GA 1ZBDA 1YVRA 3LWNA 3CX4A 1TYZA 1KL7A 1GQ2A 4KAJA 4XIGS 2XTZA 4LV8B 4P0QB 1Q15A 2OHIA 2BI4A 4KU4A 4BB6A 3A11A 3G9ZA 4IDAA 4IPTA 3EGDB 3RJMA 4U2DA 3WLMA 1EUDB 2DT5A 3K9LA 4NIMA 3DE4X 2GCIA 3ACBA 3AUKA 3GT4A 1G4HA 3OE7D 2D6FA 1X13A 5DW0A 4XRGA 4TMKA 1WKBA 1L1FA 2VDVE 2H2DA 3FPCA 2FR1A 4X1YA 5D85A 2B8WA 3L7DA 2PGLA 4TYPA 3RJ5A 2C31A 4YAGA 1E89A 3K0EA 5FA5A 4GSYA 4DA4A 4IEEA 3V80A 3MRXA 1Q1AA 4RGQA 4YRDA 3G82C 4O4LA 2Y4OA 3HCEA 5DM4A 5HQTA 2Y1XA 4IS2A 3I9V1 3SEFA 1J70A 3DHNA 1B0UA 1A72A 2BSAA 3D31A 1A96A 4YGYA 1IUPA 4DXHA 1ESEA 4GC5A 2DETA 2GJ8A 4BLWA 4HD8A 1T0PA 4FDLA 4DSUA 4QGFA 3KEFA 4MAFA 4RNDB 4OF4A 3LY7A 5B3LA 1J00A 2J6CA 3HN2A 1ONSA 3I9V6 1E6KA 5EP4A 3ZHXA 2NTYC 3IBGA 4PCVA 1E1KA 2PD3A 3AHHA 5ALUA 5ILOA 4LOLA 5EEHA 1G41A 4ARUA 4EI8A 5B6IA 4HUJA 3K09C 4WCFB 1KBZA 2H4HA 3TQHA 3DO6A 4ANFA 1NOKA 1ZUNA 4ZVNA 3F46A 3W7AA 1BN6A 4BO9A 2QXUA 4BO8A 3WTBA 1OYOA 5IJWA 3WDKA 3L79A 3HKCA 1R9GA 1TM5E 2ZREA 3BSWA 4R5MA 5KYVA 3WYAA 2GM9A 3MUFA 5FR1A 4H4EA 2QY9A 1KMHB 1RFLA 3SEZA 3G68A 1IOLA 1S1MA 3P9RA 2PUTA 1FFCA 1XC7A 2RGGA 3FVRA 3JVDA 3H2IA 2BR4A 3U7IA 1KA9H 2V45A 4GO1A 1AV7A 1L7VC 4LTNA 2C7BA 2ONKA 3CMMA 2F43A 2ECPA 4GLOA 2HWUA 1JHYA 4KUHA 4OXNA 1LX6A 1ZX1A 4G8JA 2W70A 2VHYA 3UH0A 4DXDA 5IJ9A 2YJ5A 1Q3KA 1IHPA 2WJVA 2Z83A 4XQEA 4AP6A 1RLMA 3U44B 2F1KA 5CFRA 3G3EA 3M2TA 4FFDA 1X70A 2PGOA 3L7NA 4M1QA 3MINB 3EJWA 2A3NA 4HJRA 4O8CA 3I5UA 4L28A 1DTEA 5BR7A 4DLVA 3AL3A 2QUAA 3FOFC 1Y1KE 2FEAA 5F52A 3U0VA 4C6TA 3MTAA 2UYCA 4BNIA 2QZJA 1RM4A 1DU4A 1MPTA 2YXDA 3LP8A 2BEVA 4W7HA 1WY5A 2HQOA 4OYRA 2C2OA 5AJUA 2C4WA 1B6TA 1JJ7A 2BR3A 1ZC4A 5DNWA 4DC1A 5JRZA 3GGGA 4DIMA 5C4GB 3DNFA 2BKVA 2H1LA 4NK5A 3H5RA 1KORA 2GZ3A 3CJRA 1OFGA 3GA7A 4HGNA 4TVBA 1DAOA 5L7WA 3DLCA 3H9QA 4E5PA 2XQVA 4XUGB 1BGXT 2O2IA 4GPBA 4B35A 5JT1A 4ZALA 1USKA 3L7JA 4BUCA 2QL9A 3K0HA 4X7MA 1X7HA 1D0IA 1FE8A 2HPZA 1Q12A 3A3KA 1KFBB 2GAOA 3BBLA 3WWPA 2PUJA 1OU0A 3IAFA 1NBMA 4EIWA 3WS7A 3ZWKA 3P2KA 3DV2A 4QTZA 2Q1TA 3D59A 3LG2A 3ER8A 1CVLA 3SDSA 4YRZA 4NARA 1PT5A 1ZI8A 3M82A 1PBNA 3JVVA 3AV3A 2J8ZA 4XAQA 5KSYA 5HIJA 3IUNA 4GDMA 4WGGA 4N39A 4PSUA 3MJCA 2R8XA 2WT9A 1JS1X 4A26A 3E05A 1XEWY 4GX2A 3I9FA 3ED5A 1P8AA 4GMXA 4I6JA 3WGLA 2GPWA 2VHZA 1DUSA 3JAKB 5DNUA 1W35A 3FWPA 4US0R 4HXFB 3BDAA 4HGQA 4ISBA 4GM0A 4UTNA 4EECA 1DKLA 4LBWA 1P0QA 4BAUA 2JAWA 4UEJA 2QJTA 3MQ2A 5H83A 1V2GA 3ET4A 1UC9A 3KHSA 1C7ZA 4BP9A 1NJFA 5DWVA 4YAKA 4C4SA 1Y5NA 1FUYB 4M1TA 4PZDA 5EG5A 4QSMA 1F06A 1ZA1A 2JLZA 1Y9EA 1Q11A 1QVAA 4B46A 1OB5A 2A88A 3GMSA 1QCYA 2HQBA 3BUSA 4HRVA 4JC8A 5F2KA 5I7SA 3V9PA 2P2GA 1E2JA 1D07A 3OCCA 1CRZA 3Q0EA 4K8RB 4MULA 2NU9A 5IVIA 1QGDA 2PCLA 3H97A 4CMJA 2MSNA 3IHKA 1JB1A 3KQYA 4GYJA 1MC5A 4YT5A 5JRDS 3IXLA 3CV3A 1TT7A 1TKBA 3PTAA 4Y1RA 3CH7A 3IERA 2PZGA 3OU2A 5FTJA 2X0DA 4BNUA 4GIBA 1XNGA 3UOAB 4JR1A 1BDIA 2OESA 2YICA 5F9MA 4GHWA 4ZT5A 3CSUA 2ZQYA 2GYYA 2QTLA 4W5QA 2P90A 4X6XA 4OXXA 2QQ5A 5ALJA 4EG5A 1JHAA 1W76A 1GFIA 1FLAA 1WXEA 1Y3IA 2FMIA 2REQA 1I36A 3ESCA 4KKVA 4Y2JA 4FOLA 5C34B 2J0EA 1J5XA 1WU8A 4KIJA 