5ELAA

The structure of dhar1 from arabidopsis thaliana
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
212
structure length
211
Chain Sequence
ALEICVKAAVGAPDHLGDPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase DHAR1, mitochondrial
publication title Arabidopsis thaliana DHAR1 apo structure
rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 63
structure length 211
sequence length 212
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5elaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5elaA01
1F3AA 3GTUB 4MF6A 4IP1A 1BQ7A 2JZSA 4CHSA 5DCGA 3KH7A 3GL5A 1FOVA 6GSVA 2AYTA 2WDUA 3GSSA 3M1GA 2V41A 12GSA 2QGVA 3HVXA 3DMLA 2C80A 4EKZA 2IN3A 2H8LA 1YY7A 3FZ5A 2IIYA 3WYWA 3ZFBA 2WULA 5KN0A 2I4AA 2X8HA 1F37A 4XTSA 3QAVA 3HD5A 4K7IA 4V1Ag 2JADA 1JZRA 4D73B 2LSTA 4EVMA 3KIJA 4ULXA 4PXOA 1I5GA 1SK1A 2CX3A 4DVCA 3VI7A 2AV4A 1K0NA 4JR4A 3TJGA 4F0BA 2GLRA 1F6MC 2VL3A 2WZ9A 4Q5QA 17GSA 3LYKA 4HEA2 4KDXA 3ZVJA 1TOFA 2LNTA 4NWYA 3GSTA 1WRYA 2CX4A 2I81A 3GL3A 2YZUA 4F9ZA 2IJYA 4TR4A 3F3RA 2C0DA 4OFTA 2I1UA 1JFUA 2HZEA 2VM1A 2NVLA 1TK5B 3BBYA 2IFQA 3PPUA 3EWLA 4NXIA 1TKDB 4NAXA 3IA1A 4JRRA 3FR9A 4MF5A 4HZ4A 5D9XA 3WGEA 3P90A 1DSBA 2X64A 3N9JA 3PINA 3DRNA 4G0IA 1UN2A 4O7HA 4I5QA 2CAIA 4FIWA 4ML1A 1M9BA 3RPNA 3VWVA 2ZNMA 2IMFA 1PMTA 19GSA 4G9HA 4ECBA 4HJMA 2F3MA 4MPFA 3BCKA 5F07A 5A5KA 4FYUA 2GSRA 5DAKB 1K0OA 1PSQA 3FY7A 5G5EA 5D9VA 2MMAA 1AAZA 2HSYA 2K8SA 3UVTA 1OKDA 1XWGA 5D9TA 4MK3A 1FAAA 1R5AA 1TU8A 3LORA 1YQ1A 5ECPB 4HQZA 2FD3A 1ON4A 1K0AA 3C8EA 1O8XA 4WKWA 1E6BA 1SJZA 2CV4A 4JR6A 1MDJA 3ZFLA 1M9AA 2ZCTA 2H6YA 5HFGA 3APQA 4EF0A 4K8MA 1X9WB 3BOAA 1N2AA 3ZITA 2HRNA 5AIXA 2DJKA 2PWJA 5ABRA 2CAQA 5A4VA 3HZ8A 3LFLA 3CMIA 1GUMA 4EC0A 3LGCA 3LQ7A 2P5RA 1XWCA 3ZZXA 2P31A 1RQMA 4KW6A 2YANA 2Z9SA 3GYKA 1XVWA 2A2SA 1UVZA 4MPGA 3H79A 2GZZA 1F2EA 3F4TA 2NTOA 3O76A 2B1KA 3JCML 3C73A 1GSUA 4K0NA 2L5LA 5ECIB 4NV2A 3EINA 4PUFC 2VCVA 2YOIA 3QMXA 3FZAA 1U3IA 1MEKA 3MWHA 1T00A 2RLIA 6GSUA 2DBCA 5CP1A 4HOJA 2DJ0A 4LMWA 3ZTLA 3TDGA 3FEUA 4TRXA 3TRQA 3VPTA 2DJ2A 3VLNA 2C4JA 3HJMA 3ERFA 2WRTA 1AQVA 4POKA 1T8EB 1USBA 1X9MB 3IBHA 3VK9A 1R5PA 1O81A 4RUVA 2KHPA 2H30A 3EU3A 1NHOA 2NBSA 5D93A 4BVYA 3HJOA 4DEJA 1YDKA 2EIQA 5AN1A 2PBJA 2WJUA 6GSSA 4OO4A 1THOA 22GSA 4TR0A 1A2LA 3DEXA 4DSSA 1EZKA 3TJKA 2H73A 3I9V2 3GH9A 5H5RA 3MDKA 4IVFA 2H1DA 3UBKA 4FO5A 5IO0A 2QC7A 3TRPA 2H0HA 2LRTA 3UJ1A 1T4YA 4KAEA 4NMUA 3C71A 5IPGA 1A23A 3H4KA 3US3A 3FW2A 2DJJA 2DSAA 3D4TA 5ELAA 5DJLA 2OE0A 5B6NA 2B1LA 5G1KA 3J7Yb 3IC4A 3F63A 4GRFA 2LEGA 5CRDA 5F05A 1GL8A 3VWXA 1PKZA 2GSQA 2VD1A 1XW6A 2JZRA 3C1RA 3UIWA 2K9FA 2M80A 2EIRA 2PERA 3GKMA 4OFMA 2P5QA 5CRGA 3LXTA 2YZHA 3CTGA 3D21A 4Q5NA 2OA7A 5EL8A 2L6DA 2C3TA 3BJ5A 14GSA 5AGYA 4IHUA 3TB2A 1CQGA 4ZB6A 3CYNA 3ERGA 2JSZA 4MCUA 1R4WA 1E2YA 2GS3A 5EVOA 2LJAA 1B8XA 3IC8A 2F51A 2YWOA 3IHQA 4KDYA 5ECSA 1G7EA 1EOHA 2DJ3A 2R2JA 4ZBDA 1GNWA 4TN8A 18GSA 