5EKTA

Crystal structure of mutant-k146a of peptidyl-trna hydrolase from vibrio cholerae at 1.63a resolution.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
197
structure length
196
Chain Sequence
MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHADKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mutant-K146A of peptidyl-tRNA hydrolase from Vibrio cholerae at 1.63A resolution.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 63
structure length 196
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ektA00
2LGJA 4P7BA 4QT4A 4JY7A 2NAFA 3V2IA 2Z2JA 4FOTA 4HOYA 4QAJA 4DHWA 5IMBA 2MJLA 5IKEA 4YLYA 4ZXPA 3KJZA 3OFVA 3TCNA 1RYBA 3KK0A 4QBKA 2Z2KA 4Z86A 4ERXA 2Z2IA 2JRCA 4FOPA 4JWKA 4JC4A 4FYJA 4LWQA 3NEAA 3TD6A 3TCKA 4JX9A 2PTHA 4IKOA 5IVPA 3TD2A 5B6JA 1RYNA 4FNOA 3VJRA 4OLJA 5EKTA 4QD3A 4DJJA 1RYMA 3P2JA
chains in the Genus database with same CATH superfamily
4L2IB 3DM5A 1D4ZA 3F9CA 1NDQA 3KZNA 2FEWB 2ZBVA 4MWDA 3BBLA 2QTRA 2G04A 3A9UA 2C1EA 4PYKA 3SQLA 3MT9A 2C4WA 4KTTE 1QYVA 5GJVC 1I5RA 2AN1A 1GQQA 3C8DA 5C1OA 5IWAB 1TC2A 4FPXA 2O4UX 5IC6A 4Q34A 1B8NA 4LXUA 4JI5B 1GAEO 3E84A 3L0ZA 3LPLA 1TECE 4YEDA 3P9QA 1KDVA 3DOCA 3WDSA 2PXCA 3EDQA 5TGTA 5CIYA 3S6JA 4PN7A 4IWXA 3QMVA 1FXUA 2MT9A 3KELA 5HF8A 3ND8A 4XTRA 1ZRSA 3MD0A 1FXWF 4ZRMA 3GEEA 4JT4A 2Y1GA 3IX7A 3RVSA 3L3BA 5K6RA 3IAHA 2HO5A 2I4LA 3LUFA 1TA0A 1PZNA 3FSGA 1A2QA 1P1HA 3REOA 4B45A 1KP2A 1QFSA 2FUEA 2P67A 4EDFA 2OFPA 3AY0A 4G09A 4KQGA 2ZYRA 1P2SA 2ZB8A 3DT8A 4HN2A 3KFLA 1Y4ZA 5AM0A 3ZV4A 3OF3A 4JNCA 1N1DA 4P5PA 2B8JA 3P5BA 5D5PA 3W5AA 1JQDA 1PNTA 2FF7A 2Q6VA 3CNHA 4J43A 1HV8A 2IEDA 4RTSA 3AWIA 4PZLA 1GRRA 1XVLA 5HCIA 1E2QA 2I6TA 4KBYA 2NSJA 2PA3A 2WU4A 3WMFA 1BN7A 1CBUA 5JAHA 2VHUA 1RQXA 5JSFA 3PFWO 4O2LA 2PVSA 4ZV4A 3UFBA 4Z9BA 2WQ7A 1CUEA 1KFCB 2XE7A 3TM4A 4DA4A 4OREX 4QUIA 1QRAA 4KKXB 3GJZA 1KZ7B 1ECCA 4L8YA 1TE2A 4V0RA 4ZI5A 3ZEIA 3DKPA 2I3DA 1A8UA 1QF9A 3OY2A 3S4YA 1J8VA 2C5BA 5TE9A 1UFVA 2LWIA 1DRKA 4GD3Q 3OQPA 3W6NA 3IOCA 3VTFA 4NATA 1SJ9A 3ER6A 4M86A 1I6LA 4HQOA 4WA8A 3GJ4A 5ED0A 2Q4BA 1VHTA 2HBZA 3EA5A 4G07A 5M3BA 4EYQA 2J9FA 3OE1A 1QG4A 3I5YA 3AR6A 4CM5A 3NZEA 1FU7A 3Q11A 3SLGA 1QVRA 2VZ0A 2JIBA 3I34X 1KAQA 1NVUQ 4R8LA 3DAHA 1IQPA 3Q40A 5DRYA 3WHIA 1JWLA 1BG6A 1MC1A 2Z30A 1RP7A 2BEVB 2WFLA 4RM2A 4XAQA 3T34A 5I7OA 2OYRA 1SKBA 5YASA 2WT8A 4A2CA 5F77A 1XZGA 4G0XA 3KXDA 3X1KA 4DV5B 1RPAA 1JDPA 2X2PA 2DECA 5GY7A 5B3LA 2UYOA 4HGYA 1F4PA 3PXEA 1K7EB 1ZGHA 4IDCA 4RD1A 1RVDA 2PRZA 1YDEA 2ZVPX 1UFOA 2B5WA 3JWJA 4ME6A 2FFAA 5EMJA 1XTKA 1R4NB 1Y1PA 1PGNA 1VCIA 1QYDA 2IXEA 3DZKA 1XELA 1E2MA 1AHIA 3I9OA 4H0CA 1PGPA 5E9JA 1R9MA 1KVSA 1YOVB 3WMXA 1C7IA 1EE2A 1N8TA 2H1VA 4OXIA 2QL9A 1UEJA 1AMUA 3SNHA 1Z6YA 3GUUA 2FZ5A 4X66B 3I61A 1Y8QA 2CV0A 1BO6A 3G0DA 2B4RO 3MELA 1ETHA 1HT3A 4DIFA 4EW6A 1YVEI 2OBYA 4NH0A 1UM8A 3FBGA 3MWGA 3G85A 1RRCA 2BDEA 4NBKA 1N0UA 3WK7A 4Z3OA 5AW0A 1DZ3A 4BNKA 4X9XA 4DEYA 2G6BA 3WKCA 5JVDF 3HVKA 2B4YA 4TV9B 4J90A 2PL9A 2HZ7A 2FZGA 1WW8A 1T10A 2E4YA 4TXMA 2OOSA 1WXEA 2OBNA 2Y4NA 4MO9A 3RRZA 4RV9A 3RDPA 1Q16A 1FFAA 3KM0A 3R3ZA 3SYNA 4UBMA 3JD4A 3D3QA 4E2XA 5JI3E 1XZDA 1Z8DA 2WAMA 2G9RA 3STHA 1Y48E 3K0HA 1QKIA 1ZKMA 3TQCA 3M89A 3PJDA 4M22A 5AR1A 4DDHA 4YN3A 5IJ9B 3F96A 1LI7A 2IVFA 2Q5JA 3FTPA 3P2JA 4MUXA 4BLUA 5FKJA 1XZEA 3TX2A 5ALEA 1SU8A 4X1KA 5JSZB 4X71A 3TGWA 3ZI4A 4G0ZA 1PR1A 1UJ6A 3T3MB 1NJGA 1RHJA 3OSUA 2O0HA 2GASA 5LQDA 3WAGA 5AI8A 5HIMA 1C7EA 1VE9A 1VRVA 1TJ5A 1ZC4A 1ZA2A 3O3CA 4ZAFA 4C0KA 3OF2A 2OGWA 2P0YA 4FYVA 4IWYA 1HNXB 4D3ZA 3OEHD 5FQNA 4CV2A 3AM1A 3PUXA 2EZ4A 1WZEA 1U2SA 3HUUA 5LP6A 1GNTA 4UBLA 2Y05A 1Z63A 1V7ZA 4EYEA 1H2XA 2Q5LA 5K09A 3PXCX 3O92A 1JEQB 3TUIC 1VSTA 3ZS9A 2C20A 4OUKX 1PHRA 2HLHA 2BMFA 1WLSA 1PHPA 2X4LA 4LY9A 3P4YA 4RPIA 1D4FA 4X8MA 1X7XB 3JWIA 5HIIA 3TS1A 1GCUA 3IE2A 3ZK7A 4PYNA 4AJPA 5HVNA 1Y1TA 3HYNA 3OLXA 4MI1A 1JQLB 3LO8A 4YASA 5T3YA 1XK7A 2XB9A 4QECA 1TYZA 4L8GA 4Z4QA 2PMBA 1RLIA 3DLCA 1A4XA 3AJRA 1KJ9A 1JX6A 3JVEA 3DBHB 3LK7A 2BFAA 2XNHA 3T9BA 1UKCA 1D6MA 1IIRA 1E5TA 3NOVA 3I04A 1S96A 3O82A 5F7OA 2M1ZA 4FCWA 1GPMA 1G7TA 1CF9A 4FFWA 2QV0A 4BAZA 1UADA 4G1EB 1KJIA 4Q00A 1J2YA 2NQTA 4KQEA 1NATA 3U2QA 2N0SA 2AH5A 5BV7A 1DT3A 3TQQA 3PU6A 5DMHA 3R9XB 2HHAA 3EUAA 1EFHA 4W7HA 2Z09A 4IR7A 1U2PA 3PX7A 3RLFA 2VJKA 2J0UA 1BROA 1H5QA 2QVZX 3AM3A 5FWNA 2BMVA 4KFUA 3UAXA 4B4WA 3PDCA 1FQJA 2HA4A 4I4NA 4HY3A 3CKYA 3AESA 3OJXA 5CXQA 1SXJD 4D42A 1VE6A 5IM5A 4HAZA 3NTOA 4B4UA 1P4HA 3IKLA 2R4QA 4I6GA 1CKEA 1XTBA 2BM9A 4J1QA 1LZLA 4N5NA 2R96A 3UT6A 1J1UA 3QG1A 4HF7A 2X5NA 4WI1A 3V1TC 1K0UA 3PQCA 3BGSA 2PUFA 5HF5A 1BJRE 1ESZA 3ESDA 4LNAA 3R76A 1M2FA 1HYHA 1DZIA 3C6KA 3SQXA 2YWBA 3TLJA 5TEWA 2VP3A 5B7PA 1C2YA 3VBEA 4BIIA 5DZSA 3GLFE 2C94A 3DULA 2JD0A 4Q48A 5FBZA 5AXAA 3WHPA 1PVOA 4YECA 1MHTA 2HRCA 3CUEF 1WW3A 2FHPA 3EH2A 1OW3B 1QIFA 4Q6WA 1PR4A 5J2UA 2ZWMA 3GZNB 2FZKA 3CEAA 4NENA 3X43A 4QAQA 1PDOA 4H9GA 4ENSA 4LZWA 1HGXA 2ZZNA 3N2KA 1OZFA 3OZIA 4GKBA 5LP6B 2BUAA 2AQIA 5D01A 1KRWA 2RGUA 3QV1A 4FHCA 3R23A 4LVOA 5T5QA 5EMLA 5DNWA 2IUUA 