3RVKA 1YC5A 2DBVO 4RE5A 2G1AA 4MEJA 4M86A 2P77A 1LJ8A 2H4ZA 3Q2OA 3UXHA 2MMCA 4DC0A 2A1TS 2AFHA 2IYNA 2XA2A 3I4FA 3O21A 4QAJA 1Z0UA 4HRAA 1ZGBA 4LAFA 3PJRA 2ORIA 1M2OA 5T3YA 5CX1A 1ZZGA 2M6SA 3G2OA 4O2BF 4RM3A 4M0KA 5GIOE 2C9MA 1GZ3A 3N3AC 2X19A 1LPNA 2DHDA 2MT9A 4Q03A 4MO9A 1UPFA 2EEZA 1TTPB 3E8XA 3DG9A 1RWBA 4XFDA 4A8JB 3EPLA 2C7QA 2VZLA 2IYPA 1CHDA 2HA7A 1E2FA 5EQTA 1M2NA 1MB0A 1AQJA 4RMNA 3CC8A 3HCWA 2X9GA 1A5AB 1DXHA 2BVNA 4EGAA 2X9QA 5M29A 1XD8A 1N0UA 4OH1A 2CJFA 2Z56A 2J3LA 2WJ4A 3EK2A 1OI3A 1JEQB 1YZGA 2GNAA 1WHTB 3FDJA 1DJNA 4GGMX 4LI3X 3HMKA 2JBWA 1T2EA 3AWDA 1SUEA 3Q8KA 2HR1A 1H8EA 4RKWA 1N6HA 3TRJA 1ML3A 1Z6PA 1E1CB 4ZJYA 4IWYA 1Y34E 3ANYB 2WB2A 1W75A 3LCUA 1IN4A 3DYVA 3PWSA 4E03A 2CZCA 1YMVA 5HFAA 1N2JA 5COAA 4WXHA 1GZDA 3Q15C 2H9IA 4ZYYA 5ITWA 2KLBA 3AGPA 3ASUA 2BWJA 4KDFA 2YX1A 2C2XA 2Q27A 1MQSA 2R85A 2QPLA 2Q3EA 3PGMA 4PPFA 4UD6A 5EWMB 3PQ4A 1K4MA 4DV3B 2GEUA 1IN1A 3NASA 4L72A 3TLEA 2WAYA 2VDWA 1F2VA 4EVIA 1T3SA 3V1MA 1JBQA 3T1YB 2IWRA 3L0YA 4B76A 2O2CA 1U3FA 5AICA 5IBQA 4ALLA 3JCZA 4FDMA 4CDNA 2J9RA 4UPDA 2E49A 4O4JB 5K1ZA 3GPBA 4KFUA 1A88A 2G9NA 4DCGA 2WFLB 2GEBA 2ENWA 3MT7A 3D1LA 3FKSD 4MQFB 5ELXA 2DUWA 3VV3A 2C4MA 2IT1A 1B26A 2XNKA 3C4VA 4RC9A 4D4KA 4OHZA 1P1BA 2OCIA 4JBLA 5HFNA 2GJ4A 1G9TA 5KC8A 2OMKA 3O8QA 1RRMA 3PNMA 3WHIA 1L1QA 5ECDA 13PKA 2YXBA 2HMUA 3QVMA 3TLJA 2QDXA 3HCCA 4PQGA 3EC1A 5ALKA 3BIOA 2EWWA 3L6UA 1A69A 3ST7A 2P2YA 1EK0A 1P17A 1RPAA 4WWHA 1H66A 4LWPA 5EMHA 1Z4LA 5I9BA 4B3SB 3I0ZA 1L4MA 1PZXA 4IIDA 1B41A 3IYLW 4AVYA 1XOIA 1DX4A 1PG2A 3GH3A 4UPVA 1PNOA 1KAQA 4NG5A 1CULC 2FEXA 1WDWB 1J1IA 1A9TA 2GCOA 2HQ1A 2O1XA 2XIJA 4UCXA 1G8HA 3PVZA 3L2OB 4EEZA 5LQNA 1N8NA 4DCTA 3RQSA 3IEPA 1SU4A 4M8SA 4ZT4A 5SZIA 4EKNB 1ZJ5A 2VPYA 2Q5FA 2WYWA 3ASVA 2XODA 4IWXA 2OCXA 3N2EA 4KXYA 4M22A 2EVWX 1RJGA 5FJIA 3KRTA 3T0FA 3LC0A 1UEJA 1GUAA 5AVZA 3AR5A 4G9BA 4F11A 2QI9F 3U5ZB 1PVVA 1JRLA 1G98A 2CYAA 2J9GA 3PQ2A 5IYZB 4QM7A 2RB5A 4DV6B 3DGEC 1ZVJA 2YV1A 3M9WA 4Q3NA 5AVKA 5EJFA 2R25B 3BVPA 3CLSD 4KLZA 1IY0A 4PX3A 3DDSA 4XD7A 1EXDA 1M1YE 2P2LA 4ZEVA 3S29A 3HWSA 2IU4A 1ECGA 1SWWA 2RC5A 3QE3A 2AX3A 4US2R 5F1YA 1S3SA 3EQ7A 1XU7A 2LW7A 2A59A 1T4CA 3ICQB 4ZARA 3I61A 1Z07A 1M8GA 5JQGF 2WKRA 3QF7A 4MB0A 4YQEA 4A8JC 1HBJA 2XYVA 1G0NA 1EFLA 2IQ5A 3BMOB 3H75A 4HGYA 3OUUA 3RSCA 2QRZA 1DAKA 3IT3A 4GPZA 4I4IA 5T3UA 3UXMA 2PGNA 4BEWA 2G6BA 4YX9A 3EG5A 4MP8A 4X93A 3HKDB 1DCTA 3GCDA 4LDNA 1N5DA 2W6JA 5AXCA 3P32A 3MTDA 1QG6A 4RFVA 3D6AA 1YA8A 1ORDA 2BFCB 3CYFA 3HDVA 4H3VA 3ZW7A 4MQ5A 2I29A 1SQGA 3TZKA 2W93A 4YALA 2YCBA 3N3BC 4GH5A 4S24A 5ALNA 3ADKA 1RYYA 3CKKA 2GARA 1N1GA 2ZT6A 3G49A 4IEFB 3NDIA 5KJCA 1DELA 5F9FA 3NH9A 3W8RA 2W0MA 4G24A 2BELA 2QLFA 3MCTA 4QUEA 2ZVDA 3N2YA 2JCGA 4RETA 3WZMA 4BNDA 2WHQA 1DIOB 4ADSG 1IY9A 4XJXA 1KZ9A 1W47A 1J2YA 5H80A 1XB2A 1RM0A 1L5HB 3D5QA 1YVDA 2NU7B 2VJPA 3M49A 1KDPA 4J0DA 2G0TA 3GC6A 1Y1PA 3PUVA 1OZ0A 2CZQA 3CS3A 4V1CI 3MLBA 5TC4A 1HNZB 4AMVA 2H1FA 1DMRA 1NXQA 2J48A 2Y92A 4OI0A 1THGA 1W94A 2WHRA 5KTOA 1MC8A 1VYUA 5IKOA 1DINA 