1O73A 3H1NA 1BEDA 2OBIA 4TVEA 1X5CA 5DAKA 2FWGA 9GSSA 3I43A 2O8VB 1AQWA 3IV4A 2F8FA 3M0FA 4ZB9A 5INYA 1ERUA 1KTEA 4PQ1A 3VPQA 5GAND 3WT2A 1FB0A 3ZRDA 3IPZA 3QD9A 1HYUA 3TUEA 4PQHA 3KTLA 4TXVA 2PMTA 2KUCA 5GSSA 2LV3A 1T1VA 3EMXA 3IR4A 1XXUA 2I9HA 3CBUA 3UEMA 1FO5A 1MDKA 2C0GA 2XHFA 2VUPA 3EYTA 5HR3A 4CDOA 1S3AA 3UAPA 1FW1A 3R2QA 5D9WA 1SU9A 2YWMA 1M0UA 5BMUA 4PGTA 2YJHA 1C72A 5FHIA 2OJLA 1GSDA 2JL4A 3UBLA 1ZOFA 5FT3A 3ME8A 4Q5RA 1TRWA 2VCWA 1AC1A 3A2VA 1MTCA 3QFBC 2IMEA 5C04A 1MD3A 3HVVA 4PUAA 2DIYA 3VWUA 2J23A 2A2RA 2HFDA 2F9SA 2DLXA 3KP9A 5FWGA 3ZIVA 1YEXA 1OC9A 2KLXA 3GMFA 2VOCA 3H8QA 3PR8A 5J5NA 2TRXA 4X1UA 7GSSA 2YV9A 2PPTA 5D73A 3N5OA 4ECCA 2X99A 1M99A 3KGKA 2L57A 4IQ1A 2RM5A 2VCTA 4GSNA 2VO4A 4L0WA 3A5WA 1V98A 2B5YA 4QQ7A 1QUWA 4NHZA 3APOA 3KM6A 1GSSA 3HA9A 4JE1A 2TRCP 3NIVA 3GURA 2VL2C 2ON7A 3RHBA 1UC7A 3QPMA 2FGXA 4EUYA 3LJRA 1W4VA 2MBSA 2LRNA 4CW9A 2LUSA 5IOXA 1KNGA 4JBBA 4POLA 5ENUA 2IWTA 2K18A 1WMJA 4WBJA 2H01A 1T3BA 4N11A 3CXGA 3ZREA 1AW9A 2HSMB 1PKWA 2OE1A 1XOAA 4FYCA 4N10A 3IDVA 3FR6A 2HSNB 2K8VA 2H71A 2N5BA 4K9ZA 4WF5A 2C8UA 3IRAA 1OC3A 5C00A 1Y6EA 2FHEA 3GX0A 5DALB 3CTFA 5ECHB 5KEJA 1GWCA 2H1BA 4TXOB 2EIOA 3KCMA 1WJKA 4TR1B 1YJ6A 5ID2B 3HY2A 4FH8A 1FVJA 5ECQB 3P2AA 1PA3A 4KCEA 4K2DA 1GTAA 5E59A 2YWIA 1GRXA 2VAFA 3FHKA 3ZYWA 2CZ2A 4J57E 4HU9A 3BCIA 3KZQA 4G0KA 3FK8A 2L6CA 1IYIA 4N0ZA 2LKUA 1A2JA 2HRKB 1A2MA 3TKPA 1SL2B 1T4ZA 3L9UA 1G6WA 2HNLA 1SYXA 1GSYA 1QGVA 3KD0A 4XS4B 4GF0A 5KN1A 1NHYA 4XRDA 4PNGA 1ZCPA 2RUFA 1EV4A 1TRSA 1LJRA 1PD21 2ES7A 2GVPA 1QK8A 4MA9A 1GLQA 1BYEA 2HQTA 1M2BA 2O89A 2AHEA 2L4QA 1WWJA 4KF9A 1SJ6A 2MMNA 1A8YA 1JLVA 2R3XA 4L5OA 2R5GA 4EDYA 2FY6A 4ZBAA 4AJ7A 3OR5A 1YEPA 3ZVJD 2XPDA 3CSIA 3IE3A 5ELGA 5CRHA 3F9UA 1R26A 4KE3A 3UMAA 4YQMA 1MDIA 1KBNA 3EURA 4FQUA 1A24A 2I3YA 2WB9A 4GTUA 4BVXB 2DIZA 3KEBA 2E0QA 5B8BA 2E2GA 2PVQA 1XFLA 5J9CA 1MD4A 1U3AA 3F4SA 2HI7A 2L4CA 4XRAA 3RHCA 1A0FA 1S3DA 1YZXA 3DVWA 2GT5A 3QDNA 3O3TA 1SD9A 1SJIA 5G2ZA 4K7NA 4ECJA 3CSHA 3G7JA 3S9FA 1PL1A 4AGSA 3C1SA 4TOPA 2DJ1A 1TW9A 6GSXA 3F6DA 3TGZA 2CZ3A 4L5LA 1TU7A 2FLSA 2C3QA 1ZZYA 2C0EA 2FUG2 1GTIA 5E4WA 1BJXA 3D22A 2YV7A 2LJKA 1H75A 3KP8A 4ZIJA 4KB3A 1XIYA 2OACA 1Z6NA 3E0UA 2CVKA 3UVHA 3FRCA 4WBRD 1K3OA 4YH2A 2YWNA 3D5JA 5G1LA 2A4VA 2JSYA 3M9KA 5DJMA 3M9JA 3TKSC 3LXZA 1M7TA 1Q98A 3PGTA 2RIIA 4IP6A 2GQKA 4IGJA 4WXTA 4BL7A 3L9SA 4K1FA 1QMVA 4ZL9A 3I69A 1JZWA 1GSEA 2O7KA 2CVDA 2VCQA 4E8EA 1FVKA 2H75A 3D0ZA 3TOUA 2B5EA 1ML6A 4GSSA 3IK7A 3F3QA 4O32A 1F3BA 2IMKA 4ID0A 1EWXA 2BMXA 1XWBA 3D6IA 5B7CA 3KJYA 2ZUPA 2RM6A 2RUEA 1OYJA 4KA0A 5IMVA 1VGLA 3DWVA 2OADA 3GRXA 3CRTA 4MH2A 1XCCA 5J9BA 1VF3A 3GTUA 3TJJA 1Z3EA 3E3EA 2AB6A 4KSMA 4DSQA 1U6TA 3L78A 1YKAA 4F0CA 5F0GA 4TR3A 4ILFA 5JCUA 4EDZA 4MZCA 4FYBA 4H86A 2VCZA 1O6JA 1F9MA 1TJDA 2VL9A 1GULA 4WF4A 3EE2A 4OO5A 4AJ6A 1TRUA 2QKEA 5HQPA 1ST9A 3DVXA 4XIHA 3QFAC 4BWQA 1U88A 1EGOA 2K6VA 2DMMA 1SL0B 3KXOA 5ECLB 