5L53A 4JA2A 1T4CB 2NAFA 2IITA 5BVHB 5ICFA 2C7PA 3AHIA 2AEFA 3FR8A 2IYVA 5BRAA 5F64A 4M4SA 4YRLA 3WP0A 4HJXA 2QX7A 4P92A 1XTTA 1L1RA 3RE1A 1UKBA 2FYTA 4EKDA 2P41A 3DFZA 3U3KA 1FFSA 3BTOA 4RHXA 3RSZA 3AB7A 3CNQS 1H8HD 4EG6A 4JFAA 1M7BA 4AROA 1DQZA 3LKBA 4YRZA 1EIZA 2QIOA 4GM0A 4REQA 2Y1KA 1XA4A 2PS1A 1PG5A 4RK5A 4TXLA 4WK0B 2HXGA 5FL3A 4MYHA 4IIDA 4ZHQA 3LY9A 3O8DA 5U4XA 4BE9A 4ISBA 2XODA 4RJTA 4GZ5A 2FMUA 2O2JA 3U7IA 4A82A 3LK6A 4DSZA 1N2IA 1VL8A 2GZHA 2C7GA 1Z2EA 1RXCA 2BLNA 2VHJA 3P4XA 4WCDA 1A96A 1XPOA 4OX9Y 1U0HC 2V5AA 3MWEA 2P3OA 1GTG1 2E4UA 2O8DA 1P80A 1X7YA 3HI6A 5FO1A 3VO9A 1M76A 2Z0MA 3BCRA 3FOWA 3JYHA 4H1UA 3H3FA 1XZBA 3PHBE 4K7JA 3CIFA 4RK6A 2OAP1 2P68A 2J09A 1N6OA 1Q6YA 2SICE 3SHTA 1KTIA 3PA6A 1E69A 4HKTA 2BM8A 2XYPA 3UJBA 4MQ5A 3HJGA 2VLBA 1YZHA 3EW9A 3OLCX 1PYDA 3SR4A 2O8NA 5HOQA 1E89A 1KTVA 2VCEA 2PX5A 2H6EA 4X45A 5EXPA 5KQSA 2B98A 1C8VB 1L7XA 3QU2A 2DQYA 3T0FA 3P2IA 1H0RA 1TO2E 3EW7A 2A1UA 3DG9A 4AIRA 3N76A 4ZHQF 2WFZA 4DB2A 4D8UA 2LXNA 3ZJTA 2AL7A 4I50B 2CNKA 4OBBA 3MOGA 1NMXA 2ZKLA 4Q3DA 2G8LA 4Y2HA 1PFGA 1UFQA 1NUPA 2DY1A 5AUQA 2OT3B 1SXIA 3NCTA 3VR3A 3FOBA 3KYDB 4MTLA 3GG9A 3LAWA 4CEHA 1QP8A 3KXPA 4RCYA 2EHJA 4ISCA 1YFZA 4LCJA 1IEQA 2G08A 5B1YA 3ZWXA 4ZCRA 3DEFA 5H59A 4O4IA 3S3TA 1JJBA 3QOWA 4AECA 1FVOA 3E6AA 2DBQA 1HFJA 2YXNA 3LT2A 2OECA 2VPPA 1PUJA 3PQ6A 1FX1A 2HKIA 2P6MA 1QO0D 5DHTA 1PL7A 1MNQA 3L4SO 1NVXQ 1GL3A 1Z5OA 2IIQA 2ODNA 4QULA 4L50A 4RAOA 5REQA 5JSQA 1NQXA 1PNOA 4WLOA 4A7PA 2YWGA 3F5MA 4RADA 2XKKA 1U2GC 1SA0A 4UXJA 4EGAA 3C7TA 1YFJA 5CIWA 2OVBA 1Q0PA 2JAHA 5C8VA 3AL0C 2CLCX 1Y1KE 3GA7A 1FP6A 2JGEA 3RVRA 4EG7A 2GZ3A 1NIPA 1YCHA 4M7PA 5KTMA 1FS4A 4GMXA 4LE0A 5F5XA 2I29A 3UK7A 3VR4D 2FUG6 5JISA 4CT5A 2D7JA 2DHQA 1N7JA 5FLKA 4EBFA 1NMQA 2XZLA 3V8RA 2P30A 4HCJA 3IXQA 4S1TA 1K63A 3RC7A 4IDEA 1KFBB 2ZKIA 3VQTA 1N3YA 1YDFA 2O8VA 2FVXA 4HBGA 4MZXA 3P1JA 1G0OA 1I0LA 1G20B 1PS8A 1Q1GA 1TOAA 1YB2A 3H9QA 4XFDA 3DT9A 5HRUA 3BWBA 2REXB 4UU1A 3VKHA 5E7IA 1WDLA 4DQVA 3AYXB 6REQA 1UZMA 1YUMA 2F6RA 4PFJA 3UC9A 3RD5A 3ZU6A 1S3SA 1O95A 1XO1A 2ZIGA 4E11A 3E2IA 2VWPA 2XDYA 1G2QA 3BXZA 3ETNA 1OH7A 1E60A 2QUKA 4L4UA 3RHSA 3VNBA 1DQPA 1XRLA 5AW7A 2JGKA 4L8LA 2ZS7A 1J09A 3HS3A 5GIPE 3EPLA 1P6XA 2I3BA 3FI0A 4AP9A 2AX4A 4GX1A 4N5MA 5K3BA 1L7AA 2H65A 2IQIA 2DLDA 2ZSHA 3B38A 1GG9A 4J75A 2VHZA 1N9GB 1NTOA 1PR5A 2YW2A 3K5WA 1VCMA 1IZ8A 1T34A 2QLNA 4P1ZA 4UTPA 2H4YA 5CDYA 2XD9A 4ZALA 4E12A 2WU1A 5JS7A 1BVRA 4QDUA 4PQGA 3KJIA 3ADCA 3BN3A 1X87A 3G2PA 1B2LA 4AD8A 1P33A 4TS1A 2VQSA 3TNLA 1T2FA 9ABPA 4R68A 2QTVA 2GRUA 5EJGA 5BWNA 1GOTA 2H06A 2QXUA 3QTLA 5JHGB 2E55A 2CZCA 3EZ6A 3QPVA 2FLWA 1JNYA 4ZO9A 2QN2A 1SELA 1WTCA 2HD4A 4ZO6A 4NXMB 4TGLA 5KOIA 4W5NA 5LP6F 3PI7A 4MKHA 4NOMA 3LVRE 3K71B 1QQ5A 5F35A 1NXPA 1RI5A 2PWZA 1GPKA 4E6EA 4JLJA 3OIUA 1SXPA 3TRJA 1QQ7A 1TT5B 1O6FA 1NVAA 5T6MA 1GA1A 4ZN6A 2VTKA 2HSEA 3NPMA 4KQ6A 2Q7XA 5DU2A 1N0VC 4ZMBA 3HVRA 3M6LA 1R5BA 2GGSA 4YP5A 5B7NA 2XT0A 2WBLC 4IINA 4QEZA 2R751 1EK6A 4JLMA 1UKEA 3B6ZA 3TL2A 1G3UA 2PA0A 2R6R1 4QA9A 5A4JA 5KNDA 5KYYB 3OTHA 4Q4HA 4B48A 3EXG2 1CUJA 3HU1A 3QUTA 3BUSA 4EY4A 1T6ZA 5LJLA 5B4UA 1W0KA 1I4OA 1W96A 1YU9A 4AF6A 5M29A 1X80A 4IQ4A 4ARCA 3LLVA 1TJNA 1VI6A 2P27A 2Z3VA 3DVRX 3NGMA 3HNRA 1FSSA 3BRWA 3EQ9A 5K0JA 1H5UA 1R0CA 3D7MA 2JLUA 1E7QA 3A6KA 3ZDFA 1U8TA 3LC0A 3BGDA 1MQAA 4L6IA 5CB4A 3I6ZA 3D3EA 3AFMA 1V48A 3JPYA 5CJPA 1DCFA 5FPSA 2X5KO 4REMA 4JASB 2BKVA 4LTDA 1ML3A 4WRRA 1IEVA 1LLCA 3VO1A 3WS7A 1BE6A 1RJGA 4ZTUB 4WZBB 4CJXA 3AI1A 4QPPA 3DDOA 2Q9UA 1SQFA 2I4TA 5CP8A 4CR6A 3E1KA 3OM1A 4BZQA 1L2TA 1QRRA 5EJFA 3KTFA 4ABYA 3SR3A 4EMSA 1D2GA 5A04A 2WA2A 3WE7A 2GHTA 4DUZB 3VH2A 1XP8A 2AR9A 2SHKA 3A6JA 3HKBB 3O3MB 1ZJZA 1DIRA 4QBFA 4XWGA 2G40A 4AWBA 5IT0A 3WADA 2A30A 1Z82A 3CKMA 1EE1A 1JGTA 2H2AA 2I7XA 2P2LA 1WDMA 3HGTA 3KFVA 5F7ZA 4DJTA 4JYPA 4R83A 3SE7A 1YS7A 3JQDA 4YV2A 4CV3A 1IXSB 4PYOA 3LKZA 2MSDB 4G56A 4UUAA 1AOXA 4FCCA 1USIA 1N6LA 3OUTA 4JV5B 4MUNA 1KGSA 1HE2A 4W7SA 2ZQZA 1VPWA 3E9EA 1U9IC 5AW2A 3TGPA 4H1TA 2VRWA 3U19A 4JGIA 4L73A 2OZVA 2FX3A 3I2KA 4WADA 1OLXB 4HQKA 3OCYA 4LWQA 4Q1FA 4ZZ2A 1YB1A 1VKJA 4Q9NA 1Q74A 3PCXA 1XYGA 1P31A 1UMCB 1T9BA 2VG8A 3KSZO 1GXSB 3AJ8A 1CE8A 1D4OA 3IVGA 3UN1A 3TW0A 1J5EB 2FR1A 4CCYB 5JMWA 1O9BA 5EA2A 5IYZF 4RZ3A 2YFHA 1PSWA 4N4AA 5KHAA 3MHTA 4COOA 1CCWA 1WD5A 1NRIA 1PTJA 5K8JB 3G7SA 1QIDA 3RS4A 2ALJA 3H18A 5JZOA 2BFDB 2C7OA 3MMZA 3STWA 1NQUA 3PHHA 4K5QA 1JKXA 4PC1A 3LDGA 1H9BA 3U3RA 1IN6A 3FNQA 3O8QB 1HLGA 5HWSA 5THXA 4L0CA 3N2KB 3TOVA 2H4ZA 2IZ5A 3RK1A 2ZTMA 4MQ6A 2PH7A 1MGOA 2ARKA 2OLJA 2C59A 2VATA 2VHXA 3EYAA 4K86A 4LA4A 4WOKA 4YRDA 4EW1A 3GW8A 5EAIA 1P7PA 1WUKS 3ZX4A 1KH2A 1HE5A 2Z58A 2WUEA 1YC5A 4NMLA 4HWTA 5J1TB 3VGPA 3U60B 2O06A 1YZGA 1DHRA 2P90A 4YCMA 5GGYA 2VQ3A 2Q5QA 3HEMA 1TW3A 4BCCA 4J76A 4PSUA 4OXXA 2CXPA 5MN5A 4EKEA 4RSMA 2XW6A 4DQXA 2VXBA 3K9BA 1L5ZA 1PD1A 1YKFA 2YFYA 3I4LA 1OGYA 2HCTA 3JRWA 4FYIA 1HOTA 3FPAA 1REQA 3NBFA 3QOYA 4WMLA 4CKBA 2C8KA 4MPRA 3HM9A 5HF6A 2WMOB 4MS3B 5DCUA 5DGXA 3SQOA 3B70A 3B20A 3MJEA 5IT5A 1V0JA 2GZMA 