2K5UA 5A5VA 4YJ2F 1E60A 3ZVLA 2NU6B 3A1VA 3AIKA 3NW9A 4RJTA 2MINB 5BVHB 4LZPA 4WZBA 3HP7A 4CMCA 4YJ2A 1XXHB 5CFNA 3WZLA 4F2DA 5FFNA 3ZK7A 1DE0A 1E7WA 1TZJA 2GCPA 2ACWA 3HXMA 3DFKA 1VJDA 3VNAA 2ZBDA 4DSNA 3EMKA 1ZOIA 3HO1A 1CZOA 4JJGA 1SVKA 5DHQA 3QBJA 5J47A 4M0UA 1E8DA 4IICA 1W36B 1YS6A 1PWEA 2Q3CA 2FGKA 1FYVA 3MMSA 3AKYA 1LQTA 2QLNA 3Q5GA 3CKMA 3NDRA 3EZNA 4QQNA 4BUZA 4EITA 4RY2A 5K5EA 4D44A 4F5DA 4E51A 2YY6A 3HCOA 1SUSA 1JQKA 4WKNA 2EJTA 4CL2A 3ETLA 1OF1A 2V5VA 3GYBA 4NPAA 1K5DA 1UJ2A 1EVIA 3OX4A 4F2GA 4LHZA 4G0YA 2EKZA 4RA9A 5CAEA 2VLIA 4DIBA 5CK4A 3VR5A 5KNBH 3CVWA 2ADOA 3DL2A 4IMPA 2D2VA 3QM1A 2PZFA 2QRMA 4C7MA 1CRQA 1F0KA 2NP6A 3VX4A 4QXOA 2AYZA 3LL4A 1VXRA 4HBZA 3NPMA 4IG9A 1ETUA 1V16B 2OOKA 3GWZA 1MNAA 2QNBA 3HA7A 1U8XX 3OHPA 4P7JA 4Q01A 3NHUA 2C3MA 2J09A 1KFEB 4B4OA 1ANKA 4JVLA 2D1YA 4MQBA 1UXJA 4TRRA 1CJSA 4ARZA 4OI1A 2ZSUA 2Q46A 2IOHA 4CGYA 3KSAC 1NNSA 4QOHA 4EQ6A 1JR3D 4J3JA 1ZCJA 3EC7A 3DOJA 3IRVA 2UKDA 1PNQA 2WUDA 1G8MA 2OSBA 3K0FA 3SHFA 4CLOA 4G5OA 1VSQA 4P3KA 4BZQA 3QKRA 4FYMA 5HXAA 1XLUA 2E4UA 4GZ5A 3W4IA 3WJAA 2CXHA 3QLVA 4UJ3A 4XASA 2WMYA 2CE2X 2AQIA 1SH7A 2X2PA 1UQRA 3E58A 4MUYA 3VVLA 1UBGA 3HCDA 3Q3EA 1VG9B 4KRYA 1J2UA 4S1VA 4LXQA 1P2BA 4JVOA 2JBHA 3LS2A 1NASA 4UFOA 4XM0A 1D8AA 1P2SA 3AERA 2ISQA 4Q7QA 1AXRA 2QM0A 1Z62A 4J7XA 4BLPA 1QOQB 5HKBA 2GZRA 1QQAA 2PV0A 4R1OA 4C7OB 1I4DD 3QYAA 1L4HA 1P81A 5JYBA 4U3JA 1J5EB 1WXIA 2LD4A 2VA9A 1DRUA 4FN5A 3PWTA 3X1WA 2EJUA 3K4PA 4JT4A 4NBLA 4LN1A 4JT2A 1NM5A 4AQDA 3Q5EA 1OREA 3E9ZA 3E5HA 2OK8A 3K0CA 1N5OX 2ANBA 1IY8A 1P3JA 1KVRA 2Q5IA 2YFYA 1IAVA 2PWZA 3JWEA 3QA9A 4HLNA 2O59A 4L9AA 5BN1A 3W6UA 4JU9A 3T1HB 5JUWA 3T0IA 1R8SA 2WJPA 3UK0A 3NYQA 4AKIA 1MT0A 5K0ZA 2FF7A 3D1JA 3T3NA 1ADGA 3BTOA 3BFVA 4DA9A 4TKUB 4N0QA 2NXCA 5CHEA 4CRWB 1QIFA 3B6KA 4M1EA 5GGYA 4PLPA 1A9YA 4YJHA 3A1FA 4PS0A 1XCPA 4I08A 1B14A 4Q05A 5MGBA 4W5TA 2JRLA 1MZPA 3DVLA 1EE2A 2FMUA 3ITDA 3SI7A 1SZDA 3KEMA 2ZK7A 3MFYA 4HPWA 1H6BA 2OGWA 4KPGA 4B1FA 2BSQA 1PFQA 1WXFA 5DM1A 3PYLA 2CYCA 1UQUA 1O6FA 2H2AA 3KKKA 3HNRA 3PPVA 3W3AH 3OTIA 1JDTA 2D2EA 4J2TA 3GUHA 1DDGA 4KNWA 1O1YA 4QULA 1SOWA 3G13A 4X90A 2X4LA 4FMDB 1U9JA 5CDGA 5CG1A 4DV4B 1PVOA 3GD7A 2WLTA 3I05A 2QSJA 1UMCA 1WSDA 3LQFA 1Z4PX 1YZNA 1SBCA 1FU8A 1XF9A 1GHTA 2IPMA 4FFBB 1Z6ZA 4DE5A 1W36C 2RJ3A 2V0CA 2Z5LA 3UMCA 1T0HB 3NWBA 3TB4A 4CEJB 4XGRA 5C1BA 3FYHA 4Z86A 4E2FA 3CY6A 4XIFA 1P19A 3H6HA 2Y8EA 1JILA 2NLOA 4JI7B 4HVTA 3MW8A 1FJHA 1GNLA 2SKDA 1II8B 1DAHA 1FB5A 3ZXXA 1Y3BE 2AYXA 3R24A 4EYGA 1KQFA 1C4XA 5C5CA 1QGYA 4Q7JB 1GQSA 3I72A 3T3OA 4MA4A 5B1DA 1BEEA 2PA0A 5HFJA 2FFHA 4UBJA 3R8FA 4UVDA 3BWVA 4DEVA 1YL5A 5HJ5A 1SQFA 3KQTA 3KYJB 3HQ4O 1XNQB 1D0SA 3WX0A 1ENYA 1XALA 4RW0A 3RIMA 4EPRA 1M54A 1WE2A 1XJQA 2JFGA 2WWFA 5B7NA 1P7WA 4F6CA 1F7UA 2AQKA 1E9SA 1YQWA 2PX3A 1CY7A 2WICA 2ZE6A 3A3OA 2Q2QA 1G8JA 2LDBA 2VQEB 1DXYA 1NBAA 4HNUA 1CUEA 3AF4A 2VWGA 4HAYA 4X6UA 3QFFA 4D92A 1Y48E 1ZICA 4MPPA 3ZX4A 1FRZA 3AETA 3H0CA 2EW1A 4AF8A 3TL3A 2WTEA 3MXTA 1RKQA 3IPYA 3UJ3X 1N25A 2HV8A 5KREA 2IV2X 