4ISDA 1R7HA 1G7OA 4D73A 3GN3A 2VLTA 1VF1A 1EOGA 1LU4A 1N8JA 5DQYA 3WT1A 2V1MA 4HI7A 2X8GA 1SL1B 1X0RA 4TR1A 2XBIA 2CT6A 2YCDA 1HNCA 2PUKC 3VWWA 1HNBA 2LS5A 2C0FA 3GV1A 1Z7PA 3TJFA 1WOUA 3EMPA 4RQXA 4I8BA 3LSZA 4GQCA 4E8HA 5KN2A 4KSOA 3UL3A 2PN8A 2E2MA 1XW5A 1THXA 3Q6OA 1SENA 5GSTA 4ACSA 3ZMLA 3TKSE 4I97A 2AAWA 2D2ZA 4YQUA 1TXXA 4HU7A 1PL2A 2BTOT 3AY8A 1TK8B 1SYRA 2HRKA 1K0BA 5DDLA 1BG5A 3F6FA 3ZLPA 2HE3A 4F2IA 4WEYA 1PX6A 1AQXA 4ML6A 1Z9HA 4ZL8A 2M72A 2PVOC 4HJ2A 3IXRA 4IW9A 3MNGA 1OE8A 3LEFA 4OWYA 2MMOA 2H19A 4PX1A 3VI5A 4GWRA 4IKHA 5CRWA 4LMVA 4XS1A 3U5RE 2IPAA 4TW5A 3I6AA 3ERWA 1DBYA 4TKYA 5IMAA 4EL1A 5F8BA 1B48A 2FA4A 2VIMA 5ECNB 4MJBA 4MJCA 3TKRA 3TOTA 6GSYA 2P0GA 4G19A 5EY6A 5J4UA 4L8EA 1ILOA 4N0VA 4WETA 3A2XA 3MAKA 3HZ4A 2PU9C 1S3CA 4BA7A 1B4PA 2YNXA 1QXHA 2IL3A 5CAXA 1NM3A 1ZMAA 1TI1A 4ZILA 3L0HA 5A4WA 3GIXA 3GFKA 1TDIA 4EXJA 6GSTA 2QSIA 3HYPA 4MABA 1VF2A 1ZL9A 3FZ4A 3GH6A 1V57A 16GSA 2XPEA 3ED3A 1VF4A 1Z6MA 4WR5A 5EPFA 1RW1A 3APSA 1X5EA 2XC2A 1W89A 5G30A 4J2FA 1XW9A 4GQFA 2MMZA 5JCGA 2OE3A 2R4VA 2LQOA 3EVIA 2R37A 8GSSA 1GSQA 3HVSA 1J9BA 1OAZA 2V6OA 4IBPA 1DUGA 5HR1A 3KMOA 1RK4A 2FCHA 4ZXGA 2GQMA 3HXSA 3H93A 3TCOA 2GTUA 3EU4A 2H76A 1SKRB 2N5FA 1EV9A 4RI7A 5IMDA 4OD7A 1BAYA 4Z7XA 1EGRA 2H0GA 4OCFA 3ME7A 2TIRA 4G2EA 3MSZA 5HFKA 1SK0A 1QFNA 4JEDA 4MMMA 4KUNA 4V2LA 2PGTA 3HCZA 2G2QA 1Z5YE 2HT9A 2XBQA 2LTKA 3DIEA 1BX9A 3ZMKA 3F4RA 5JCWA 3QCPA 5B6MA 4DSSB 1NSWA 1Q4JA 4MZBA 2HRFA 4KGIA 3NZNA 4MJEA 3IAM2 1GSFA 20GSA 1GH2A 4MZWA 3QAWA 1AUCA 1GTUA 2HLSA 4IJIA 1SK2A 1TI3A 2LNSA 1DE1A 3HDCA 3A3TA 1NW2A 2FNOA 3QOUA 1X9SB 4USSA 3K8NA 2IMDA 4P3YB 5G31A 1YF0A 1FB6A 5D96A 3IK9A 4K0GA 2IMIA 1JZOA 3F0IA 1B4QA 4JU5A 2YP6A 3BD2A 2V32A 2HRAA 2WFCA 3DYRA 3M3MA 2REMA 3UOMA 1G0TA 3RBTA 2H6XA 3D4MA 10GSA 3KMNA 5IOWA 2CQ9A 4NPBA 4I6XA 5JWRB 1FG4A 2YJ7A 4POMA 13GSA 2NDOA 3L9VA 2AJQB 4OCEA 2VLUA 3DD3A 1JZDA 3TKQA 3W8JA 1XZOA 2GSSA 4LA1A 2VLVA 4L0UA 2HYXA 3Q19A 4MH3A 4AJ8A 1OC8A 4YAPA 1PN9A 4V1Ap 2YPMA 4G0LA 5DCHA 4MLYA 1URMA 2NPBA 4XHMA 2JU5A 2GSTA 5B8AA 4X43A 5ECRB 3W6GA 1M2AA 1V40A 3UARA 4XS6A 1YF1A 3W8SA 2WS2A 5AIVA 2H0IA 2ON5A 1EP8A 3E9JB 1V58A 1GTBA 4JZQA 1AIUA 5COHA 2AUVA 2GZYA 5J41A 3ZIJA 4I2TA 3O6TA 3PH9A 2KP1A 2GZPA 4KDUA 4K6XA 4Q5FA 1V2AA 2C1YA 1SKSB 2LQQA 1HNAA 5CNWA 1ZYQB 2VL2A 3FR3A 4IS0A 3GKKA 2UZ8A 1J08A 2KP2A 5JWQB 5IM9A 4ZBBA 2J9HA 5CO3A 4KCAA 2E7PA 4RI6A 5IPHA 1O85A 5L71A 4IELA 4ZL7A 2MBTA 2B3SA 4PNFA 4ZB8A 1XPVA 2X8CA 2BJXA 1GUKA 4LLRA 5DQSA 2H1AA 4HDEA 1SD8A 3RPPA 6GSWA 1ZGNA 5JWOB 3J7Yk 3TRXA 4IN0A 1OC9B 2FWFA 2JZTA 2V2GA 1WE0A 2FWHA 1M2DA 3DXBA 3G7IA 4POBA 3RDWA 2G0FA 1EP7A 4QL7A 1GP1A 3Q74A 4X0XA 1H4OA 4F03A 4LL1B 1PQNA 1WIKA 4OFNA 3NOFA 2B6MA 3A2WA 2OBKA 4PTSA 5CREA 1XOBA 1PGTA 3TJBA 4K7OA 3Q18A 2O87A 4EO3A 4NV5A 2DMLA 3ZL5A 4F82A 1K0CA 3LG6A 4LL4B 2B7JA 2V6KA 3V1WA 2OKAA 4YQVA 4MJAA 5H5SA 3FKFA 3CRUA 5CYYA 1KEBA 2B5XA 3HKRA 1I9DA 1J0FA 2HSMA 2C3NA 