3KAPA 2B30A 2X86A 3NC1C 4E5UA 5CCEA 2IOFK 1VZ2A 4NXNB 3DS8A 2FFRA 1GZ6A 4FGZA 1KIFA 2ZULA 3IQIX 4YT5A 1P7WA 2HRQA 3QKRA 2QUZA 4FR5A 5ALWA 5IBCA 2XYVA 5D1NA 3TLZA 4AY6A 3VC2A 4C3ZA 4EG8A 3COJA 3ROEA 1PV2A 2Z98A 2IYSA 2QTNA 3ZDEA 1DC5A 3EGWA 4D8WA 2PUGA 2OXIA 2FPIB 4TYNA 4JP8A 3OFKA 4IRMA 5JY1A 4LYFA 1CYDA 3WJ7A 2ATEA 2F3PA 1A27A 3C14C 3CRRA 3IPRA 4E4TA 4MPPA 4GOKA 3F49S 2JATA 1QIKA 4TMVA 1UF9A 2IBMA 4Q16A 1UQUA 2JAOA 3JRNA 3OX1A 4NX2A 4J1SA 3RAPR 3PTAA 1UP6A 4TKVA 4ML3A 4MKFA 3TW6A 5FNVF 3VPDA 5BN1A 2EBFX 4IL5A 1GU7A 1W2HA 4LF8B 3G17A 1NXXA 3LVBA 3KVYA 4JMLA 2XB8A 4P98A 3WO1A 1FYWA 4UAUA 1YS1X 2R4TA 1UXGA 5K3SA 3ZR4B 3ADDA 1HEYA 3BXHA 4KV9A 2TSYB 3V2IA 4FKMA 3LO5A 1AXRA 1DO8A 1IBRA 2C57A 1DOZA 5CLFA 1JE0A 2AZMA 3LW8A 1V6AA 3AG5A 5J63A 4BFYA 1GITA 3B6JA 5GM1A 2I9KA 1YJ5A 5H70A 3AXSA 3MQFA 4F71A 4GW3A 3Q8KA 1TADA 2FJ0A 2CEKA 3BSYA 5K6AA 5LIRA 4M8NE 4J6FA 2QR2A 3GJ6A 2VDKB 2XTJA 3IOBA 2CLEB 4RPCA 4LX8A 3M1AA 3RK0A 4RD3A 3SX2A 1XZ8A 2GEDA 1JHZA 3H0EA 3HCWA 4LHSA 3F6BX 4RQAA 4EEZA 5AW9A 4KR6A 3RU7A 2NLOA 3UIEA 3H1BA 3CUTA 4OYHA 1VLQA 4PC7A 3TEJA 1JFRA 1HDIA 2OB2A 4KQXA 2BTQA 4EEXA 5B57C 2VBIA 4B09A 4TWIA 3EA4A 4CL3A 1SVMA 4LS3A 3GBSA 3E58A 1X1DA 4TWRA 5HMMA 4IVPA 5JAOA 2B37A 1Z47A 1KAOA 1U0GA 3E3OA 1MB0A 1B0PA 4BKMA 3B3QA 1DMSA 1QC5B 3QKRB 1JA9A 3JYLA 1ZJ4A 4YO8A 4B3XA 1GZVA 3SQNA 1CQWA 3K8OE 3U4GA 2Z08A 4C0QC 1JS1X 1I0ZA 4JXKA 1I7SB 1JHPA 3RSCA 3WMRA 3JV7A 4N9QA 2FPXA 4J0DA 4AJEA 4BB0A 2ZIWB 3FYTA 1J70A 4TLLB 3DZBA 2PRJA 3KBBA 1Y8RA 3NYIA 4AWAA 1LA2A 2CVFA 1LTHR 3EZGA 4B7AA 5A5VA 4JYZA 1ZEMA 2X9GA 4ZAGA 3QU4A 3MTAA 2ECFA 1RWKA 3GFBA 4IH4A 3FSJX 5CDSA 3AF6A 4ARIA 4MPDA 1GN9A 3AGPA 5JXGA 2WD8A 5DCYA 3OSZA 2WM9B 4EHBA 2VBGA 4F06A 1A8IA 2J32A 1Y5IA 1IHOA 4FFOA 1AF7A 5LZ8A 4Q4JA 4C05A 1LBEA 1IM8A 3D0KA 3QVSA 3B7GA 1FK8A 3NAZA 2CUTA 1JBQA 1LDNA 2PZLA 5AICA 5DN6D 1MJFA 2B1QA 3OOJA 3WQBA 1SULA 4FOLA 2HMSA 4ALIA 4HLCA 4R9VA 1YR7A 1C0LA 1WJGA 2V7UA 2Y76A 3JQFA 5HFNA 1RZRA 2MR6A 3QA3E 2BRUC 1YJQA 3DA8A 1Z5WA 7GPBA 3IDAA 3FJYA 3U4MA 2DJ5A 2JIQA 5AOBA 1Z8FA 1B76A 4FHZA 2OLKA 4RV5A 1SG9A 1NPTO 3MCZA 3F3KA 1X74A 2VJLA 4BEBA 3ANYB 4EGFA 1MBZA 1XZAA 2PKRA 1FQWA 1JVSA 1I7LA 4CIDA 5ES4B 5JJCA 3D1JA 3E5NA 2ZS9A 5DM60 1RXWA 4DBLE 3NHWA 3CKLA 5KX5A 2IKQA 3L1VA 4DWVA 1K2VN 3M4XA 3WIOA 4LCEA 5HKLA 3WMWA 1GFIA 2B61A 2JH9A 4GUAA 2CLOB 1L7RA 2CLMB 3GAAA 3MBKA 3Q4GA 1GR0A 3RSFA 4R1NA 1PTJC 2CYCA 2IHVA 5A5EA 4OLBA 3IIMA 3G7UA 2AJDA 1KYZA 5E1DA 1BIFA 5ITWA 3UAWA 3R4CA 3GN1A 2ZBUA 1F2TB 1M2VA 4GYKA 4P58A 2HF9A 3NAMA 3WLRA 2ZUFA 4N7RA 3CGGA 1NW3A 4BATA 2FJPA 5FFNA 2PMKA 2MYPA 1H2FA 2QLMA 4MYRA 1G63A 4R2JA 3PIDA 2OBXA 1I4LD 4J6EA 4G5GA 2NPFA 4DLVA 1D5CA 1X8LA 2CNBA 1O96A 1G38A 1YQDA 5KMGB 4M1TA 1MRSA 1KJWA 2YJ4A 4EI9A 4F3YA 2FSFA 4WFIA 5HYVA 2F17A 4KPFC 4UOQA 3SC3A 3FTEA 2JPDA 3NC4A 1V16B 3F71A 3PKZA 4NJOA 4U2FA 4NVRA 3EC1A 4QVIA 2R79A 1XZFA 2FV8A 4V39A 2BI7A 4R6WA 5I7FA 4RVDA 4B3FX 4DT1A 5HP4A 3QV2A 2Y0BA 1XDUA 2JCXA 3EVDA 4U3JA 3RVNA 1XNRB 1NHWA 1T2CA 2NZ8A 2X7XA 4IGKA 5CA1B 4PO3X 2X8WA 2Q50A 1V3VA 2QTAA 3AHFA 3DOHA 1LWNA 3FRIA 3I9LA 4JSYA 1VIDA 4M9RA 3JQ7B 3B1XA 3WLPA 4EYOA 2H9IA 3BWYA 4KXNA 1GFSA 5K03A 2QRJA 3DE6X 1P1FA 3UMSA 3HWSA 3HXQA 2GS9A 4FXPA 9MHTA 4IFTA 5JXIA 3MCTA 1XNGA 3X0DA 4I55F 2C9OA 5L4LA 4BGVA 1QHFA 1QIEA 5HS6A 3AR2A 3FDXA 1JAIA 2VK4A 3PC8C 3UAZA 2ISSD 4DBLC 3PWSA 2F9MA 2VXYA 3GT3A 2JGAA 2PCLA 1U04A 3ULKA 1O94C 3P9PA 1CJKC 2H3HA 3GEMA 4W8GA 4LMAA 4B31A 3V4SA 4YRMA 2C04A 1HNWB 2X8BA 5JANA 3WB2A 5JTUA 2ZWIA 3RHFA 2VTBA 2ZYVX 3QFTA 1M34E 4RBNA 4Y7CA 5FOWA 2C5FA 2V9PA 4OJMX 3ESBA 1WAMA 4M53A 4BVEA 1A97A 3NJ8A 4Q1AA 5C35A 1LPSA 1X2BA 1XRSB 1NYQA 3T7DA 3TZ6A 5JS6A 3WQQA 1P2TA 2TRSB 1Y42X 1YB5A 4HR7A 4J4BA 3T9DA 3UUFA 1NJ5A 2RG7A 1ULAA 2NVBA 3B1YA 5CLLA 2X0EA 5C5EA 3EPKA 5M2QA 5FOXA 2WJIA 5EZQA 4EFKA 1B6SA 2W8BB 4WAUA 3S1AA 5IKPA 1I1HA 1TIKA 1D3AA 5K3OA 1ORIA 1OYWA 1B8VA 3RABA 2N9UA 4Y6LA 1T1SA 4AMGA 4YJ2B 3GL9A 5KTRA 1TAHA 4XJXA 3R1IA 2JFYA 3RUFA 2KM1A 1Y9ZA 1ZINA 5TQJA 1VBMA 1K3TA 1KJ8A 1GRNA 2P2NA 5CVCA 3REFA 1H2EA 3MS7A 2BW0A 5CT5A 3RWOA 3CUSA 2GMWA 3EG9B 4RE6A 2J0VA 2X6TA 4HQ6A 3ZDYB 1XEXB 4QFMA 4TKLA 4IHAA 1ZJYA 5LVAA 3ZDBA 1B00A 3F2IA 4YUXA 3KRTA 2JFQA 4S2UA 5KSWB 3BRSA 2PLRA 4IY1A 1WPRA 3H2HA 3DW1X 3LHDA 5TQ2A 2XVZA 4NFLA 2J7KA 4URUR 1YBHA 4DLXA 3RKRA 4PYMA 4HFNA 2GBLC 3EIUA 3E7XA 1DBSA 1N0HA 3H4VA 3IDSA 4RD0A 3GVCA 5IW8A 2J59A 4XGIA 3TZBA 1I7QB 1BNCA 1NMYA 3USCS 5J4LA 3UMMA 4MQLA 2BF7A 4ZT6A 4FSHA 2MDTA 4F86A 3T5DA 1J9EA 4M8SA 5HNKA 1X0XA 1F0PA 1BX3A 4IILA 1V8DA 4BFVA 1UK6A 1S8AA 3QXSA 4R0MA 1A9TA 2NU7B 3DTYA 3HJHA 1GPBA 4WCFC 5TS2A 2HW8A 1TQ8A 2Q4RA 4KVZA 5CA0F 4HC4A 3EZFA 3FVVA 4P4LA 4Q19A 3UK2A 5LQJA 1NLMA 1HSZA 3G5UA 5HF9A 1GL6A 3RKUA 4O4HF 3SBDA 4BTLA 4IIBA 2FPGA 4GP7A 3FW1A 4FLFA 5BN3A 3F5SA 1SVLA 2C3YA 1ZUNA 2AFIA 2WHQA 2GM5A 3OCWA 3T6KA 2H1SA 2WYHA 1M6VB 4TRMA 3VV2A 2WNSA 3ELDA 4POOA 4NTZA 4WEQA 3GGGA 1W4RA 3LM8A 1EK2A 2WM2A 4R9NA 5DXFA 3DXXA 3KKKA 2F43A 4ZEVA 4P86A 4MJLA 1BMFD 2CK3D 1H6DA 2YZGA 2IYPA 3VZDA 4ETWA 2P2GA 4CLHA 5JRDS 2BY4A 