4LDAA 2Z6VA 5DE3A 2IFTA 2Q3LA 2B2XA 5CMLA 5AHWA 1DAPA 3U61B 1WVGA 1U8YA 1VBNA 3GRYA 4GVLA 5TPWA 2BDUA 2JFXA 2ID4A 3ZQKA 1ZINA 3QNMA 3RVJA 4YRFA 4LC9A 2ZKLA 4B7AA 1T3TA 4IJ6A 1EFHA 4D9MA 1PJAA 4RY9A 1TD1A 1RYDA 2HM7A 5DLEA 1T9AA 2ODNA 3N6XA 3F6SA 3OA0A 4R7TA 5LLSA 2H4XA 1USVA 2FVXA 4JP3A 4UTVA 4MV3A 3EEBA 3JQ8B 4RL4A 2H4JA 1WVMA 2JDID 3R9XA 1Y4ZA 3TRDA 1VSUA 3ES9A 3D81A 1Z38A 3HP4A 3M6FA 2PO5A 4OXRA 3ZCVA 1VHTA 3CINA 1FUIA 2FZVA 4OEHA 2X1LA 1HNXB 4RFLA 5ALXA 1ZD9A 3R5JA 2ZGVA 4KE6A 1ZUIA 4WK6A 1DDIA 2XD4A 1J2EA 4UE3S 3BIFA 4IQFA 1YGPA 4IOLA 3V97A 3K2QA 3MZ0A 2GYWA 2HJVA 2GPNA 3U1VA 3WQQA 4DBLC 2F62A 4GI5A 2JFVA 2JFFA 2ZAMA 1M7HA 1X7ZA 3T7DA 5JSQA 2ZEJA 2GJKA 1X7XB 1GXSB 4MQ6A 4V0QA 3DAHA 4NCBA 2FSFA 4NXMB 2JFHA 4P08A 1EMDA 2DMRA 1VG1A 1HOXA 3DJFA 3MJ4A 2PUVA 1KI2A 3SK0A 1MFZA 2SHKA 1ZVQA 2RGWA 4KYIB 4IEIA 5ULLA 5JAZA 2PT7A 1Z83A 3MGGA 3I3OA 5TV2A 1CEYA 2XKKA 1O97C 3WNVA 3INYA 1OKKA 1IC6A 3H8WA 1QQ5A 1XZGA 4HGPA 3BJIC 4EY3A 2ZSBA 3EZXA 3HFGA 1A98A 2PIDA 2QQ0A 1T5DX 1VL6A 3K5WA 2PXAA 3P2JA 4NESA 1HDYA 3A4LA 3NNDA 5BQXA 4LJ7A 1Q95A 4TTIA 1LNSA 2XI4A 4FD2A 4L4SA 4QARA 3ZU4A 1VCIA 3BYZA 4EARA 2YZ7A 2X0EA 1ZK2A 3KT3A 3NANA 4LDQA 4M6WB 4X95A 1NW7A 4TSFD 5L7YA 4C6RA 2PX6A 2YNMC 3V4ZA 2EJBA 5LZ5A 4C3VA 1YASA 4N3BA 3I39X 3NIBA 4MIKA 1Y42X 2D13A 4JC0A 4XUEA 4LOHA 2PZLA 5FO0A 4QPPA 3KQOA 2FZWA 2XMDA 4EJSB 3FDZB 5I7RA 1QK5A 1O6BA 3NYWA 1KP2A 3O5AA 5DGHA 4YPFA 3M70A 1H4SA 4JFAA 4YRNA 3S1AB 1ODLA 4MDFA 2EW8A 4XUCA 2QXTA 3T9EA 1AV6A 1TC2A 1ZRSA 4Q39A 3K9BA 5AK0A 2D2IA 5E2BA 4F4UA 1TUBB 2ZYRA 1T5OA 1D2CA 2IYVA 2QDKA 3AFOA 3E81A 3I30X 4AYTA 4WLUA 3ZIDA 4WPGA 3FTCA 3JWGA 1WM1A 2G5TA 4J7CA 3RJTA 2REBA 1FTNA 2HUNA 1XBTA 3N0WA 3HJCA 4MINA 10MHA 4TTAA 3ZDBA 1OLXA 4KDRA 1DO8A 4MKGA 2QE7D 3FXAA 4QVGA 3OD5A 5KVCA 2NUAB 4ZDJA 4X00A 3SC4A 4LOIA 3N39C 2PLNA 1I4LD 3T3MB 4CM4A 3K31A 2WMNB 2WG1A 3LVQE 4S0ZA 3LECA 1ZI6A 2XWPA 1MABA 2WU4A 3C7KA 2X8LA 4HAOA 4P4SB 4R8LA 2ZBPA 2P4SA 4RKFA 4ND2A 2ZR7A 5TGTA 1H8HD 4JX9A 1GA4A 4JYMA 1SCUA 4C08A 4KHPB 1UR5A 4G0ZA 4RS3A 4HB2A 1KBQA 1JR2A 2ZJFA 4MUBA 1PGQA 1FDTA 2B34A 3CF4G 3P0RA 4HYEA 4MPDA 1P1HA 3C5WP 5JMOA 1H6AA 3U7QA 1KZ1A 1LLUA 3M6UA 2JLUA 2R6JA 1K7SN 1KFJB 1E2EA 3RK4A 1HOTA 1FP7A 1OASA 3HPRA 3CH5A 3R4CA 1ZR2A 5HEKA 4CMHA 1ODSA 5E2IA 1GKIA 4JOCA 4BQFA 2OMEA 2ZBVA 2QP3A 1D1TA 2C0CA 2HMAA 5H59A 4BLUA 3DKIA 1RPJA 1XZHA 1ZCAA 2OKGA 2P9EA 1DIHA 2VNHA 3C43A 1IXRC 4AUMA 1QQTA 3O2SB 4PCLA 4QECA 3QUTA 3SM3A 3UT0A 2BGWA 3CFYA 3P2EA 4WNCA 4RVDA 2EZTA 1PZMA 1SHKA 1C1DB 2HA5A 3OJXA 3JYQA 1PJSA 3GK3A 2XMRA 1X7YB 3I6BA 5FNVB 4CKEA 1E3EA 2PYDA 2ZXEA 1L2TA 1Q50A 2HGZA 2HTEA 2XMPA 3UAXA 4ACAA 4KPFC 1R3DA 3OZIA 1BWPA 5LQJA 1UT5A 4PICA 4QOEA 4V0SA 3ZV5A 4WFQA 4A10A 5F64A 1U3VA 4E08A 3LA6A 5ALFA 4YRRA 2VJMB 1I4TD 1DOHA 1YJ5A 1KVSA 3BXEA 4F6RA 4TUYF 4XLLA 5FFFA 1HH4A 4LSWA 1RQRA 3AIIA 3FSJX 2PZBA 2PJZA 4NDZA 2I1WA 2IPLA 1TA9A 5LP1A 3C7CB 1C3JA 4TUYA 2PKYX 1ZHOA 1EDZA 1PZGA 4IZHA 3L0BA 5FB3A 5K2MA 4GXQA 3WGZA 5KTSA 5KYXB 1YU9A 2AOWA 1E3QA 1DAEA 2XE8A 4IM7A 1N8KA 