1WPIA 4KH7A 1XBSA 4HZ2A 3WGDA 3VURA 1OKTA 2F8AA 2O85A 2WGRA 3WGXA 4BWSA 4YAVA 1XWAA 5DALA 3HJPA 4MF7A 5G5FA 1PX7A 4TXOA 1CQHA 1TK0B 4KNDA 4NHWA 2MYGA 5ID2A 3L4NA 3IAS2 1T7PB 1G6YA 5ECKB 1FHEA 1X5DA 1OVNA 1O7UA 5AISA 2MZCA 3QAGA 5DVBA 3DKSA 4OMVA 3LYPA 2B7KA 2HZEB 1A0RP 4O92A 1K3YA 2IFQB 5LNKe 2H72A 1TTZA 3G9BA 5F06A 2H1GA 1GNEA 2HZFA 2DC5A 1PRXA 1ERTA 4MP4A 5KN3A 5ECOB 1B9YC 4XS4A 4QL9A 1IYHA 2L59A 4HS1A 5HR2A 2GDRA 3FYGA 4GXZA 2H66A 1V9WA 5IMZA 5IMFA 2GT6A 2H74A 4BPYA 3TKSA 1WP0A 5D8IA 2EC4A 1YKCA 4PURA 1TRVA 1Y25A 3R3EA 3U6VA 1GLPA 5GAPD 2ALBA 3HHVA 4HQSA 2GQLA 2HSHA 3RAZA 1SKWB 2VD0A 5HFIA 4J56E 1B9XC 4V2MA 1ERWA 3P7XA 4BVXA 4KX4A 1OE7A 1HD2A 3GKNA 3GNJA 2R6KA 2FA8A 1GUHA 1EEJA 2H6ZA 1LBKA 5ECMB 5IO2A 5H5QA 2H70A 2LRCA 1ZYEA 11GSA 4IQAA 3C7MA 4XCSA 1Z7RA 2VM2A 3P8WA 4HUAA 2VCXA 1ERVA 1O8WA 1TP9A 4GLTA 2KOKA 3GKXA 2LJRA 2YN1A 1ACVA 5LCZA 4G10A 2M46A 1K0MA 1UA5A 5A4UA 1K0DA 1EEMA 1JLWA 4RQRA 5LD0A 3GUSA 1XVQA 3F8UA 3LWAA 2CVBA 3KTBA 5HR0A 1K3LA 5IQYA 1U87A 3M8NA 3DGQA 2N5AA 3ISOA 4BL7B 2FWEA 2L5OA 5GZZB 4GCIA 3G7YA 3GA4A 2JACA 3IOSA 1ABAA 2CA8A 4MDCA 2HXKA 3FZ9A 3KH9A 3GHAA 4O5RA 1JHBA 1VRSD 4I2UA 4V2NA 3WD6A 3VFIA 4DSRA 4EE0A 1QQ2A 3GX8A 1DE2A 5IMCA 1AXDA 3SBCA 4AF2A 2WCIA 1HQOA 5J3RA 3EC3A 4N30A 4GSTA 5DBQA 5IIZA 4PQIA 3QR6A 4ECIA 3SWLA 4WR4A 4IJ3A 4BVYB 1A8LA 2GGTA 1XWKA 3CSJA
chains in the Genus database with same CATH superfamily
1F3AA 4FXYP 3GTUB 4MF6A 4IP1A 1BQ7A 2JZSA 4CHSA 5DCGA 3KH7A 3GL5A 1FOVA 6GSVA 3RFRC 2AYTA 2WDUA 3GSSA 3M1GA 3LW9A 2V41A 12GSA 2QGVA 3HVXA 3DMLA 2C80A 4EKZA 2IN3A 2H8LA 1YY7A 2WW0A 3FZ5A 2IIYA 3WYWA 3ZFBA 2WULA 5KN0A 2I4AA 1M3IA 2X8HA 1F37A 4XTSA 3QAVA 3HD5A 4K7IA 4V1Ag 2JADA 1JZRA 4D73B 2LSTA 4EVMA 3KIJA 4ULXA 4PXOA 1I5GA 1SK1A 2CX3A 4DVCA 3VI7A 2AV4A 1K0NA 4JR4A 1Y1UA 3TJGA 4F0BA 2GLRA 1F6MC 2VL3A 2WZ9A 4Q5QA 2X4AA 17GSA 3LYKA 4HEA2 4KDXA 3ZVJA 1TOFA 2LNTA 4NWYA 3GSTA 1WRYA 2CX4A 2I81A 3GL3A 2YZUA 4F9ZA 2IJYA 4TR4A 3F3RA 2C0DA 4OFTA 2I1UA 1JFUA 2HZEA 2VM1A 2NVLA 1TK5B 3BBYA 2IFQA 3PPUA 3EWLA 4NXIA 1TKDB 4NAXA 5A1NA 3IA1A 4JRRA 3FR9A 4MF5A 4HZ4A 5D9XA 3WGEA 3P90A 1DSBA 2X64A 3N9JA 3PINA 3DRNA 4G0IA 1UN2A 4O7HA 4I5QA 2CAIA 4FIWA 4ML1A 1M9BA 3RPNA 3VWVA 2ZNMA 2IMFA 1PMTA 19GSA 4G9HA 4ECBA 4HJMA 2F3MA 4MPFA 4GDFA 3BCKA 5F07A 5A5KA 4FYUA 2GSRA 5DAKB 1K0OA 1PSQA 3FY7A 5G5EA 3MIXA 5D9VA 2MMAA 1AAZA 2HSYA 2K8SA 3UVTA 1OKDA 1XWGA 5D9TA 4MK3A 1FAAA 1R5AA 1TU8A 3LORA 1YQ1A 5ECPB 4HQZA 2FD3A 1PN0A 1ON4A 1K0AA 3C8EA 1O8XA 4WKWA 1E6BA 1SJZA 2CV4A 4JR6A 5A34B 1MDJA 3ZFLA 1M9AA 2ZCTA 2H6YA 5HFGA 3APQA 4EF0A 4K8MA 1X9WB 3BOAA 1N2AA 3ZITA 1FOHA 2HRNA 5AIXA 2DJKA 2PWJA 5ABRA 2CAQA 5A4VA 3HZ8A 3LFLA 1S3RA 3CMIA 3CWGA 1GUMA 4EC0A 3LGCA 3LQ7A 2P5RA 1XWCA 3ZZXA 2P31A 1RQMA 4KW6A 2YANA 2Z9SA 3GYKA 1XVWA 2A2SA 1UVZA 4MPGA 3H79A 2GZZA 1F2EA 3F4TA 2NTOA 3O76A 2B1KA 4MNNA 3JCML 3C73A 1GSUA 4K0NA 3RGBC 2L5LA 5ECIB 4NV2A 3EINA 4PUFC 2VCVA 2YOIA 