3E9RA 4KHZA 4Q37A 3F6YA 1OYVA 4JY7A 3ML1A 5GP1A 2OM6A 4MLPA 3T38A 1U3TA 4GMFA 1AS3A 3M1IA 4BCBA 4M0DA 1FDIA 4O1IA 5DEOA 1FYFA 3O93A 1XB2A 3KNZA 2W6ID 1M8GA 4L95C 5H83A 3VU9B 2DJIA 3DZHA 2BFMA 2K7ZA 1D2HA 4U8HA 1E2HA 1K5GA 2VPZA 3HVIA 2QP3A 2W43A 1G2IA 4BNLA 4DCSA 1ONBA 5LIPA 5DM2A 1JRLA 1RXSA 4BNHA 2WJVA 4MRVA 2FWRA 1VL2A 4M1ZA 5AKIA 2OGTA 2O50A 3VPGA 2W71A 1M0SA 4KLCA 1DJPA 2B92A 1BJKA 2JCSA 2X3YA 2YZKA 3E0XA 4G23A 4CDMA 4U7HA 5CFQA 1CVRA 1B7GO 1I9GA 3NRCA 2RHMA 4WXYB 4OSOA 4A92A 3BAZA 4BVBA 1X7ZB 3W4JA 2H1RA 3W1VA 2C5HA 5KNDH 1EFVB 4RABA 3AP2A 2JD1A 1RYFA 1ZHOA 3W90A 2NSDA 2ISQA 5GPBA 4WGFA 3WGUA 1NU8A 4A6XA 1JTVA 4CUKA 2WAYA 1PEKE 4QIHA 4WZBE 1RAEA 3HA2A 4FMDB 1VFNA 3E3MA 5AI9A 5CCDA 4CTMA 3LOPA 3ZGNA 4P3OA 4KPYA 3BIOA 2B8TA 5J2UB 4G0MA 2O07A 3HXTA 2IP4A 1FP4B 1QS0A 1ZONA 5BWLA 1LU9A 4JK3A 4OHVA 1DXHA 4WXEA 4XSHA 4EO9A 2O6HA 2PGJA 1MAAA 5E4TA 2CNDA 4ZAYA 4BMOB 4EKYA 4DSTA 4PRYA 1KJYA 1YS6A 3A3KA 3EFEA 3BE8A 2ACEA 4LV5B 3GLFA 4FWIB 1ORDA 2HHCA 2WA1A 3AYZB 1TI7A 1GYPA 3TVTA 3UEOA 4WNYA 3AOEA 1R6AA 3AEKB 2JIZA 5ALQA 3A6ZA 3TLMA 1Q2XA 2XDAA 4P36A 1LV8A 5DHPA 4O4LB 1SXHA 2F48A 1EE9A 3A3OA 3O75A 3LECA 4GOXA 3R09A 1Z25A 3ICOA 3UJCA 3AVUA 2XYRA 1UDCA 2DWCA 3O4IA 3KLBA 2QBYB 5IABA 1V71A 3DHEA 2R25B 3DDZX 4MVJD 4WK4B 1IBCA 5DSZA 4BO5A 3BXEA 5B5SA 2C1XA 2P9JA 4PHHA 3KXKA 1NBMD 4HUJA 4QGHA 3W7AA 2IF0A 5K99A 4HXEB 3UBTA 4RORA 3PGLA 2YUIA 5ALTA 1FDSA 3LYLA 2J3MA 2PUBA 4D97A 3ENQA 3QUSA 4DIKA 4L22A 1CF4A 2FMIA 3OFNA 2X4GA 3TE6A 1KC3A 4A10A 3TQFA 1A82A 1U3VA 1PQ4A 1TCBA 1WTAA 3ZLVA 2ZI7A 4BO0A 1WMDA 5CAEA 4MI6A 2C58A 3TXYA 4GR5A 3C3BA 3CH4B 4HAIA 1BS9A 2VPQA 4XI9A 3EQZA 4ZAXA 1QLJA 3TB6A 1L9KA 2CJPA 3H2GA 3GPDG 1VPEA 4PAQA 5DN9A 4YACA 4RIFA 4HGZA 1UOEA 4LZPA 5A4MS 1ZK0A 2H0AA 1MX9A 3LF2A 3RVOA 2V58A 2GZ1A 2ON6A 3ANNA 1UWCA 1ULTA 3OIVA 5C32A 1U3CA 3IVMA 5EGNA 4U6NA 2B9VA 2FFJA 2XTZA 4CG2A 4E7PA 3VNQA 5GJBA 4BZXA 3OZDA 2IIPA 1ZM9A 1E9BA 3HUFA 3NGXA 3W05A 2EZ8A 4EPRA 4CUJA 4X8LA 1E1KA 2UVPB 3HA7A 4OP1A 2FGJA 4B2PA 4I4IA 4ITRC 3I39X 3W2HA 2R8BA 1IWBB 2AN9A 4O4JA 1VE3A 1J0EA 2MHCA 3HV0A 3T52A 3RAFC 4BNNA 5H7XA 4LBYA 2AI2A 3IR7A 4L5BA 3DE7X 1Y3AA 2QTCA 2YASA 2YR0A 3FLBA 5DVZA 1CQXA 1Z06A 1VKOA 3V8EA 3ADPA 4CFZA 4DA7A 1XCPA 1RCTE 2CMKA 4Q6BA 2NUTA 3S7TA 3CUVA 5EHGA 1E2LA 3K5IA 2DTXA 1B1CA 4BMCA 1NQAO 4JKIA 4HSGA 1UBSB 1EFTA 1FFDA 1OFGA 2Z3ZA 3ESRA 4H6PA 1X14A 1LEHA 2CXQA 1AY0A 4Y1EA 3BGOS 4KIGA 3CCCA 5IT4A 4YA6A 2R1TA 5IP5A 3DOFA 2QVXX 3GI1A 3ZJYA 4UTNA 4RKWA 4B0OA 1Q0TA 4YR9A 3OJWA 1UC8A 3USZA 2HREA 2GB4A 3HDYA 4KQJA 1N7GA 4NU6A 1EBUA 1XP5A 3PFFA 1R2QA 2ZWOA 4BDTA 1FTNA 1PRYA 2IEIA 1XEXA 4V3CA 3GAMA 3L6BA 3VNAA 4M0PA 3HBNA 3DE5X 4GE0A 1GADO 1XUOA 2NYAA 4QBHA 3ORYA 5ALPA 5IK2D 2XMQA 2J3EA 2I4IA 4OJKA 2GM4A 2SKCA 5E3HA 2EF1A 3U1BA 3AJ9A 2BF4A 1Q91A 3DL2A 3SS7X 4B6QA 5JWHA 2WJ3A 3NP9A 5FTJA 3ROXA 1WQ4A 3HVUA 3C8MA 1OXMA 2QKYA 2ORWA 1OJLA 2XRMA 3P19A 4UBJA 2EZTA 2C0CA 5HMLA 1ZH8A 1S2GA 2NO4A 5ITVA 3F9IA 3L6DA 2F9FA 2AOTA 2PLAA 1CK4A 4AP6A 2J87A 4MKIA 1FS6A 3UKOA 5G0WA 3VAZA 5GIOE 1LLFA 3GJ5A 3B5JA 5COAA 3V7WA 1C30B 3WWYA 2O19A 1LWOA 4RKRA 3U7EB 2UUAB 3BKWA 2O2EA 5ENDA 2AYZA 1IQ0A 4YJ3B 3OE7D 5FPTA 4LYAA 1KS9A 3WIEA 1NW6A 3HY3A 4Q9AA 1SVSA 2EKLA 2OXTA 1X39A 1G6KA 1WCIA 1E92A 1FSFA 2RAPA 3PT9A 4MV1A 4O2BF 4ZTZB 3SKYA 1NW9B 2X2EA 3K73O 4MVJA 3L02A 3LUPA 1DJLA 2QX4A 4QOGA 2BEWA 2NYUA 2DSNA 4PY2A 2RC6A 4TV8B 1P1KA 3KXLA 1RXEA 4LDNA 4B7ZA 2UDPA 1TZCA 1F51E 4HUQB 1Y37A 1Z33A 2H63A 2AHOA 3H2IA 2WU0A 4Q1EA 1NG9A 3D81A 1JYEA 2C7BA 4H3SA 4HWSA 3SM3A 3C87A 4YBRA 2O7SA 3R0VA 1N2OA 1MJGM 1Z26A 4J03A 4YUZA 4YB8A 1OTXA 3UA4A 1SHUX 1TJ4A 3OPVA 4O63O 1JEDA 2Z04A 4P54A 3BRCA 2C31A 3CE9A 4IUDS 1Y34E 4C88A 1J39A 2R48A 1L9XA 1WD7A 1KO4A 2F90A 4KAFA 1RRGA 3BWVA 5EJAA 1NF9A 1TZ2A 2BHNA 2XOEA 2FLVA 3O4GA 1FP1D 1LK0A 2QQGA 4JT9A 5AKYA 1NZFA 3ZVLA 2CFSA 1SU7A 1ZJ5A 1U80A 1G4AE 2CT8A 4WK2B 1L8LA 2O3TA 3NWJA 1US8A 3CEJA 4C2AA 4C3VA 5BUQA 5ALXA 2MINA 3ADBA 4MVJM 3SQDA 1DWQA 1HYQA 5EIEA 4W1QA 2GEUA 1U0NA 3EEIA 3RS2A 4BFLA 1JZQA 1J07A 1RP1A 1K9VF 1U0LA 4EF6A 3EXG1 4XKJA 3GFQA 4OBWA 4S2EA 4NCAA 5JRZA 4DLZA 2H59A 1IN7A 3I6YA 1NW5A 1OT3A 1XCGB 5ICEA 4ER7A 2JFHA 3A3NA 5JDCA 3D7KA 3PTZA 4MEBA 5CJ2A 5JBNA 3EG9A 2QOEA 4KVGA 4LXXA 4U2GA 2PH3A 2RGNA 2XGOA 4BGUA 4BHTA 1D2NA 1G8KA 2EQ5A 3L06A 4OAOA 1QONA 1EG2A 2IGTA 3ZQ4A 4J2TA 2XNJA 2Z56A 4AN4A 1GPWB 3DD5A 3F90A 1W1UA 1J22A 1P9NA 4JBHA 4U00A 3SGLA 3UH1A 3SWWA 5F98A 2ZSJA 3MRXA 2B7LA 4WSOA 5I9SA 1UMDA 1K92A 2B34A 1SY7A 3FWYA 4BBZA 3IT1A 2YY5A 3K1AB 4ZU1X 4DOMA 1XAGA 5G02A 3NDIA 2R66A 4ZDIA 1JB9A 3DMHA 3A6FA 4X54A 2E5FA 2ZEJA 3NU1A 2X0DA 2B36A 4JLWA 1SUCA 5DJ5A 4JZKA 5KYNA 2J9GA 3AT1A 1C4WA 1CR0A 4OHMA 2QYTA 1KE1A 5IASA 1I2DA 2VAVA 2VYQA 4P4SA 3PFIA 3ERCA 1GT6A 4W9NC 4BNMA 3CRMA 4B9EA 5BY2A 1NBIA 1VYHA 5J40A 1QHGA 4MOWA 2IYQA 3NUGA 4QZVA 2EP7A 2LDBA 1N78A 2G1UA 3OU6A 5FPYA 1GGMA 4G84A 4K8OA 2XITA 1XWWA 1J2TA 5FPHA 4DV4B 5J2TA 4H7HA 2D54A 2NXEA 3COZA 2R4UA 1Z35A 5GINE 2F1HA 4QU0A 2YWFA 3K9LA 1VYTA 4CM7A 3TZEA 1QQAA 5HJ7A 1WB6A 3TSWA 3W9SA 