1YGYA 2CXOA 2W2OA 1T26A 2FI1A 1HYBA 1OROA 1U7HA 1XXHE 2PL5A 1IH8A 3UENA 3S81A 3D2AA 3QKWA 2WTXA 1YS1X 3QELA 3EWAA 2GZHA 4S3MA 2YW2A 1GCGA 1K7CA 2A58A 3NM5A 2XB2A 1P2TA 1R37A 2A78A 4XDZA 3EGEA 3VYUB 4RMIA 2IH5A 4YAFA 3T9DA 5I4IA 1XTRA 2ZYSA 1UIRA 1FVHA 3MJEA 4IVQA 3H19A 2J46A 5LWQA 4YP7A 3SHOA 1TM1E 4O4IB 1QZTA 1FLNA 4GEKA 1MT3A 5G3ZA 1PL8A 2Y4NA 2J0SA 4EENA 3JRWA 4MYSA 5DBOA 5KQSA 2A9VA 4TZ0A 3IQEA 3L4BC 4YN3A 3BERA 4QG7A 2IPAB 1H5UA 2OGZA 3HUTA 1SURA 1YF3A 1CD5A 5JAPA 3R40A 3CWZA 1M6VB 1AC5A 1PFGA 1ZGGA 2G5CA 3G0IA 1NIJA 3A4IA 4KSYA 3W2HA 4EJSC 4EY4A 4GBJA 1E9BA 4XIIA 4TV8B 1XAGA 2HU7A 5JG7A 2Q3MA 2QN9A 1U9ZA 1KI8A 3KZKA 2NSDA 3C16C 2QRQA 3EFOA 4IMRA 4P4NA 3C2QA 4UHBA 4Y6SA 3UMRA 4COKA 3FOEC 3K9CA 4CMIA 3GHYA 1EFPA 2FUNB 2XCOA 5THKA 4Z7OB 1JN0A 3EG9B 4NG4A 1BFDA 1WABA 1YONA 2B69A 4UMVA 2XTNA 4LE2A 1BQ4A 3GEPA 4JP2A 4UDOA 2R5WA 3F6BX 2R97A 1FSZA 4DC9A 1JPNA 4L95C 2DC1A 3VZBA 4XFKA 3PZRA 1AMOA 3C7TA 2I1LA 3PC6A 3IS3A 4MVJF 5TS3A 4IKPA 1RRVA 4YBZA 2GA8A 5AXAA 3CVVA 5CNKA 2MDTA 4TGLA 5CXXA 3ZE2B 1OAKA 1ADBA 4MVJA 1KSHA 2DYKA 3DXYA 3GRKA 3CZCA 1RIIA 2EWVA 2AOXA 5A9TA 4B3MB 3GJ8A 4FQ8A 3BA6A 4PANA 3UVEA 4CW7A 5TQ2A 1Z8FA 1I2CA 3F6EX 4MYTA 4CEIB 1Q22A 4NCIA 1VA4A 2ZROA 2W6OA 3TTXA 1V3TA 1X1AA 3IAAA 2GKSA 3LM8A 1SO8A 2QW1A 3DEZA 3SYKA 4UTPA 1RRFA 1VPLA 3OT4A 4PC2A 3QXCA 4CL8A 3RAJA 3ENZA 3A9WA 1ZN7A 4OJQA 3IMEA 1ADFA 2X77A 2ZWMA 3C39A 4UHEA 1IK4A 4ZPXA 1E6UA 4E09A 2FTKE 2FAXA 1SB9A 4X45A 3FPGA 5E7MA 521PA 2C8LA 3KDAA 1B2LA 1F48A 3VBCA 5JH7F 3BXZA 3FD8A 2RH9B 1AGPA 1RSZA 3F6PA 3EGVA 3ITKA 5T8KC 3H83A 3CNBA 3GGJA 1W5FA 1U1DA 2YJTD 1IBSA 1JQAA 4LOAA 1QO7A 1QPGA 2QRHA 1YI8A 4OQXA 4PY2A 3NTOA 4RVGA 4QUGA 4RIGA 5KMGB 2BFDB 4DNFA 4K40A 1JG4A 1SPBS 4AKEA 5I9NA 1ACMA 2RK3A 1IL0A 2ZQZA 3BL6A 3FGOA 4WXYB 3DL0A 2VTVA 1BHJA 4IXWA 1F1JA 3FAKA 5DOVA 1ZK3A 5CFOA 4HQFA 5I3ZA 2YWXA 2IDKA 3BJEA 4CM8A 2PYZA 3QJ5A 3RPEA 3SNKA 3MT0A 3U9LA 4QU9A 1L5GB 3TNJA 4Q9IA 1WG8A 2VZ8A 3FYCA 3PUJA 1PEKE 3M89A 2CL5A 3TLZA 3U3ZA 2Y1GA 3STWA 4CV0A 5AVWA 3EGCA 8MHTA 3D6MA 1S3GA 1T35A 2O06A 3DXZA 2EZ4A 4A16A 3DCYA 2QMQA 3OURA 4G5HA 4B4WA 4QT4A 3ENNA 2BM1A 1JQDA 4JUIA 1YDWA 3ZWDA 1IULA 1VMIA 4QT0A 1SXJD 2WV7A 4XB6B 1D2MA 3B9RA 3TWOA 2VT7A 1PSDA 3EQ6A 4B74A 1PT6A 1G8FA 3X2EA 3ABQB 2QTRA 5LA6B 5BSUA 3ZIUA 2R11A 5AKEA 2XXAA 1HL7A 2BUAA 4KV7A 4HX2A 3MQFA 1I4OA 1BQEA 3GZNA 2PDAA 5GIPE 3E9EA 2DBYA 1OAAA 2ZUSA 5AXBA 4BFVA 5F7OA 4YCNA 4JI4B 4BMYA 2EEPA 1BWRA 3LBHA 4S1WA 3ANSA 4OJTA 3TX2A 5GTDA 5EIBC 2PH5A 3LCRA 4DA8A 1UF9A 2BMVA 1GPMA 5AOBA 2ZBFA 1XROA 4Y6LA 4QOFA 1W25A 4BIIA 1T9HA 4ME6A 2ZJZA 1J8MF 5CLHA 4RACA 3AJDA 3RFFA 2WIKA 3PQDA 4EG3A 2LR0A 4FIZA 1WKCA 4X1OA 5D7NA 1MDFA 1Q17A 4DR3B 3GVIA 4HZUB 4YYZA 4PPGA 3PC8C 1GV1A 1CRWG 4PLFA 4DN6A 3LCCA 1PWHA 1BVUA 3P0EA 4OPMA 4JC5A 4S2EA 2IF2A 3RVRA 5LJLA 1JUDA 1R8YA 1ZK4A 2W0SA 3PDIB 4EX6A 1YE8A 1N34B 1DAIA 3C3CA 4PFJA 3ZWAA 1KO4A 2FP4A 1CIJA 4IGEA 4OMDA 1A0OA 3WB0A 5P8WA 4J3FA 4LDRA 3L5KA 1A9SA 4I14A 2QOEA 1ODIA 2GA9A 2VF2A 4N9QA 1A9QA 4BNKA 1G6Q1 1HYEA 3E9RA 