3QMXA 3FZAA 1U3IA 1MEKA 3MWHA 1T00A 2RLIA 6GSUA 2DBCA 5KOWA 5CP1A 4HOJA 2DJ0A 4LMWA 3ZTLA 3TDGA 3FEUA 4TRXA 3TRQA 3VPTA 2DJ2A 3VLNA 2C4JA 3HJMA 2WRTA 3ERFA 1AQVA 4POKA 1T8EB 1USBA 1X9MB 3IBHA 3VK9A 4K5RA 1R5PA 1O81A 4RUVA 2KHPA 2H30A 3EU3A 1NHOA 3TU3B 2NBSA 5D93A 4BVYA 3HJOA 4DEJA 1YDKA 2WVXA 5A5HB 2EIQA 5AN1A 2PBJA 2WJUA 6GSSA 4OO4A 1THOA 22GSA 4TR0A 2VKZG 1A2LA 3DEXA 4DSSA 1EZKA 3TJKA 2H73A 3I9V2 3GH9A 5H5RA 3MDKA 4IVFA 2H1DA 3UBKA 4FO5A 3EPTA 5IO0A 2QC7A 3TRPA 2H0HA 2LRTA 3UJ1A 1T4YA 4KAEA 4NMUA 3C71A 5IPGA 1A23A 3H4KA 3US3A 3FW2A 2DJJA 2DSAA 3D4TA 5ELAA 5DJLA 2WZSA 2OE0A 5B6NA 2B1LA 5G1KA 3J7Yb 3IC4A 3F63A 4GRFA 2LEGA 1ZYPA 5CRDA 5F05A 2WW2A 1GL8A 3VWXA 1PKZA 2GSQA 2VD1A 1XW6A 2JZRA 3C1RA 3UIWA 2K9FA 2M80A 2EIRA 2PERA 3GKMA 4OFMA 4AKGA 2P5QA 5CRGA 3LXTA 2YZHA 3CTGA 3D21A 4Q5NA 2OA7A 5EL8A 2L6DA 2C3TA 3BJ5A 14GSA 3FMWA 5AGYA 4IHUA 3TB2A 1CQGA 4ZB6A 3CYNA 3ERGA 4BIKA 2JSZA 4MCUA 1R4WA 1E2YA 2GS3A 5EVOA 2LJAA 1B8XA 3IC8A 2F51A 1PFOA 2YWOA 3IHQA 4KDYA 5ECSA 1G7EA 1EOHA 3CQFA 2DJ3A 3IHGA 2R2JA 4ZBDA 1GNWA 4TN8A 18GSA 1O73A 3H1NA 1BEDA 2OBIA 5J4VA 4TVEA 1X5CA 5DAKA 2FWGA 9GSSA 3I43A 2O8VB 1AQWA 3IV4A 2F8FA 3M0FA 4ZB9A 5INYA 1ERUA 1KTEA 4PQ1A 3VPQA 5GAND 3WT2A 1FB0A 3ZRDA 3IPZA 3QD9A 1HYUA 4CY6A 3TUEA 4PQHA 3KTLA 4YKFA 4TXVA 2PMTA 2KUCA 5GSSA 2LV3A 1T1VA 3EMXA 3IR4A 1XXUA 2I9HA 3CBUA 3UEMA 1FO5A 1MDKA 2C0GA 2XHFA 2VUPA 3EYTA 5HR3A 4CDOA 1S3AA 3UAPA 1FW1A 2WW1A 3R2QA 5D9WA 1SU9A 2YWMA 1M0UA 5BMUA 4PGTA 2YJHA 1C72A 5FHIA 2OJLA 1GSDA 2JL4A 3UBLA 1ZOFA 5FT3A 3ME8A 4Q5RA 1TRWA 2VCWA 1AC1A 3A2VA 1MTCA 3QFBC 2IMEA 5C04A 1MD3A 3HVVA 4PUAA 2DIYA 3VWUA 2J23A 2A2RA 2HFDA 2F9SA 2DLXA 3KP9A 5FWGA 3ZIVA 2QA2A 1YEXA 1OC9A 2KLXA 3GMFA 2VOCA 3H8QA 3PR8A 5J5NA 2TRXA 4X1UA 7GSSA 2YV9A 2PPTA 1ZYNA 5D73A 3N5OA 4ECCA 2X99A 1M99A 3KGKA 2L57A 4IQ1A 2RM5A 2VCTA 4GSNA 2VO4A 4L0WA 3A5WA 1V98A 2B5YA 4QQ7A 1QUWA 4NHZA 3APOA 4EIPA 3KM6A 1GSSA 3HA9A 4JE1A 2TRCP 3NIVA 3GURA 2VL2C 2ON7A 3RHBA 1UC7A 3A5IA 3QPMA 2FGXA 4EUYA 3LJRA 1W4VA 2MBSA 2LRNA 4CW9A 2LUSA 5IOXA 1KNGA 4JBBA 4POLA 5ENUA 2IWTA 1N25A 2K18A 1WMJA 4WBJA 2H01A 2R0PA 1T3BA 4N11A 3CXGA 3ZREA 1AW9A 2HSMB 1PKWA 2OE1A 4HSCX 2EFHA 1XOAA 4FYCA 4N10A 3IDVA 3FR6A 2HSNB 2K8VA 2H71A 2N5BA 4K9ZA 4WF5A 2C8UA 3IRAA 4O5UA 1OC3A 5C00A 1Y6EA 2FHEA 3GX0A 5DALB 3CTFA 5ECHB 5KEJA 1GWCA 2H1BA 4TXOB 2EIOA 3KCMA 1WJKA 4TR1B 1YJ6A 5ID2B 3HY2A 4FH8A 1FVJA 4W66A 5ECQB 3P2AA 1PA3A 4KCEA 4K2DA 1GTAA 5E59A 2YWIA 1GRXA 2VAFA 3FHKA 3ZYWA 2QA1A 2CZ2A 4J57E 4HU9A 3BCIA 3KZQA 4G0KA 3FK8A 2L6CA 1IYIA 4N0ZA 2LKUA 1A2JA 2HRKB 1A2MA 3TKPA 1SL2B 1T4ZA 3L9UA 1G6WA 2HNLA 1SYXA 1GSYA 1QGVA 3KD0A 4XS4B 4GF0A 5KN1A 1NHYA 4XRDA 4PNGA 1ZCPA 2RUFA 1EV4A 1TRSA 1LJRA 1PD21 2ES7A 2GVPA 1QK8A 4MA9A 1GLQA 1BYEA 2HQTA 1SVLA 1M2BA 2O89A 2AHEA 2L4QA 1WWJA 4KF9A 1SJ6A 2MMNA 1A8YA 1JLVA 2R3XA 4L5OA 2R5GA 4E68A 4AKXB 4EDYA 2FY6A 4ZBAA 4AJ7A 3OR5A 1YEPA 3ZVJD 2XPDA 3CSIA 3IE3A 5ELGA 