4DPKA 2WTNA 2F3SA 2H1LA 4BB5A 3MBIA 1T36A 4TSFA 4II2A 4BCDA 3LVFO 1XLWA 1EU1A 1KYWA 2RK3A 4IDNA 3UFXB 4MUKA 4QOSA 1VHDA 2BP7B 2VHVA 3GP3A 3ITKA 3S40A 2JK1A 1LDYA 3HPRA 4ZP1A 4C06A 1ODSA 4RL4A 3IVRA 3GV0A 2XUGA 3GELA 3V5NA 4J4HA 3C48A 3D4BA 4OQLA 1RHRA 1JJAA 1V7CA 4JOCA 4LN1A 3KAJA 2PCJA 2BTOA 4IRXA 1NVEA 4P2GA 3FMVA 2WHEA 3NIGB 3GLGB 1G9XA 5AW5A 5FIUA 1CUXA 5K2OA 2I0FA 3B2QA 2TMGA 3JWHA 2DCMA 3LQYA 1KVQA 1U9JA 3W6OA 3UOGA 2XSZA 4BFZA 1F5SA 4KXVA 3DYIA 4C9BA 4ZVRA 1FNMA 3C70A 3QKSB 4IDFA 5P21A 3B6MA 3WRYA 3CVOA 2DHEA 4BWVA 3KD3A 2L69A 4MVXA 1TEZA 1IJEA 4OIMA 3X2SA 4LZAA 2PN1A 1XKLA 1OQAA 3GRYA 1T3TA 3R7FA 2ZG6A 2EL9A 5K0CA 1L4LA 2VF5X 4R5HA 5L3VA 4BO8A 3LBYA 2PS0A 1NAIA 3B9PA 3WL6A 3X2EA 1NVBA 3ON5A 5GZ6A 1PL8A 3GWZA 3PNPA 1YR9A 3ADOA 4V2UA 4E5DA 1JDTA 3L6UA 3UV6A 2ZUDA 4MUAA 4ZI2A 1AQNA 1AF4A 2RHHA 3AUUA 3BMOA 3HCAA 1JG7A 1TPZA 4J07A 4EHIA 3TIGA 3GLFB 5D8DA 4BJ3A 3BF8A 1VL6A 1FJGB 5FTKA 1KMHA 5IKOA 2ORVA 3M49A 5JQGF 1SBCA 2XUPA 3HYCA 3ANLA 1K7FB 1RS0A 1H42A 4GI5A 1JAXA 1CXZA 1UDAA 2NUBA 4BNTA 3NWPA 4X65B 3K32A 3B9QA 2QSYA 2ROQA 3COSA 3DHVA 3M4NA 4FYXA 1ENOA 2A9KA 4R5MA 4MS4B 4V38A 1I4DD 5A05A 5CFOA 4O4JF 1P4JA 3HWRA 1ID1A 3LE8A 5TPZD 1Z4OA 2QZSA 5K9ZA 4FGJA 4PRLA 1YIDA 3DJFA 3QW4B 2WTEA 2C97A 1EXDA 1TEVA 1SRQA 4NJEA 3KYJB 1WBDA 3OFSA 3BH7A 4ZXFA 5AVXA 3LPNA 3OIYA 1RM5A 2R7KA 1SM4A 4JCOA 4NESA 4WVLA 2I4MA 3K15A 2C5LA 5DEIA 1GPAA 5LB4A 4Z7JA 1JG1A 1K4MA 3L04A 2XJ9A 2NO5A 4B7XA 1JB1A 3OJOA 4NENB 3ZHTA 1UT6A 1NT2A 3WFZA 1NQTA 2K87A 1EDOA 1ZN8A 1ZMTA 1T8RA 2W4QA 4ECEA 5JLJA 3ASUA 4UNNA 5KYUB 3H84A 4PGGA 3FY4A 5CYPA 2AI3A 2GZDA 4HWKA 2BCEA 2DY0A 1R4MB 3KTAB 1Q0ZA 3L77A 4E1VA 1MB4A 1QDUA 3T1TA 1ACMA 4XQEA 1XJWA 2IOYA 5KQRA 3RAEC 5B2EA 2LUOA 4LJ8A 4UFPA 1YQXA 3K9GA 2ZUTA 3IAS6 1QTQA 3P32A 4IIXA 2AV6A 3AU8A 2Q3CA 3N7UA 1UH5A 1X7XA 4KWCA 5LC1A 3FWNA 1M1XB 4RCVA 5C80A 2QW0X 1Q7BA 5JD3A 4Y6RA 1WB5A 3TNJA 2BI4A 2AFIE 4ZPXA 4YH1A 3VKUA 9LDTA 5KVSA 1W6UA 2VJPA 1E2GA 2W90A 1KHHA 3HP4A 3U37A 4LYJA 1FX0A 4KXXA 4RTKA 3V4FA 5LJIA 1B8OA 1D04A 1XF9A 3I9V6 4D3XA 1U28C 2PUWA 1ODCA 4ZOBA 2ZRKA 5BNIA 1H1DA 2NX2A 4IUCS 4ADSG 1C0IA 2ZTSA 3QYJA 4LXHA 1XL1A 2ZJ2A 3EIEA 4O8ZA 1DUVG 5G4KA 4DG9A 1JXAA 3SE0A 1M83A 4FHEA 3VR6D 3VOAA 3PHLA 4D5EA 1VE5A 3OT4A 4EUSA 1K7YA 1LK7A 3BQ9A 4UJ3A 4D0SA 4FE4A 1GZHB 1DRVA 2XV1A 1XFAA 1CZOA 1J2EA 2H1CA 1E5DA 2PRSA 3N6RA 1RMQA 2OC4A 2Z4TA 3PLRA 3PRJA 3O3NB 4I1IA 1T8PA 4BQSA 1KEWA 3HA3A 3UCXA 4NP6A 4KREA 5EKDA 4PU0A 1VDMA 2P4UA 1DXYA 1I33A 3RVDA 2F59A 4L8VA 1AA9A 3UUEA 4LXIA 2GZ2A 2JBAA 4NZ9A 3BA1A 4NMXB 4YS6A 3RS8A 4DT1B 1L4GA 1FNNA 2H1IA 1L5SA 2CUNA 1UXKA 4QPCA 5LUAA 3SKXA 3KPWA 1C1XA 4GE3A 5IKXA 5AI6A 3QVLA 3I2GA 2REQB 1K98A 2J3JA 1DIAA 1K3FA 3ONNA 3W5JA 5KMGA 1DHTA 1GWNA 1XMJA 2PBFA 4HGNA 2CLDX 2PL5A 4KPGA 2MOKA 1CUYA 5AI5A 1I3CA 2RAVA 3HKBA 2FY8A 2HGZA 1W5AA 5TT1A 4CR8A 2I2CA 2PGAA 2JJ1D 4ZQEA 1QRTA 2BJWA 2D4AA 1KI9A 2B94A 4BN5A 5CEFA 5H3LA 3M6VA 4W5OA 3FNIA 4C29A 2VF7A 3D2LA 3EVBA 3IV9A 2ID9A 3O31A 3N58A 4JA0A 5DLEA 2R1VA 3RC2A 2E7ZA 5SY4A 4C20A 4CKBB 1XRQA 3MM4A 5A2QA 1WU8A 4MUBA 1L5HA 2QD4A 5AVZA 4P4UA 1EVYA 5KYVA 2PD3A 5AOAA 4Z9AA 4G0PA 4QXQA 3WXBA 1BMDA 1D8AA 2L42A 4CN8A 4HZUB 1UQTA 3DFFA 1X8KA 6AT1A 2FUNB 1WMBA 3JZMA 3MJHA 4LHYA 4NNOA 3R7AA 4CQMB 1CE8B 4GPIB 4HSEA 3KT6A 4BX8A 3DWEX 3W8DA 2GCIA 3R0IA 4DARA 3MJFA 1KI1A 2H2WA 1GNSA 3E27A 1BKYA 4FEEA 1ZOLA 3O1JC 3GUCA 1X7DA 1E59A 5LCXA 3OE4A 4QTTB 2DHCA 5JATA 4F3CA 4PGAA 4Z4GA 3VU8A 5CFLA 3QLJA 4Q4AA 4UCQA 3UOWA 4MV0A 3EF1A 4X7BA 4DLSA 2FX5A 3UAGA 3Q12A 5AD1A 5AJWA 4RGQA 2D5AA 1HI9A 5EP2A 2GK6A 5T67A 1AUVA 2IYTA 4EECA 3TGLA 4I50F 4ZCQA 3R7DA 2EG9A 5D51S 4N3BA 2H48A 4UU0A 1NV8A 1SZDA 2QRVA 4BN0A 4GVXA 4Q5IA 1DJQA 2IY7A 2PDAA 3I58A 4LJ4A 4NAHA 4EFLA 3WKDA 2WYWA 4G0OA 1H2HA 1T2EA 4KXMA 2I4RA 5C5IA 2AVDA 5DM4A 3KXIA 1OFHA 2BOVA 4MA0A 4OBEA 5DBGA 3W3ZB 4MUJA 4BRSA 2C8VA 2WIBA 3DCJA 4NG5A 4ND5A 2R8YA 4O2RA 1IL0A 3NTQA 3M0EA 2YVQA 1DP4A 4ND8B 5DFAA 4MUIA 4I1SA 5HUHA 2HHHB 2XWPA 4O8CA 2LRHA 5BSGA 4MCJA 3DFIA 4DXHA 1GAQA 4TLDA 4FYMA 1QE5A 3USES 4FSDA 4GI1A 2DR2A 3V2UA 3R9KA 2X41A 1XQVA 2PQ2A 2NMVA 5BSKA 1LD3A 3QLVA 3A9SA 4QXAA 2FETA 4JXZA 4KUEA 2ZFUA 1W1WA 3WJ2A 5DOVA 3LSTA 2V7VA 3Q3HA 3B12A 1KPHA 2KLBA 3GPIA 4AN1A 4ZQGA 1LFDB 4CKYA 2JJMA 4YREA 2B0JA 3MWKA 4YMWA 4F1WA 1C1HA 2R44A 3V46A 4HQLA 3Q8LA 2J9FB 1M1YB 2JH3A 1RLJA 2GCNA 4EPYA 3G9TA 4JJFA 4D0RA 3NT2A 1YJCA 2AI1A 1AKVA 2AZTA 1SRRA 4TRNA 5KPDA 5CDFA 5JJKA 3KHUA 4KYIB 3PNVA 2BGWA 2M6LA 3B48A 1K66A 2HTFA 1RDFA 3R6GA 4HQNA 4R7TA 1QH8B 3V55A 3ZQUA 1SD2A 4FDLA 4BL5A 5DNYB 3EGDA 4FXOA 2C5AA 3ZNOA 2W42A 2WYVA 2XVYA 4OF4A 5LMNB 4C3OB 1RYYA 2X0RA 3GEPA 1W94A 1T5OA 2BONA 1TAGA 4ZA2A 4U5QA 5I7EA 1XDZA 2NU8A 2NTYC 3MJDA 1QKKA 2QN8A 3HO6A 5JNRA 5KIAA 1UZLA 2IU6A 2ZRHA 4XGKA 4IOKA 1OX5A 1O0SA 2RB5A 1YSCA 2HA6A 1RJDA 3GDFA 4PBTA 4Z8XA 4CU2A 4BQRA 3ONVA 3FPCA 5K20A 2GBGA 4OIFA 2X0FA 3N53A 1J2RA 3DOIA 3MNFA 1IJFA 2ZUBA 1Y5RA 4NEGA 2VJBA 2F8TA 2QMQA 4XYEA 1N3BA 2IX9A 3LCRA 3S5UA 3I5AA 4Q9KA 4HS9A 4R81A 2P0AA 3AHCA 3PF8A 3BM5A 1N5MA 1ZY2A 2A9OA 