2VP4A 1AKYA 1WOMA 4HN2A 1RD4A 4C29A 4BXOA 2BGNA 2EBFX 1OX5A 1QIGA 2Z0MA 3KOOA 4WKGA 4ZQEA 3K1ZA 4BMPB 2Q41A 1C81A 3DTVD 1SIOA 1SCDA 1ZM9A 1TC1A 3CJTA 1W4ZA 1YJ8A 4B6JA 4QSHA 3QG1A 4WJKB 4P5DA 1CP3A 2E4YA 3UEOA 1LTHR 2AIRA 4N18A 5ILGA 4RA6B 2V0NA 2POQX 3GFOA 1SKMA 3MVEA 3OPYB 2R8PA 4EJMA 1LXCA 3AHDA 3W5UA 2QMZA 2FMTA 4GXRA 2E89A 2M32A 2OCDA 2G83A 3UA4A 1G5IA 3JD1A 3QY9A 4DRYA 3K09A 3NTUA 3QHPA 4MKZA 4Y2HA 4I9HA 1CQJB 3QWBA 2FB9A 1L7PA 2OBYA 2YINC 4OQYA 4XWAA 2ZRHA 1K8XB 2PL1A 2GK3A 3DM5A 2W2MA 5BT9A 2UZAA 4WY5A 2HMTA 4B5LA 4KXMA 4S05A 2EKDA 3O03A 1XEFA 4L02A 4JLPA 1N5IA 4LZOA 1O96B 3EWIA 2R60A 1R7RA 1D4AA 1UXHA 2I8CA 4YB8A 2ZATA 3HZHA 3SYRA 4X65B 1WS6A 2BGIA 4ROTA 2Q62A 3KXPA 4Y9RA 2IEBA 1BMFD 4ZRMA 5BMVB 3RFXA 3EFBA 5FI0B 3U1TA 3STVA 3AR3A 3LYAA 2QGFA 3NGMA 1L8OA 4LCBA 2XUKA 5DO9A 3WLFA 3CZPA 2VF7A 2YWHA 4R2MA 3ELUA 1T4BA 1BXRA 3FVWA 1T10A 2ZTVA 2BOVA 3F8TA 5AW8A 3FHLA 3QP9A 5DEOA 4URVR 4NJMA 3PEWA 4PZZA 3KOWA 2O07A 4AB1A 3TKYA 4Z99A 3VHQA 4F60A 5J23A 1PJ4A 1DUVG 5E7IA 1S0UA 2FFAA 5DI3A 1GGHA 3GLVA 1WMAA 3H2SA 2A5GA 3ZWCA 4NBKA 3AEUA 4D9JA 4TV9B 4NFYA 3BD9A 1J0CA 3UNXA 2HMVA 4BDTA 5JXJA 3ZLBA 5I8WA 2PR7A 3ICOA 3RC3A 3PFFA 3MWDB 2ROQA 5KHAA 1EESA 3ZQ6A 1G6OA 4WZAA 3UK6A 5KYGA 2BBTA 3JQDA 3IBYA 2WM2A 3OZXA 2FZCA 5I9SA 2W6QA 1QO9A 1Z33A 3ZBUA 1D6JA 2VP0A 3OTWA 4CM5A 4Z1OA 2C2KA 5CA0F 2BEWB 1ZN2A 4C4XA 2I2CA 4WXMA 5COBA 2V8OA 1FNNA 1FS4A 2X1MA 3KELA 3AJ9A 1QUFA 5CA0A 3QYPA 4XARA 1W0KA 4HI0E 1AT1A 3GO4A 3H18A 3QW2A 1O5IA 2PXHA 1SIWA 1BWQA 1D03A 3IKLA 3Q3IA 4XR9A 3ESZA 3NHRA 4L16A 4PFKA 1TVKA 3EJ6A 4PO8A 3GRUA 2KBFA 3O8RA 3TVTA 1XTUA 1TT5B 2ODBA 1ZU5A 3D64A 3KM0A 4NE9A 1E4OA 5AYVA 4B43A 5BOSB 1OCEA 3EGDA 4M9RA 2PTGA 3BCRA 2B4TO 2OV8A 1QP4A 4U6QA 1ZHFA 2JI4A 3A70A 1T9BA 4JCOA 5EZYB 3U39A 2IXBA 1MEOA 2FLVA 4ZVMA 1XDBA 4WJZA 2IV7A 8ADHA 4CR6A 3VR4D 1RHQA 3SXUB 1I2ZA 3H1FA 5IC4A 1QNLA 1JJAA 4I81A 2OHHA 2WMOB 4BY9E 2IY8A 1WUJS 3SOZA 1YU6A 2VK4A 2BKUA 3OPYI 1G2QA 1TAHA 2PVSA 5C5IA 3WP0A 1N33B 2AKYA 3HU5A 1HGXA 2CW5A 3LWZA 1RMQA 4GQIA 5F5LA 1EWRA 3I8XA 2BZ0A 4K0KB 5FQOA 1NZFA 2I6SA 2XQGA 3GAMA 2JJ1A 4FSDA 5JALA 1G20B 2GEVA 2VSQA 2VRCD 4K3UA 3FRJA 4RCZA 3VZPA 1GADO 5HX7A 4L73A 1BKYA 2A5JA 3KLBA 1SOAA 1XO1A 3RUIA 3THSA 4BVLA 4MYUA 3U9SA 3PC4A 3NC4A 4D6YA 3LXUX 1UKAA 1Z34A 3O8BA 5CYFA 2ZJYA 4IV8A 3DTTA 1U63A 4E88A 2CDCA 4WUTA 1TQ4A 4OGGA 5GM2A 1RJWA 4O2AB 2ZU6A 1QRRA 2KPOA 1GRNA 2NWQA 4P93A 2OXIA 3W5IA 3WOVA 4F1KA 2WIFA 3RHTA 2Z09A 5JC8A 4DFDA 5C53B 3GGSA 4TYWA 4PNEA 1HC7A 4H1TA 4JBGA 2Q5QA 2G88A 4LFAB 1KMHA 4HPJB 1ZGCA 1O2DA 1P75A 3FUTA 1PTKA 1NPDA 1B16A 4Y2GA 5KNCA 5KUTA 2BEKA 4OBBA 4NI5A 4UEWA 5EPOA 3V8MA 2H11A 1I0ZA 3HACA 3EF3A 1P0PA 1NY5A 2W2LD 4E11A 1R88A 3LVFO 1JI0A 1UUFA 5SY9A 1N32B 3SJBA 2WZQA 2CFCA 4B2LA 3QGMA 2YMMA 2G7ZA 3B5JA 5JSYA 1KYXA 1SAYA 4L7QA 1THTA 3N5CA 4RESA 3WADA 3RSSA 4ZK6A 4H59A 2XCRB 3L82B 4TMFA 4TTVA 5EERA 3U44A 4YRLA 1NZDA 1G5HA 3ZY3A 2D1TA 2GLTA 2R4TA 3MINA 4BVKA 4GRDA 1Q74A 2C00A 3PYXA 3ZE7A 2G8NA 4Q4AB 4HXGA 4IZIA 4I4LA 4G3XA 3AJ8A 4HLUC 