5CRHA 3F9UA 1R26A 4KE3A 3UMAA 4YQMA 1MDIA 1KBNA 3EURA 4FQUA 1A24A 2I3YA 2WB9A 4GTUA 4BVXB 2DIZA 3KEBA 2E0QA 5B8BA 2E2GA 2PVQA 1XFLA 5J9CA 1MD4A 1U3AA 3F4SA 2HI7A 4AKIA 2L4CA 4XRAA 3RHCA 1A0FA 1S3DA 2R0GA 1YZXA 3DVWA 2A4HA 2GT5A 3O3TA 1SD9A 1SJIA 3QDNA 2WVZA 5G2ZA 4ECJA 3CSHA 4K7NA 3G7JA 3S9FA 1PL1A 4AGSA 3C1SA 4TOPA 2DJ1A 1TW9A 6GSXA 3F6DA 3TGZA 2CZ3A 4L5LA 1TU7A 2FLSA 2C3QA 1ZZYA 2C0EA 2FUG2 1GTIA 5E4WA 1BJXA 3D22A 2YV7A 2LJKA 4K5SA 1H75A 3KP8A 4ZIJA 4KB3A 1XIYA 2OACA 1Z6NA 3E0UA 2CVKA 3UVHA 3FRCA 4WBRD 1K3OA 4YH2A 2YWNA 3D5JA 5G1LA 2A4VA 2JSYA 3M9KA 5DJMA 3M9JA 3TKSC 3LXZA 1M7TA 1Q98A 2EFDA 3PGTA 2RIIA 2X49A 2GQKA 4IP6A 4IGJA 4WXTA 4BL7A 3L9SA 4K1FA 1QMVA 4ZL9A 3I69A 1JZWA 1GSEA 2O7KA 2CVDA 2VCQA 4E8EA 1FVKA 2H75A 3D0ZA 3TOUA 2B5EA 1ML6A 4GSSA 3IK7A 3F3QA 4O32A 1F3BA 2IMKA 4ID0A 1EWXA 2BMXA 1XWBA 3D6IA 5B7CA 3KJYA 2ZUPA 2RM6A 2RUEA 1OYJA 4KA0A 5IMVA 1VGLA 3DWVA 2OADA 3GRXA 3CRTA 4MH2A 1XCCA 5J9BA 1VF3A 3GTUA 3TJJA 1Z3EA 3E3EA 2AB6A 4KSMA 4DSQA 1U6TA 3L78A 1YKAA 4F0CA 5F0GA 4TR3A 2EFEA 4ILFA 5JCUA 4EDZA 4MZCA 1SVOA 4FYBA 4H86A 2VCZA 1O6JA 1F9MA 1TJDA 4X4JA 2VL9A 1GULA 4WF4A 3EE2A 4OO5A 4AJ6A 1TRUA 2QKEA 5HQPA 1ST9A 3DVXA 4XIHA 3QFAC 4BWQA 1U88A 1EGOA 2K6VA 2DMMA 1SL0B 3KXOA 5ECLB 4ISDA 1R7HA 1G7OA 4D73A 3GN3A 2VLTA 1VF1A 1EOGA 1LU4A 1N8JA 5DQYA 3WT1A 2V1MA 4HI7A 2X8GA 1SL1B 1X0RA 4TR1A 2XBIA 2CT6A 2YCDA 1HNCA 2PUKC 3VWWA 1HNBA 2LS5A 2C0FA 3GV1A 1Z7PA 3TJFA 1WOUA 3EMPA 4ICYA 4RQXA 4I8BA 3LSZA 4GQCA 4E8HA 5KN2A 4KSOA 3UL3A 2PN8A 2E2MA 1XW5A 1THXA 3Q6OA 1SENA 5GSTA 4ACSA 3ZMLA 3TKSE 4I97A 2AAWA 2D2ZA 4YQUA 1TXXA 4HU7A 1PL2A 2BTOT 3AY8A 1TK8B 1SYRA 2HRKA 1K0BA 5DDLA 1BG5A 3F6FA 5A1NB 3ZLPA 2DKHA 2HE3A 4F2IA 4WEYA 1PX6A 1AQXA 4ML6A 1Z9HA 4ZL8A 2M72A 2PVOC 4HJ2A 3IXRA 4IW9A 3MNGA 1OE8A 4O5QA 3LEFA 4OWYA 2MMOA 2H19A 4PX1A 3VI5A 4GWRA 4IKHA 5CRWA 4LMVA 4XS1A 3U5RE 2IPAA 4TW5A 3I6AA 3ERWA 1DBYA 4TKYA 5IMAA 4AKHA 4EL1A 5F8BA 1B48A 2FA4A 2VIMA 5ECNB 4MJBA 4QMKA 4MJCA 3TKRA 3TOTA 6GSYA 2P0GA 4G19A 5EY6A 5J4UA 4L8EA 1ILOA 4N0VA 4WETA 3A2XA 2H1LA 3MAKA 3HZ4A 2PU9C 1S3CA 4BA7A 1B4PA 2YNXA 1QXHA 2IL3A 5CAXA 1NM3A 1ZMAA 5J40A 5A34A 1TI1A 4ZILA 3L0HA 5A4WA 3GIXA 3GFKA 1TDIA 4EXJA 6GSTA 2QSIA 3HYPA 4MABA 1VF2A 1ZL9A 3FZ4A 3GH6A 1V57A 16GSA 2XPEA 3ED3A 1VF4A 1Z6MA 4WR5A 5EPFA 1RW1A 3APSA 1X5EA 2XC2A 1W89A 5G30A 4J2FA 1XW9A 4GQFA 2MMZA 5JCGA 1M3JA 2OE3A 2R4VA 2LQOA 3EVIA 2R37A 8GSSA 1GSQA 3HVSA 1J9BA 1OAZA 2V6OA 4IBPA 1YVLA 1DUGA 5HR1A 4EIQA 3KMOA 1RK4A 2FCHA 4ZXGA 2GQMA 3HXSA 3H93A 3TCOA 1S4BP 1SVMA 2GTUA 3EU4A 2H76A 1SKRB 2N5FA 1EV9A 4RI7A 5IMDA 4OD7A 1BAYA 4Z7XA 5J4YA 1EGRA 5KOXA 2H0GA 4OCFA 3ME7A 2O3EA 2TIRA 4G2EA 3MSZA 5HFKA 1SK0A 1QFNA 4JEDA 5J47A 4MMMA 4KUNA 4V2LA 2PGTA 3HCZA 2G2QA 1Z5YE 2HT9A 2WVXB 2XBQA 2LTKA 5A5HA 3DIEA 1BX9A 3ZMKA 3F4RA 5JCWA 3QCPA 5B6MA 2O36A 4DSSB 1NSWA 1Q4JA 4MZBA 2HRFA 4KGIA 3NZNA 4MJEA 3IAM2 1GSFA 20GSA 1GH2A 4MZWA 3QAWA 1AUCA 1GTUA 