3DDUA 1XDBA 4DM3A 1JIIA 3O8NA 1AURA 1F2TA 2IXAA 3IBFA 3CEPB 1S8NA 5HKOA 1PP4A 1JKIA 4CTKA 3PC8A 1GYQA 2VH1A 4OHRA 2WV7A 4W6ZA 1CNFA 3W8FA 4X1IB 3HE3A 3UMCA 4JUIA 3BQNB 3EYWA 3JARA 5EIAA 4XM0A 3OA2A 4PGHA 3JQAA 2O3RA 3G13A 3B52X 4I5DA 3F8TA 2FN4A 3MS4A 4JLSA 4P08A 4UEWA 1NBME 4MGYR 5KTYA 5B55A 5ILQA 4LVNA 2FQXA 4I08A 4HX2A 4X1YB 4RTRA 1MXFA 1E5LA 4O4IB 3VSAA 4UNRA 4V03A 4ZC8A 4R2HA 3SIRA 2I3ZA 3VUEA 3GGPA 4WLEA 1AZLA 3EPHA 4NULA 4JJIA 4HNTA 3QMMA 5LD2C 4LDPA 3KEFA 1G5RA 2NZ2A 5I8ZA 3CN9A 1ULZA 5AHOA 3O1HB 4DJ5X 2CUZA 4DDKA 1ZD9A 1YQEA 4KO4S 5F2KA 4ZVPA 2WF5A 1FSZA 3EGEA 3TBHA 1H69A 1EZ4A 1FXSA 3WZLA 3ZD7A 2A1UB 1XR3A 4QVGA 3KLNA 4IOLA 3OE7A 2R68A 2YXEA 1YVUA 3PUJA 1QVAA 2FZVA 4P4TA 1E2JA 1K6JA 3DOEA 4V2IA 4FDVA 1ZXXA 2HPAA 4N03A 2AXNA 1SD1A 3TCXB 4F3TA 5FH9A 2PSDA 5FL7A 2AOUA 1NNI1 1ZUHA 2NTJA 3CF2A 1DBWA 4IHKA 2CUKA 4MW6A 3RNLA 4E09A 5I9IA 5AVJA 2X3FA 3F5DA 1JIJA 3KEMA 5AVQA 3O8RA 1Z2NX 3W2IA 1RC8A 4MTCA 3SZOA 3S1SA 1J0DA 4LOLA 5ABPA 2QMHA 3MINB 4PGMA 1W35A 2QTLA 4NFYA 2JIDA 3L7AA 3Q6IA 2O3QA 3ZE9A 4QNMA 3K09A 2B25A 3R2JA 4MV6A 4TN1A 4ZU3A 4DY4A 1E6KA 3GFSA 4GYJA 4JIMA 4G9GA 1N2EA 5G3YA 5EKSA 4F8JA 4AZ3A 2HJRA 1X7WB 3DAGA 1ZVKA 4LGMA 1YGYA 5JRJA 4GYWA 2HUNA 3X1ZA 1MX3A 3EUFA 4KQKA 1JFFB 2IWHA 5LPNA 3CT4A 4WXRA 3H4TA 5T41A 3I6IA 2IIBA 3LT0A 5IDVA 1O95D 4P7KA 2F64A 3ZWPA 2P1RA 4GL4A 3E05A 1GDHA 1ZI8A 2HU8A 2WSYB 4WNIA 3QBTA 3SP1A 4DNXA 4H7DA 4G0VA 1JWAB 2XE6A 3ZV6A 2QSZA 1NP7A 2VC2B 2I2XB 3ESQA 1OHHA 4DMKA 1PEDA 1TTPB 4QG3A 3D7NA 1MB2A 2EJCA 1CEQA 4TKUA 4OHCA 1SVKA 1C9KA 5EFZA 5AQ1A 3KK0A 3K20A 5CURA 4O4JB 3WJ1A 4BJHB 4BUCA 5ELXA 2BM1A 4BQFA 5JCZA 1EVZA 1USWA 1KBZA 3EVNA 3H8JA 3DKVA 4KN6A 4JWKA 1HLDA 2CMHA 5KOHB 1WE2A 1YDWA 2VAXA 3F0TA 4BE4A 1Y9AA 4JXJA 5T3UA 3RT7A 5KI6A 2AW3A 4QRDA 3HLYA 3IHKA 3MWJA 3GLUA 3ZTYA 4OGLA 1ILWA 5LNK6 2QENA 7MHTA 4CFSA 3FZNA 1PNQA 1Z8HA 4DR2B 3R8FA 3BCUA 3ISJA 1CVIA 2Q3LA 1QYXA 3MA0A 4QXRA 1ODJA 4Q9JA 3ZI7A 5G53C 5K0FA 1AGNA 2K4MA 4BVFA 3F6EX 5CLGA 1HFWA 4E4RA 2UZ4A 1EWRA 1H8EA 3MWLA 4EJ0A 4M1OA 2HSGA 1RHQA 1AN9A 1OU4A 3KKQA 3UJPA 2VP5A 5INTA 4WCVA 4NU0A 2RGCA 3RIGA 4OG2A 1Q12A 3QEJA 4PZ0A 3ZGZA 3IUJA 1NOIA 3GF4A 5L7WA 4BBAA 3QU9A 2UXBB 3G7NA 4W5TA 2I4NA 4V1CI 3BHIA 3SOZA 3EZ9A 3F47A 4HGOA 2R00C 4LWZA 1BKSB 4AJKA 4D8XA 1NNLA 2DHRA 3KVRA 3WGMA 1GDTA 5LQAA 1BA3A 3L07A 3I1YA 5BORA 2E1PA 4E5KA 2GAJA 1DC4A 2W6JA 3OPYA 4FWBA 1O3YA 2EP5A 4KJXA 4NEHB 5EINA 2OAEA 2IP1A 3H2YA 4C1BA 1V95A 5TNXA 1ENPA 3FUXA 4HDMB 3VDXA 3ZWCA 2UVQA 1AKUA 1W34A 4AF8A 2PANA 2AEEA 5L45A 3PE3A 3ZH9B 2HRZA 4AB1A 2DF8A 3C6MA 3LCVB 3GOHA 3M2PA 4CM6A 2H7XA 1SVIA 4COKA 3LT5A 2VK2A 3IKTA 3UB2A 4OFXA 1E1NA 1JUDA 2JRCA 2D0PB 3A1WA 3C3WA 5TVKA 4QEKA 4GLLA 3RNOA 4BMDA 4YHHB 3C3JA 2ISCA 4KOEC 4ZRDA 3NWEA 4UUBA 3VZCA 4WX2B 4ZI7A 3K2BA 1TT7A 1J49A 3VA7A 2QTTA 2HCJB 5H3HA 2IA5A 5CR9A 1KDZA 2VNHA 1FMCA 4PICA 3PNOA 4HX9A 4RPLA 1AHPA 4B44A 1WUJS 2O7VA 1G21A 3NIWA 4ON9A 3O2SB 3RBAA 3ZHOA 1M8PA 5C53B 1E9EA 1TDJA 4WXPA 4KN5A 1J8FA 4MKZA 1W5SA 4I1YA 3SZGA 5HXAA 3ZDDA 3K0FA 1EI9A 2A3NA 2QZ4A 3K1AA 5AKJA 4YGXB 1ORVA 1WCXA 3A7EA 4XYBA 5J23A 5BSTA 4D1YA 3IB3A 1W36C 3ZJ5A 1N34B 3R40A 2C3UA 4RKQA 5B12A 3TTTA 1C5KA 2A9VA 2GPNA 1WXFA 3FUCA 3GRUA 3I12A 2FWMX 4WH0A 1DOAA 1UKVY 3KBOA 4C22A 2A14A 3AP1A 4FLMA 1IBMB 2DKOA 2HRBA 1IXKA 2FPGB 5BN3B 3SZMA 1JHYA 5CB6A 1QLWA 2DQZA 2EZ9A 3VYSB 4E3ZA 3DPIA 3EWSA 1EZZA 2NUPB 2V3VA 3W1EA 3WRVA 1XWFA 1KJJA 2IT1A 4TMWA 3UAVA 2XLBA 3NDRA 4AULA 1EFRA 1UK8A 1VZ3A 1UMCA 1VIAA 2PRKA 2WAAA 1J06A 2GN9A 3GA5A 1PX0A 3R7NA 3RVLA 4GPTA 1QQBA 4Q05A 1DQSA 1FYEA 1X9HA 3F7NA 2Y8EA 1YCFA 1CQZA 2UU9B 3IH5A 1TRKA 2XUIA 1CJVC 3GLQA 3HR8A 3LZDA 3U62A 1QHHB 1U0JA 4H1WA 1S6YA 1V8PA 2ZITA 1SN7A 1T0UA 3NAQA 4OHWA 4U0KA 1IMOA 1U0RA 4JBWA 1A9QA 2ZTUA 3OC6A 4MYDA 3ED1A 2JI4A 4JROA 5LQRA 5C1PA 2ERCA 4FDMA 3FX2A 3N2GA 5IN4A 1BJTA 4PFQA 1JEOA 2C4HA 4TTAA 1QWSA 4DUYB 1HX7A 1T2NA 3AF0A 2X22A 4AW9A 4M2LA 1JH9A 3SSOA 4AMYA 5FI0B 1XTIA 3V34A 1K97A 4RZ2A 4GOOD 5FOSA 4UZFA 4WKBA 3PEYA 3BH6A 3MD9A 3HKEA 3C3CA 3OT5A 5C8DA 4KQ9A 4U7GA 3UH0A 5IHPA 4BO4A 3LI2A 3D02A 1ATZA 4PYRA 4HUQA 4K26A 1W76A 5ALHA 4B6PA 4CKEA 1GAWA 3SXJA 1U9CA 1J90A 3UY4A 4OI1A 1FU4A 1OOEA 3VVMA 4YBZA 5HUQA 3N2ZB 3AZPA 2W2VA 3MRTA 2VDMB 3DTVD 3F2VA 3PEVA 4IG4A 1CR6A 3LIIA 3UK6A 1WUYA 4HFJA 3ZV3A 4X6LA 3C15C 2N1BA 4PAMA 4F8YA 3BWXA 3PHGA 1W48A 2OHHA 3ZN2A 1IOWA 4JC5A 3GEBA 1SB9A 1DUIA 1KR2A 2NU6B 3K92A 2CHQA 5AJUA 1E63A 5AK5A 1MENA 3WK9A 3CH5A 1TK3A 1A72A 2JGFA 4ZK6A 4P32A 4LOHA 2RIRA 3D6FA 4UXHA 1YQ9A 1O77A 3MHPA 3KLPX 4FC7A 2Q3FA 5A1TA 5DIZA 1FFEA 5SZJA 2B4AA 1E1RA 1WCWA 1ZIDA 4D4GA 2GF2A 3EEQA 1GGNA 4BLOA 2ECKA 2OZLA 2QW1A 5AVYA 1WU7A 1SCAA 1PUIA 2O3JA 1TO6A 3Q88A 4GT1A 2Z8YM 4J9VA 4JLBA 4KQHA 4DGSA 1Q20A 2A0XA 3MAGA 2WF9A 1V39A 3IPXA 3NXKA 1BGWA 2NQ8A 2ZRAA 4G97A 4UUQA 1BMTA 4ZOLA 5E1OA 3VR6H 1WR8A 4XQ9A 1E94E 1X1TA 1JMVA 3MTBA 4JCCA 4AAYA 2VQDA 4M88A 2A94A 4RHEA 2JIMA 4N18A 2D2EA 5DXAA 3WRXA 2ZVDA 1F7UA 1VI2A 1SG0A 3BFVA 2CZGA 4I7EA 1QNFA 3GB9A 3DVLA 5HZMA 1FLAA 1Y4AE 1VBKA 2V7QD 3M5PA 3S29A 3OQBA 