3AB8A 2MSEB 1C0IA 3HR4A 3N74A 4NENB 5DSZA 4PLTA 4RL6A 4D4MA 4KZPA 3ADBA 4CM9A 5HG0A 1Z9BA 3MCAA 3K92A 3UF0A 3WJ7A 3HGQA 3K32A 1AZLA 4XVQA 2OM6A 1UMBB 3L1JA 2OQVA 3TI7A 3MTEA 1Z06A 4YMTA 4AC9A 3KE8A 4CT0A 4FILA 3UMBA 5H16A 3ZOKA 4B6EA 2CV0A 5LQAA 4ER6A 1UEIA 1YCGA 4G65A 1DWQA 3CSDA 4FR0A 2IS4A 3AB3A 1A04A 1MD9A 1KJWA 4DR6B 3RVBA 3O1JC 3LC1O 4G81A 3IP5A 2BZ1A 4MHTA 1E2GA 1C2TA 1NJGA 1XHFA 1MX3A 3E53A 1Z47A 4RV5A 1SD2A 3P27A 3O9VA 4QUIA 4Y30A 1D1SA 2UZ3A 3GJ5A 5JJLA 4H7JA 1D6SA 4BFWA 4BTEA 5IANA 2EOAA 1I01A 2HRCA 2Q07A 4IAOA 4NR0A 2ODEA 4D6PA 1SVUA 4A36A 4GI1A 3DAFA 4JENA 1FJXA 5AUOB 3VR1A 3WFIA 3TMYA 2WFAA 3Q88A 2Q6LA 2GEDA 3JALB 2JAXA 3FNFA 1ODKA 1J8FA 2B99A 2EIHA 3E1SA 3KZ1E 3OIUA 3GQBB 4XPZA 2O7RA 5I7AA 3JAKA 3T9BA 4B6GA 1R0ZA 4LQDA 1KYIA 2EZUA 3IEIA 2H3HA 3KEQA 1GN8A 3HO8A 2C5EA 4KE8A 4AP5A 5LKRA 3OQHA 1L4BA 2O2JA 2BF7A 2RBGA 4PZEA 1XKTA 1CJCA 1U5BB 2JFBA 3L6OO 4E14A 4YUYA 4A0SA 2WYOA 3PNYA 1T1RA 2JHCA 1IUOA 4KUEA 2XD9A 3RJZA 4RJ2A 1N2EA 1CBUA 3KC2A 4D0SA 2JHPA 2Q45A 4CIVA 4IFTA 1R16A 3C6QA 4HJXA 5HCNA 1MNQA 2D2XA 4G5FA 3UUWA 4HZGA 4JITA 2BH2A 1CDDA 5IU6A 3U16A 1TJ4A 1DZ3A 2JHAA 4HG2A 1FY2A 2LCFA 3LDUA 2V6FA 1ZSVA 4LYHA 4Y9DA 1E6WA 3FTFA 2N1MA 1NZJA 1JFTA 1NW5A 4OA5A 4FOSA 3NWJA 2QX8A 4IJKA 1L9XA 2MMGA 3FNRA 4UKDA 1JEYB 3PEUA 3KP1A 4ARBA 4FE7A 2OENG 1E66A 2IRWA 3MN1A 1GZ6A 2F48A 3EXIA 2YMPA 1N9KA 1BA2A 5HE9A 5LZ4A 5E4FA 1M0EA 1SHUX 1ISHA 1MUUA 1U2QA 4LWOA 4Q6BA 1QFXA 4O2RA 1VGQA 5FBZA 3DOEA 3DEKA 1F17A 5H3HA 1N6RA 1SVLA 2NGRA 3F6YA 3HMQA 4BJ5A 5I5EA 1YRYE 1HF3A 3ECSA 4ZU3A 1CYEA 1B76A 2AC4A 4ZVLA 3QEAZ 1G8AA 5A5GA 3LHFA 4A03A 4DLLA 1IPEA 3RRJA 5L51A 1I8TA 2IYUA 4QQFA 3HJGA 1DT3A 3DF9A 4XYEA 5IVPA 4JUBA 3N0XA 2GN2A 3DHYA 3ESYA 2VBCA 4L9WA 5F9HA 4WK2B 1Y5RA 1NVAA 4G4SP 4LZZA 1TAGA 4BVAA 2D4AA 1ECCA 2IYSA 3RSGA 3CNNA 3AJEA 1A2KC 4QYIB 2VBFA 5JAUA 2JLVA 1QGAA 2D7JA 5JANA 4P82A 5A3QA 1N6KA 1Z18A 2B3TA 1BRTA 2CDAA 1EFVB 3OEYA 4A8JA 1OU4A 4H6XA 3BSYA 1DEAA 1N7IA 1YR6A 3KQLA 5TE9A 1ZOSA 3QMWA 3HPQA 4XM1A 4J8PA 4P98A 4QRHA 2FMXA 1UK6A 5BWBA 2P6MA 1SZPA 3F3YA 3CRZA 4CG3A 3MYRA 3P0HA 5DH9A 4IHJB 5AOCA 4GPEA 2WM9B 3QX3A 2WTUA 1VA5A 1I1QB 4B80A 2UVPB 3GEHA 1XPJA 5HZGA 2O8BB 2ONCA 1QF7A 1E2DA 3PIDA 1JEQA 2PGXA 1QP8A 3AIOA 1IK6A 1WHTA 1PL0A 1KYYA 2XA9A 3OIVA 4LX8A 3UJAA 3ZS9A 2G09A 2A9KA 2NSJA 4C20A 2ISSD 5DHAA 2PU7A 3AMVA 1E1CA 3UKJA 5F4ZA 4NCJA 4ZHSA 5CB6A 5AP9A 4DR4B 3F97A 3QIAA 1TFUA 3URMA 3L49A 3P8ZA 3Q2IA 4LQ4A 4NVRA 1M5UA 4YBRA 3RGWS 3W34A 4H9GA 5CVUA 1WZ2A 1BD3A 1TXGA 2R96A 2NTJA 3GYGA 3R44A 1KZ7B 2XB9A 4HDAA 4OHXA 3NEAA 2BMAA 5EWMA 1JZSA 1ZHHA 4I55F 4EP1A 3U49A 4QPCA 4BN4A 3W3ZB 4G36A 1FC0A 2OGSA 3STXA 4DEXA 3E23A 3FHTA 1NPTO 3K4QA 2B9EA 5TMEA 2I33A 4EFKA 4O4JF 4NZOA 1G7SA 4ZYXA 4X1KB 5L53A 3NBKA 2A84A 3QRWA 3W8EA 1Q19A 1ZEJA 4MJ7A 4QUJA 3TOSA 4O4JA 3UA3A 5C5DA 1XZLA 1MRNA 4TTPA 4YH1A 4B6PA 2WFLA 4ARIA 4I4CA 5FLYA 2AF4C 1G64A 3HR7A 1KY4A 4XWWA 3QU9A 1E9RA 3S2YA 1E1NA 2CEAA 2GD1O 4U2KA 2PRKA 4K3VA 4S35A 5TQ0B 4M1YA 5HSGA 3I2HA 4URFA 4B8WA 2R84A 1D7AA 2Y1KA 