2HLSA 4IJIA 1SK2A 1TI3A 2LNSA 1DE1A 3HDCA 3A3TA 1NW2A 2FNOA 3QOUA 1X9SB 4AI6A 4USSA 3K8NA 2IMDA 4P3YB 5G31A 1YF0A 2A2PA 1FB6A 5D96A 3HVNA 3IK9A 4K0GA 2IMIA 1JZOA 3F0IA 1B4QA 4JU5A 2YP6A 3BD2A 2V32A 2HRAA 2WFCA 3DYRA 3M3MA 2REMA 3UOMA 4Z2UA 1G0TA 3RBTA 2H6XA 3D4MA 10GSA 3KMNA 1BF5A 5IOWA 2CQ9A 4NPBA 4I6XA 5JWRB 1FG4A 2YJ7A 4POMA 13GSA 2NDOA 3L9VA 2AJQB 4OCEA 2VLUA 3DD3A 1JZDA 3TKQA 3W8JA 1XZOA 2WVYA 2GSSA 4LA1A 2VLVA 4L0UA 2HYXA 3Q19A 4PI0C 4MH3A 4AJ8A 1OC8A 4YAPA 1PN9A 1I1IP 4V1Ap 2YPMA 4G0LA 2O5VA 5DCHA 4MLYA 1URMA 2NPBA 4XHMA 2JU5A 1XG8A 4A5PA 2GSTA 5B8AA 4X43A 5ECRB 3W6GA 1M2AA 1V40A 3MYDA 1YEWC 3UARA 4XS6A 1YF1A 3W8SA 2WS2A 5AIVA 2H0IA 2ON5A 1EP8A 3E9JB 1V58A 1GTBA 4JZQA 1AIUA 5COHA 2AUVA 2GZYA 5J41A 3ZIJA 4I2TA 3O6TA 3PH9A 2KP1A 2GZPA 4KDUA 4K6XA 4Q5FA 1V2AA 2C1YA 1SKSB 2LQQA 1HNAA 5CNWA 1ZYQB 2VL2A 5BMUB 3FR3A 4IS0A 3GKKA 2UZ8A 1J08A 2KP2A 5JWQB 5IM9A 4ZBBA 2J9HA 5CO3A 4KCAA 2E7PA 4RI6A 5IPHA 1O85A 5L71A 4IELA 4ZL7A 2MBTA 2B3SA 4PNFA 4ZB8A 1XPVA 2X8CA 2BJXA 1GUKA 4LLRA 5DQSA 2WW3A 2H1AA 4HDEA 1SD8A 3RPPA 6GSWA 1ZGNA 5JWOB 3J7Yk 3TRXA 4IN0A 1OC9B 2FWFA 2JZTA 2V2GA 1WE0A 2FWHA 1M2DA 3DXBA 3G7IA 4POBA 3RDWA 2G0FA 1EP7A 4QL7A 1GP1A 3Q74A 4X0XA 1H4OA 4F03A 4LL1B 1PQNA 2UV8G 1WIKA 4OFNA 3NOFA 2B6MA 3A2WA 2OBKA 4PTSA 5CREA 1XOBA 1PGTA 3TJBA 4K7OA 3Q18A 2O87A 4EO3A 4NV5A 2DMLA 3ZL5A 4F82A 1K0CA 3LG6A 4LL4B 2B7JA 4K2XA 2V6KA 3V1WA 2OKAA 4YQVA 4MJAA 5H5SA 3FKFA 2R0CA 3CRUA 5CYYA 1KEBA 2B5XA 3HKRA 1I9DA 1J0FA 2HSMA 2C3NA 1WPIA 4KH7A 1XBSA 4Z2TA 4HZ2A 2HSNA 3WGDA 3VURA 1OKTA 2F8AA 2O85A 2WGRA 3WGXA 4BWSA 4YAVA 1XWAA 5DALA 3HJPA 4MF7A 5G5FA 1PX7A 4TXOA 1CQHA 1TK0B 4KNDA 4NHWA 2MYGA 5ID2A 3L4NA 3IAS2 1T7PB 1G6YA 5ECKB 2DKIA 1FHEA 1X5DA 1OVNA 2OT3A 1O7UA 5AISA 4YKGA 2MZCA 4N3ZA 3QAGA 5DVBA 3DKSA 4OMVA 3LYPA 2B7KA 2HZEB 1A0RP 4O92A 1K3YA 2IFQB 5LNKe 2H72A 1TTZA 3G9BA 5F06A 2H1GA 1GNEA 2HZFA 2DC5A 1PRXA 1ERTA 1TXUA 4PHZC 4ZB7A 4MP4A 5KN3A 5ECOB 1B9YC 4XS4A 4QL9A 1IYHA 2L59A 4HS1A 5HR2A 2GDRA 3FYGA 4GXZA 2H66A 1V9WA 5IMZA 5IMFA 2GT6A 2H74A 4BPYA 3TKSA 1WP0A 5D8IA 2EC4A 1YKCA 4PURA 1TRVA 1Y25A 3R3EA 3U6VA 1BG1A 1GLPA 5GAPD 2ALBA 3HHVA 4HQSA 2GQLA 2HSHA 3RAZA 1SKWB 2VD0A 5HFIA 4J56E 1B9XC 4V2MA 1ERWA 3P7XA 4BVXA 4KX4A 1OE7A 1HD2A 3CHXC 3GKNA 4G01A 3GNJA 5BRTA 2R6KA 2FA8A 1GUHA 1EEJA 2H6ZA 1LBKA 5ECMB 5IO2A 3HMJG 5H5QA 2H70A 2LRCA 1ZYEA 11GSA 4IQAA 3C7MA 4CY8A 4XCSA 1Z7RA 2VM2A 3P8WA 4HUAA 2VCXA 1ERVA 1O8WA 4Z2RA 1TP9A 4GLTA 2KOKA 3GKXA 2LJRA 2YN1A 1ACVA 5LCZA 4G10A 2M46A 1K0MA 1UA5A 5A4UA 1K0DA 1EEMA 1JLWA 4RQRA 5LD0A 3GUSA 1XVQA 3F8UA 3LWAA 2CVBA 3KTBA 5HR0A 1K3LA 5IQYA 1U87A 3M8NA 3DGQA 2N5AA 3ISOA 4BL7B 2FWEA 2L5OA 5GZZB 4GCIA 3G7YA 3GA4A 2JACA 4PI2C 3IOSA 1ABAA 2CA8A 4MDCA 2HXKA 3FZ9A 3KH9A 3GHAA 4O5RA 1JHBA 1VRSD 4I2UA 4V2NA 3WD6A 3VFIA 4DSRA 4EE0A 1QQ2A 3GX8A 1DE2A 5IMCA 1AXDA 3SBCA 4AF2A 2WCIA 1HQOA 2EFCA 5J3RA 3EC3A 4N30A 4GSTA 5DBQA 5IIZA 4PQIA 3QR6A 4ECIA 3SWLA 4WR4A 4IJ3A 4BVYB 1A8LA 2GGTA 1XWKA 3CSJA