2ZCUA 1P81A 4E6PA 2IZ6A 2VEDA 2WZCA 3PNQA 3ZYZA 3AEXA 3PV0A 1R8YA 2YRXA 1ACLA 1X13A 1Y3DE 1WB4A 3D6JA 2Q7DA 5FCDA 1V2GA 2AZ4A 2VR1A 1LQTA 3CW2A 3PDIB 1IOLA 3RFFA 4ALNA 2AFHE 5JSKA 1W36B 2YJ3A 5AUNB 2FPKA 4N0EA 5EE5B 3UGQA 4BOYA 2OWDA 1SHJA 1XQ9A 1EQUA 2VJYA 3NTUA 1ZNQO 3QUAA 4LGVA 2PG3A 3E2MA 3WYFA 1FF9A 2AC7A 4M9SA 5ECDA 3FKSA 2P2CA 1XLVA 4KR7A 4IRUB 1U0FA 4ZZ1A 2XBUA 5EE0A 3I4FA 4GI3A 1HZJA 1H6BA 2GJ9A 2G9NA 3A26A 1HTTA 3G2QA 3NBXX 3AY7A 3DEAA 3IIEA 3HSKA 2GLTA 4HAWA 4Q18A 1PWXA 3RSQA 3GDWA 4BEWA 1EBFA 5AHXA 3ZNQA 2QVGA 1R4NA 2WSMA 2BGGA 1IVSA 2ZIXA 1A50B 1EP9A 1AQ6A 3EXFA 4FFRA 1WS6A 5DHAA 5GOTA 1TTQB 1BS1A 2G9VA 3CSSA 4GP6A 3KOMA 5FJIA 1E1CB 4TZ0A 5BMVF 3A4YA 4MYSA 1OWPA 2NXCA 3RQSA 1UWKA 3BCSA 4B17A 1IY2A 2AVNA 1DIOB 3HGQA 1RWBA 4OJTA 2NUTB 1ND5A 5JEEA 3KQOA 4PTZA 1KAHA 3G3EA 5TLSA 1YBMA 2KI5A 2I6FA 2KMLA 1RJWA 3UO8B 2B7CA 5CT8A 3MUEA 1U2RA 4DNOA 4O5OA 1RT9A 1YR3A 4AF7A 3WOHA 2BHTA 2YN0A 1WBBA 3UK0A 1XOIA 1E3WA 3T3NA 2PFKA 4DHEA 4EG0A 3A6GA 1SCUA 1AKRA 1JHXA 2PZMA 3A05A 3KR9A 3DEKA 4CEJB 1U6KA 1DEOA 2GFIA 3BVPA 3OEEA 4K6FA 1M5RA 4PLPA 1GAXA 4FMCF 2CVPA 1E4EA 3L1UA 3IQFA 1RWOA 3FCOA 5FWYA 2H1WA 4F9TA 3KJEA 1HWYA 1C2TA 2IWRA 3EEOA 4M49A 2L82A 5DI3A 1T8UA 3ZHBA 4UPEA 1A9XA 4RZXA 1VL1A 1P4AA 2FXIA 1Z22A 2Y68A 2GKGA 3MWEB 4HATA 4XR9A 5T8KA 1PCXA 4L6AA 5FJJA 1UKZA 3CEHA 4PNPA 2F2TA 2XY4A 4TSRA 1KY3A 3G0GA 1CF2O 4OXNA 2WTMA 1PVVA 2PD6A 4FN4A 3GZTB 1PGJA 5JAPA 1H4QA 3C0KA 1QHEA 1CUHA 4H59A 1V6CA 1XKTA 1ZM3A 2QJWA 3TI9A 1E1LA 1L8OA 1N25A 3DBHA 3KDSE 5KDOA 4N76A 1AKQA 1CR4A 1BC5A 1DQYA 1WUHS 3FMIA 1VHJA 3DNMA 5IM4A 1C9MA 4I8DA 3AIMA 3FYUB 2OCDA 5HK8A 3NUZA 1ULSA 4IQ8A 4NONA 4PS0A 4ZODA 1DAHA 5HKKD 4YP6A 1IUOA 2Q62A 1PQYA 4UHBA 1PR2A 3SZUA 4W8HA 1CY1A 1OXBB 2WD7A 3D5QA 3L7NA 3AM5A 3PPWA 4RK4A 3OY7A 5AJYA 5DCLA 5I8WA 1Z2OX 2E89A 2ZR8A 3H5IA 4MYTA 5JECA 1BH2A 1E9FA 2PR2A 3BL5A 4Y2SA 3FPKA 1JEQA 2OBLA 4GBJA 1ZNYA 1U9YA 2BDTA 5D6OA 4D45A 4CBVA 3I2YX 5KOHA 2YFQA 3GZNA 1GNQA 3F8WA 4LY3A 3K6SB 4D8YA 2C2YA 2PZKA 2IE0A 1QZ3A 3OZTA 4OOEA 2YMQA 4TROA 3DBVO 1N5LA 4AFNA 1H3FA 1ZHHA 2P2SA 3VI3B 2BUBA 4TTTS 3A4NA 1EFVA 1F2UA 2VFAA 2XJ4A 1DDIA 3UZUA 3TUZC 1ZMBA 4KN9S 2YV1A 2HU5A 4B6JA 5L4SA 1USGA 1KF0A 1OWNA 4LRXA 1OXSC 1YFKA 4Q4LA 7REQA 1PIWA 3R5XA 1JG6A 5JMPA 3BIXA 3CZQA 2XB6A 3OFVA 3O8BA 2YN4A 4WL0A 1RYBA 2IU0A 4H7KA 4OYRA 1VP3A 2QMYA 2JVIA 2DH5A 2AKEA 2GUWA 1S2IA 2RK4A 3H9GA 5KQLA 1G0NA 2QTWB 2J4DA 5HUJA 2AE2A 3LKDA 1Z38A 3M6WA 3L01A 1T13A 3O2NA 5KSYA 1W29A 2GF0A 4R4JA 2IODA 1B74A 1WPQA 2KW5A 2XZPA 4FZ5A 3WDLA 3H17A 3RG2A 1RAHA 4OQPA 1BHSA 2WP0A 4Y2RA 1R1DA 4U39A 3TPCA 1ZM7A 4MRRA 1HLFA 1KMIY 4WW0A 4CM4B 2JLQA 3FTQA 5JPDA 2W6QA 3UV3A 2HL6A 1E0SA 2R65A 3RUHA 2WKSA 3VDNB 3BK1A 5IXSA 4CDNA 2VAWA 2FCRA 4I55A 3PITA 3OZFA 4KXQA 2QPLA 4RNDB 1E3DA 3GJQA 1EUDB 1M2HA 3WYDA 3FGNA 1S4MA 3PRKE 5DWQA 5DHSA 1ZIXA 2QBYA 1Y82A 4E7OA 3QE2A 2BGIA 1KYTA 3MPUA 2W2XA 2ZE6A 4XVQA 5IJAA 2W70A 3F9RA 5A3QA 2J46A 2GJSA 3PI6A 1ADFA 3ND5A 3A25A 4IZ6A 2GLXA 4YMTA 2UUOA 4GKAA 1I0IA 1WMEA 3EASA 4TQ9A 1V1RB 5FT9A 3PNYA 1XRMA 4II7A 1IXZA 4OLJA 2CDCA 1WQ3A 3DBIA 3GRVA 4RD6A 4AMUA 2G3YA 3OCZA 3A3PA 2PBRA 3NP7A 4ZT3A 3Q0EA 4KWTA 1F9AA 5TJ9A 4D4IA 4P7BA 1WY7A 1AS0A 1QC5A 4R71A 1MA0A 1B14A 3E3NA 4J0IA 4N7JA 1M1NA 3Q8XB 1KQNA 1TYAE 5F1YA 3C6YA 4OJQA 4TTQA 2AUMA 3NLLA 2FXVA 5KYGA 4B3MB 4WJKB 1POXA 5SZHB 1CWUA 1VHQA 1ULUA 1C4XA 1YZ3A 4TYQA 3Q87B 1GA4A 2RI1A 3GH3A 2ZR9A 5G0SA 3URMA 1Y3IA 3AWDA 3ESYA 1U2TA 5FXMA 4C04A 4DLRA 2A7XA 1KERA 4OL0A 3RADC 1FNCA 2ZIEA 4QQFA 4DKJA 1J4AA 5LA6B 5JFOA 3RGGA 3BKXA 5EEHA 2GK4A 3UW3A 1QG6A 1BXRB 3I4CA 1HE4A 4G41A 3T5TA 1XQ1A 5M34A 5CA0B 1TLTA 2ZAOA 4JH0A 3ZCVA 1BHO1 2JB9A 4UC0A 5C9ZA 1RKBA 1N33B 3H5OA 3O1IC 5KWEA 2FRXA 3DGFC 3AHEA 5FBVB 2ADMA 4YUWA 4CMIB 5IARA 1XRRA 3P0JA 5K05A 1UAAA 1DARA 2Q46A 2R6JA 4JL8A 3UQYS 1RAGA 1KJNA 2XT6A 5A03A 1LRLA 1O4WA 3K8YA 5K0SA 1H5NA 1KOJA 3AIOA 3L5OA 3SVZA 5C7YA 1KC1A 3I30X 3R3XA 4LZZA 4GS5A 4YX9A 1VSQA 2QVLA 3NDPA 2C77A 4OHPA 5B3JA 1CNMA 5ANRB 1GUYA 2CV1A 3AK4A 4KCGA 5KJ6A 1BWQA 5H82A 3W3AH 3FFWA 2I34A 3DDNA 4E2YA 1FZQA 5A02A 1W52X 2I67A 1ZI6A 3C2QA 3RJ9A 1YDHA 3NT5A 4KX3A 2XZOA 4Q02A 1IUKA 2HX1A 2IYRA 1OIWA 4H0NA 2ZM6B 1A4UA 4PC3A 3KFXA 3LCUA 3PUKA 5HIJA 1Z0JA 3TJRA 3FFXA 4EA9A 3PEUA 3VPBA 3V8NA 2YY7A 4BRUA 3N75A 1AZWA 3QE4A 3MG9A 3ZY2A 4IQFA 1B8UA 3OECA 3QVXA 4FHGA 3T5AA 1QVVA 4DIOA 3K1ZA 3FCEA 2CKMA 3IYLW 4S1OA 1X38A 4TWJA 2BRUA 5CXUA 4KXLA 3E9ZA 3AVPA 3IIKA 3W8RA 5IUJC 2XD4A 2BWJA 1YOVA 2AMFA 1L5FA 1OHHD 1QAMA 1T2VA 2QM0A 1H2AS 4OQYA 4BKQA 1TF7A 5F9HA 4LZLA 3UATA 2ACVA 3RJMA 2IXFA 1EX6A 3SJCA 3O5AA 4JQCA 3VTZA 2QG6A 3PXBA 4MGIR 4AS2A 2NU7A 1NP3A 5BUZA 4DILA 3A6PC 2J45A 4LJSA 5IVKA 2FKAA 2Q2VA 1M0TA 2AMYA 3ADKA 1V7QA 2P65A 4YJKA 4FNAA 3RWBA 2OWEA 4J7AA 1XZJA 1E0AA 3RJTA 1XTUA 2FQYA 3H1FA 5EZ5A 1Z68A 2AMLA 3VMMA 4E70A 2HV8A 3OEED 3QKWA 5CFMA 2CLIB 4LZOA 2INGX 4AL4A 3KSBC 3HB1A 1OLOA 2NTNA 4WKGA 5DSTA 4RZUA 2RH8A 3SSAA 1I8TA 1II0A 3TTXA 1EP3B 4ZEMA 1A8HA 3KOXA 2O8BB 4DADA 1DUSA 1GQFA 3N8DA 1V43A 3OZBA 3L0DA 2DYKA 3EVGA 