3H9BA 5G02A 1AO0A 1P6XA 2HMWA 2O0KA 2NTEA 4Z7JA 3FGZA 4B79A 4ZI2A 1RTTA 4X3CA 4DAOA 3WRXA 1ELOA 5UKDA 3TGLA 3A2NA 4WFIA 4BNWA 4AN0A 4BNXA 3TBHA 1I14A 4PN7A 2P1ZA 4WTOA 1Z6TA 2OGTA 1P1JA 3PEVA 1W581 2JGJA 2V4ZA 4F56A 3TAHA 5ADWA 2Q5LA 4NBNA 1C3OB 4RPKA 3WIOA 4Z4IA 3TXAA 2FLWA 2XB6A 1JQ5A 4YEDA 2X3YA 4FB4A 1QQ7A 4G23A 1L5FA 3LY8A 3FMGA 4HXEB 3LF1A 3RC9A 5BXYA 1G2PA 1SHJA 5IUKC 2HWWA 1NRJB 2FPPB 2IYXA 3HXLA 4QNNA 4X84A 5DCUA 1I9GA 4DMUB 1E2PA 2A9JA 4ENUA 3M81A 5CFMA 2QB5A 1QVVA 1S01A 4UASA 5EWJA 1AF7A 5IYZF 3BTVA 3RAEC 5A7HA 3JQAD 1RKVA 2O5RA 2X9VA 4HDSB 5IYZA 4MRSA 2AHOA 2GBIA 3DDUA 3K16A 2GSWA 3P26A 4BYGA 3UTDA 5GJVC 1Y9JA 1A82A 3TGPA 3UCFA 4P3NA 1F60A 1M7GA 3IVRA 1SG9A 3L0DA 3WL8A 3MT8A 4B3FX 3CPSA 1T5TA 5HOEA 4X3PA 2XLCA 3KTFA 3NT2A 2CD7A 1KAGA 121PA 2AFVA 4W82A 5C51B 4X0EA 5FFMA 1TAUA 2FP3A 1FDOA 5TNXA 4JUAA 4MV6A 2SNIE 1W0CA 4LE1A 1EFDN 1SRQA 2PS3A 1DDOA 1PCXA 3L8GA 2ZTUA 2DFVA 3OJWA 3WWEA 3KETA 1YK1A 4AZSA 1MJGA 4G0VA 2ISCA 3Q7EA 2PZEA 5CH8A 2PL9A 3BMOA 5B5SA 5HRUA 3MS4A 4KXFB 1F4VA 1QONA 1EG2A 1B6GA 3B6ZA 2GI4A 3DT9A 4DNXA 1VRCA 3WKEA 3TFWA 3WGTA 5DP2A 4LQLA 4D82A 3W8DA 3OP4A 1NFRA 2P0EA 2V59A 2ZYHA 3DFMA 3HKDA 3QHQA 3BWYA 4LYGA 3LSTA 5FD8A 3A2MA 2BFCA 2VH1A 1KEVA 2WHEA 3LXRA 4L0DA 3RSFA 4M0LA 4KWHA 5A4DA 3GDWA 3IUSA 4RE6A 1XMOB 1WETA 3ZE0B 1FQWA 1U11A 3RV4A 4M9CA 1XD9A 3L8HA 3NT5A 3TMAA 1CF4A 3KZOA 1QF9A 3FYDA 2VT6A 4BNFA 3MAAC 1H2RS 1B7GO 3DMDA 2BPOA 1FFSA 5L45A 3QX7A 1C1YA 4K9RA 3EPHA 2D06A 3IURA 1VRVA 1A71A 2CNDA 2X15A 4HV4A 4N3GA 5CJJA 3WGKA 3QIVA 4TL6A 3B1VA 2CNOA 1L5HA 2IYAA 2NU7A 1D6NA 4FLFA 2EIXA 4NH4A 4HMOA 4A0HA 5K6AC 2I2BA 2QVCA 3D6UA 1MJ5A 1RC1A 3A27A 3WRVA 5AK6A 3WSVA 1KEPA 1CB0A 3AH8A 2XMSA 1BYIA 3Q7TA 3SNHA 5K0CA 2QF7A 4OIMA 3TZCA 2D1QA 1QOPB 2NU6A 4MCJA 4EFNA 3RODA 2DRIA 1N3BA 3KJFA 5BVHA 1G20E 3CLSC 1S9DA 1U0SY 3RK1A 5AVJA 1QCZA 1XXHA 2NYVA 4DJFC 1R12A 3M6MD 3USES 4NOKA 1JL3A 4JOBA 3EYAA 1B0ZA 3L0CA 1DRKA 1RU3A 4NQZA 3OQBA 1ZIXA 4R16A 1ZC3A 4PHTA 3PB3A 4G0OA 2D5BA 5ILQA 1O87A 4KK3A 3U7FB 1SCAA 2ZPTX 1Q0TA 3JYLA 1JSLA 3DZIA 1JAZA 4UDNA 1ESCA 3AUTA 4B3JA 2Z3VA 1E3JA 4D45A 2ATCA 2CMKA 3WA6A 1Q0QA 2YY5A 1BCRB 2CLFB 4E3ZA 1SEVA 1N5LA 3SY8A 4ZI7B 2FN7A 1RXUA 1Q1NA 3KVVA 3N0VA 3RQIA 2ZRDA 3DPUA 1N6PA 3AR2A 3VAYA 3VR6H 3AZPA 4P3YA 3BD8A 1LRJA 1ZRHA 1NKSA 4Z0PA 4OB7A 3ZBQA 4C1BA 5AVRA 1VJTA 5BY2A 1EG7A 1Z2EA 1BO6A 2R1ZA 1T25A 3SZRA 3THXB 4E1VA 3EIUA 4DLAA 2VPTA 3Q98A 4QXMA 1W2GA 4LY9A 3F7TA 4TWAA 3VJMA 4QG3A 3W6PA 3TN7A 3G2LA 3MEQA 4WZ6A 4E12A 2ZRLA 3NG1A 4YP1A 1XYVA 5BSWA 3DHVA 4YCAA 2X2EA 5BSMA 1V16A 1QO0A 1NF8A 2A0FA 3KJXA 5TPZA 5DTMA 2VOJA 5LNK6 2GHQA 3DB2A 3G88A 2JKZA 2NZXA 1V71A 4KLRA 1J9GA 3DP9A 4JGBA 4L74A 2HA0A 2DY0A 2NO5A 5B7PA 4G25A 4JP8A 2EQ5A 4K7JA 1TJ3A 1CLEA 1AKWA 3NWPA 5FT9A 5K0SA 3AM3A 3LCVB 5B1IA 4MSUA 2A4KA 3WB1A 3NHWA 3FWNA 4MUEA 2QIPA 1FK8A 4WXEA 2PKCA 2Z1DA 3I9NA 2CL0X 3EGXB 1UBOS 1YKGA 2UVQA 3D4LA 5HP4A 2HREA 3NETA 5L3VA 5A6SB 1HYQA 4Y2VA 1K97A 3V5NA 1E6CA 4ERNA 4LMPA 4LHVA 1A9ZA 2GN4A 4O02B 3RTCA 2F8SA 3KBBA 4G5GA