3ILXA 4D9EA 1C8LA 4ETMA 4BAUA 2D0OB 1C3JA 2ATVA 1UC9A 5E3JA 2X0KA 5ELMA 4H60A 4G81A 4CV0A 1XXHA 3ELYA 5LLSA 2F1OA 1UWVA 3JCZA 3F4LA 2PVPA 4Y8VA 1A9XB 4UFOA 4QJBA 1BRTA 4C89A 2X1VA 1I7NA 3OJ0A 3HBMA 1BEUB 2DPHA 3EBOA 5BR7A 4IV0A 1MJNA 1UDXA 3FLEA 3EEYA 4FHDA 2JLSA 4GOJA 4LMPA 3TRFA 3VXKA 1GO2A 2XUFA 4ZGWA 1AUXA 4ATNA 4F1JA 1GKIA 1XVIA 2A2ZA 2VHWA 3HC7A 1P0PA 3RC9A 3S55A 2NACA 3WLTA 4NZNA 3MAJA 4RX1A 3OJEA 2C95A 1QM5A 1PJSA 2VRBA 4HPJB 4YP0A 5AO9A 1E3WB 1NKVA 5IN5A 2XEXA 4CWAA 3E48A 2IUTA 2VP9A 3EZ2A 4YMSA 1VOTA 1ZO8A 1GSIA 3O4FA 5FWDA 4HMQA 2OA0A 1KAEA 1GFZA 1SGWA 2CXSA 2E9SA 2V6GA 2ZSDA 3PL5A 5AW6A 3L5KA 4D81A 2JLRA 2BCJQ 3P9CA 3TNYA 5JH7A 3W06A 4ZDKA 1V41E 2AJ8A 1PS9A 3U0VA 4E5SA 4OO3A 5G0VA 2C07A 2ZBDA 3PPIA 3B1KA 5JHHB 1EK5A 4BNJA 4M46A 1G59A 1ZI9A 3ZJ4A 1H6AA 3HXOA 5K8VA 2QLTA 2G9ZA 1HE8B 1MO2A 3ZLJA 3K0AB 3KV3O 5D5QA 3W5VA 2DC1A 1EZ1A 4BLWA 1XLUA 2D5IA 3MCVA 3K05A 5C7IO 4EABA 4PLGA 3A1DA 4NKRA 4L5YA 2C7VA 1WL8A 4JOSA 3GXOA 1I01A 3ORFA 3AF2A 3ZE7A 4KDEA 2NXWA 4YMHA 1YBVA 4Y2UA 2XRYA 3E82A 1IOZA 4MICA 1DS6A 1HUQA 1MT3A 5BPHA 5IDQA 1JT9A 2JCBA 3KCNA 4XB2A 3R7WB 3WGNA 3MN1A 4D9IA 1X6VA 2ERYA 3ZOZA 2C83A 3HKDB 3CKKA 2IXGA 5LLTA 1BEZA 1CZKA 3QVUA 4LXQA 4MQFB 1ECLA 1E1CA 3KC2A 1VKNA 3L7LA 4YAJA 3WISA 5BNZA 4JC0A 1BS2A 3OOHA 1P75A 1S2NA 2CW5A 4R2WA 5CB0A 2JLWA 3AI3A 2DT8A 3ORSA 1HE3A 3LLCA 2AK3A 4CMHA 1U8AA 1UMBA 1YJAA 3TXAA 4X3CA 3JQ9C 1V8ZA 5K8LA 2PUHA 2GBCA 2HMVA 1EDDA 3DO6A 4CE6A 1PZXA 3B7PA 5AJZA 1TM4E 4L16A 1KKUA 3UXEA 3RRMA 1R74A 3EMDA 5FO0A 1B8PA 1PZFA 3D7RA 2PKQP 2RCNA 4HADA 3V8BA 1A5SB 5HZGA 4TTVA 2QG9A 1UBCA 3UGJA 2W2KB 4BGDA 2VP2A 5LZ7A 3FM9A 4OGGA 3OBIA 2PUEA 3MW8A 3OWOA 1P5FA 1VC2A 4WVFA 4AZTA 4JB2A 3UQZA 2ZI9A 2UVDA 2JGLA 6PFKA 1V11A 3IDFA 3IHWA 4PXAA 3OKCA 1E7YA 1U81A 1QK3A 1GCAA 3N2GB 1VE1A 4WXHA 5KTTA 1SUSA 1IWPB 5E4YA 1YNSA 3LLSA 1EDBA 2QMOA 3I1FA 3EXHB 2FFQA 4FZRA 4N6GA 4AKTA 1Z7GA 4K9PA 4IAOA 2XCRB 1EUCA 1JSRA 4YAOA 2FOXA 3H9BA 2AF3C 5KVQA 2FH5B 1UBUS 4V0LA 1VSUA 2ZT7A 3IJRA 1HDOA 2IUEA 3I0NA 3S0JA 2ID4A 2WJYA 1XZQA 1HSOA 1V6SA 2E6KA 1G5IA 1O2DA 3KZKA 5IVIA 3L1HA 2VSOA 1HG1A 4NFSA 5IUKC 4O2BB 5JEDA 4PZDA 5FA5A 1ZD1A 4RIGA 2ECPA 3UT5B 3RUDA 4YRGA 5BSUA 2OSVA 5TGZA 3SJ7A 4WFKA 4YXWA 5EG5A 2IPOA 2FX2A 1GGJA 3ZXXA 4YCBA 3D59A 3INNA 5JAQA 4B7CA 1O1YA 1AKWA 3PNLA 3KSDO 4C7VA 3LGAA 4UVGA 2AQHA 5J59A 2QX8A 1E1MA 3E7PA 1GG8A 3GUVA 5F7XA 3AVWA 3AVQA 1OC2A 3IJEB 4UHJA 1ZUIA 2ZP1A 2FQQA 4LYDA 4XVHA 1ISSA 5DK4A 4A6EA 4ZCIA 5BW5A 1JFTA 1M75A 5CH8A 4E1AA 1Y6QA 4QUEA 4DV6B 4RMNA 1AS2A 3T1NA 4EHHA 3H11A 1G8YA 2G36A 2MMGA 1J8MF 1L7PA 3CTMA 3TI7A 4D98A 3KLMX 5C34B 5LNK1 2A5FA 3G5TA 1KAMA 2VF8A 2JFOA 1Z28A 2E4WA 3FTDA 4MR9A 3F6PA 3ZBPA 4NU5A 1CVLA 3PGXA 4ARUA 2KS6A 3PHCA 3PPVA 4REOA 3LQFA 5B4TA 3BL8A 2QN6A 1TZKA 3GRFA 5CW2A 5BXQC 3KJZA 3V3KA 1GT91 4KITB 1GV0A 3SF8B 4KR2A 4ENRA 8GPBA 2VPYA 4UPDA 2CE7A 3HR7A 4JJAA 4RMGA 5FNVB 3EA0A 4C0XA 3A4MA 1Z7EA 3T9EA 5E9WA 5A3JA 4E31A 2G9UA 3HYLA 3TD2A 4EKGA 1A1SA 4B9AA 4CQLB 4OL9A 5THQA 2QG4A 3HKEB 3KYIB 2IY9A 4AKEA 1THZA 1XDGA 2MTBA 4AKIA 1EHCA 3GHHA 1S7GA 3LBHA 5I9TA 4D43A 2X0IA 2V9CA 3IP9A 1S8OA 3P27A 3JXEA 1S1CA 1QV7A 1DAGA 1C50A 5COQA 3H04A 1BXRA 2WJAA 2L19A 3EFHA 4G2NA 5ALFA 5PNTA 2IY8A 3UV7A 4EAAA 4FZ3A 4FUTA 2G88A 5KHLB 3OKFA 3OIGA 1UEIA 1I9CA 5BV1A 1U7TA 4MWOA 3MIZA 3VR4H 1QVZA 4C14A 2UUCB 3V6MA 1VBFA 4HG2A 1ESEA 2YJ5A 3CPSA 3LC1O 4INPA 1XV5A 2J9ZB 1YRYE 3QEMA 3HJRA 4IKEA 2ONCA 5TEVA 1KDOA 1XZLA 3HU5A 3E9DA 1CQJA 1SXQA 1JQ3A 4M9ZA 4WCFB 3ZJUA 1OR8A 4A0QA 1D8TA 4BZPA 1AJEA 4OHYA 3E9MA 4M36A 2QJTA 2WFAA 3RAGA 1KETA 5ADHA 4DR4B 1G3MA 3AEKA 1C7JA 1CUVA 1X7YB 1OBHA 1BXGA 4RF4A 2LBPA 3FIJA 4L78A 4BLVA 5AVSA 3KEQA 2J3LA 3OKAA 3VR5A 4N39A 1U1EA 1RXUA 4XYLA 2CL0X 2J4FA 3P0FA 1K88A 3GDGA 1RJ9A 5GWXA 1CPYA 4RJIA 3A2NA 4PSAA 1U31A 3PD7A 4AZWA 4PSDA 1PZGA 1RI1A 1QTRA 2PSEA 2GEJA 5CAEB 1R8SA 1O9GA 3PKJA 2C9MA 2JI9A 2IS2A 2XCTB 3BA6A 2BTEA 3OUZA 3CLUC 2C0PA 2M1XA 3FTNA 4P9NA 2WV9A 4X8OA 2QE7A 1T5IA 4W4TA 4BKRA 2UYCA 2QTBA 5B37A 3VV3A 3T94A 4NS1A 3MXOA 4J0QA 4ED9A 3P45A 1R9GA 3TD9A 3GJXC 2EWMA 3QY0A 1QPBA 4BS9A 1J97A 3DBLA 2H4WA 1ODFA 1RQNA 2WSLA 3E7WA 1OROA 2OR3A 1GIAA 3LC7O 5E8JA 4JP5A 3EB9A 3IO5A 4WNAB 2D4HA 1O6GA 1YACA 1Z0KA 3AI7A 5ADVA 1CRPA 5HZHA 5AM2A 2HR1A 3ZWWA 4CQLA 2K7FA 4XW2A 3HZRA 2XWSA 2XMBA 3GJ3A 1UWLA 5LKRA 2PLFA 2IYZA 3LBFA 4PE5B 1LSJA 4M9XA 4QDJA 1R3DA 4JAVC 4ER0A 3ROQA 1Z5VA 2FWJA 4O4LF 1X7WA 4TT8A 3RF7A 2WHYA 1VGRA 1QDLB 3FZYA 4CNBA 3LDFA 1DLJA 1AUQA 1QGAA 4DL9A 4AKSA 2TECE 1OTHA 2VZEA 1SQGA 4RA6B 4TRJA 5B36A 4LFCB 3Q3VA 1QFMA 2F4NA 2AD1A 1GGVA 2ZE8A 1V47A 3STXA 3TLBA 1Y3BE 5I7WA 1M72A 3RUEA 3DNPA 1G7SA 3ORRA 1JHRA 3UANA 1YHZA 2XE4A 1PT9A 1X80B 4RTJA 3IVCA 4U7FA 4ZREA 1CQJB 4M21A 5JVDA 4TT3D 5E2BA 3BFXA 2R7LA 2QXYA 2R00A 3C5HA 1PFVA 1JHQA 5E6UA 1HC7A 3R0QA 1CUCA 5AT1A 4UTRA 4XEUA 4KXFB 1HETA 1KQFA 4KRFA 1MB3A 2B6NA 3H0KA 5IX8A 4L9WA 1DKQA 3K53A 2IYNA 4DIMA 2G76A 3PTLA 1MPXA 1OYOA 4LJ6A 2HFJA 1ULHA 2R8XA 1XNQB 3VSDA 1N2BA 4IDGA 4QE3A 5I9BA 2G5TA 1QFXA 4QATA 5EZYA 4EP1A 3EZ7A 1L4YA<