chains in the Genus database with same CATH topology
1F3AA 3GTUB 4MF6A 4IP1A 1BQ7A 2JZSA 4CHSA 5DCGA 3KH7A 3GL5A 1FOVA 6GSVA 2AYTA 2WDUA 3GSSA 3M1GA 3LW9A 2V41A 12GSA 2QGVA 3HVXA 3DMLA 2C80A 4EKZA 2IN3A 2H8LA 1YY7A 3FZ5A 2IIYA 3WYWA 3ZFBA 2WULA 5KN0A 2I4AA 2X8HA 1F37A 4XTSA 3QAVA 3HD5A 4K7IA 4V1Ag 2JADA 1JZRA 4D73B 2LSTA 4EVMA 3KIJA 4ULXA 4PXOA 1I5GA 1SK1A 2CX3A 4DVCA 3VI7A 2AV4A 1K0NA 4JR4A 1Y1UA 3TJGA 4F0BA 2GLRA 1F6MC 2VL3A 2WZ9A 4Q5QA 2X4AA 17GSA 3LYKA 4HEA2 4KDXA 3ZVJA 1TOFA 2LNTA 4NWYA 3GSTA 1WRYA 2CX4A 2I81A 3GL3A 2YZUA 4F9ZA 2IJYA 4TR4A 3F3RA 2C0DA 4OFTA 2I1UA 1JFUA 2HZEA 2VM1A 2NVLA 1TK5B 3BBYA 2IFQA 3PPUA 3EWLA 4NXIA 1TKDB 4NAXA 5A1NA 3IA1A 4JRRA 3FR9A 4MF5A 4HZ4A 5D9XA 3WGEA 3P90A 1DSBA 2X64A 3N9JA 3PINA 3DRNA 4G0IA 1UN2A 4O7HA 4I5QA 2CAIA 4FIWA 4ML1A 1M9BA 3RPNA 3VWVA 2ZNMA 2IMFA 1PMTA 19GSA 4G9HA 4ECBA 4HJMA 2F3MA 4MPFA 4GDFA 3BCKA 5F07A 5A5KA 4FYUA 2GSRA 5DAKB 1K0OA 1PSQA 3FY7A 5G5EA 3MIXA 5D9VA 2MMAA 1AAZA 2HSYA 2K8SA 3UVTA 1OKDA 1XWGA 5D9TA 4MK3A 1FAAA 1R5AA 1TU8A 3LORA 1YQ1A 5ECPB 4HQZA 2FD3A 1PN0A 1ON4A 1K0AA 3C8EA 1O8XA 4WKWA 1E6BA 1SJZA 2CV4A 4JR6A 5A34B 1MDJA 3ZFLA 1M9AA 2ZCTA 2H6YA 5HFGA 3APQA 4EF0A 4K8MA 1X9WB 3BOAA 1N2AA 3ZITA 1FOHA 2HRNA 5AIXA 2DJKA 2PWJA 5ABRA 2CAQA 5A4VA 3HZ8A 3LFLA 3CMIA 3CWGA 1GUMA 4EC0A 3LGCA 3LQ7A 2P5RA 1XWCA 3ZZXA 2P31A 1RQMA 4KW6A 2YANA 2Z9SA 3GYKA 1XVWA 2A2SA 1UVZA 4MPGA 3H79A 2GZZA 1F2EA 3F4TA 2NTOA 3O76A 2B1KA 4MNNA 3JCML 3C73A 1GSUA 4K0NA 2L5LA 5ECIB 4NV2A 3EINA 4PUFC 2VCVA 2YOIA 3QMXA 3FZAA 1U3IA 1MEKA 3MWHA 1T00A 2RLIA 6GSUA 2DBCA 5KOWA 5CP1A 4HOJA 2DJ0A 4LMWA 3ZTLA 3TDGA 3FEUA 4TRXA 3TRQA 3VPTA 2DJ2A 3VLNA 2C4JA 3HJMA 2WRTA 3ERFA 1AQVA 4POKA 1T8EB 1USBA 1X9MB 3IBHA 3VK9A 4K5RA 1R5PA 1O81A 4RUVA 2KHPA 2H30A 3EU3A 1NHOA 3TU3B 2NBSA 5D93A 4BVYA 3HJOA 4DEJA 1YDKA 5A5HB 2EIQA 5AN1A 2PBJA 2WJUA 6GSSA 4OO4A 1THOA 22GSA 4TR0A 2VKZG 1A2LA 3DEXA 4DSSA 1EZKA 3TJKA 2H73A 3I9V2 3GH9A 5H5RA 3MDKA 4IVFA 2H1DA 3UBKA 4FO5A 3EPTA 5IO0A 2QC7A 3TRPA 2H0HA 2LRTA 3UJ1A 1T4YA 4KAEA 4NMUA 3C71A 5IPGA 1A23A 3H4KA 3US3A 3FW2A 2DJJA 2DSAA 3D4TA 5ELAA 5DJLA 2OE0A 5B6NA 2B1LA 5G1KA 3J7Yb 3IC4A 3F63A 4GRFA 2LEGA 1ZYPA 5CRDA 5F05A 1GL8A 3VWXA 1PKZA 2GSQA 2VD1A 1XW6A 2JZRA 3C1RA 3UIWA 2K9FA 2M80A 2EIRA 2PERA 3GKMA 4OFMA 4AKGA 2P5QA 5CRGA 3LXTA 2YZHA 3CTGA 3D21A 4Q5NA 2OA7A 5EL8A 2L6DA 2C3TA 3BJ5A 14GSA 3FMWA 5AGYA 4IHUA 3TB2A 1CQGA 4ZB6A 3CYNA 3ERGA 2JSZA 4MCUA 1R4WA 1E2YA 2GS3A 5EVOA 2LJAA 1B8XA 3IC8A 2F51A 2YWOA 3IHQA 4KDYA 5ECSA 1G7EA 1EOHA 2DJ3A 3IHGA 2R2JA 4ZBDA 1GNWA 4TN8A 18GSA 1O73A 3H1NA 1BEDA 2OBIA 5J4VA 4TVEA 1X5CA 5DAKA 2FWGA 9GSSA 3I43A 2O8VB 1AQWA 3IV4A 2F8FA 3M0FA 4ZB9A 5INYA 1ERUA 1KTEA 4PQ1A 3VPQA 5GAND 3WT2A 1FB0A 3ZRDA 3IPZA 3QD9A 1HYUA 4CY6A 3TUEA 4PQHA 3KTLA 4YKFA 4TXVA 2PMTA 2KUCA 5GSSA 2LV3A 1T1VA 3EMXA 3IR4A 1XXUA 2I9HA 3CBUA 3UEMA 1FO5A 1MDKA 2C0GA 2XHFA 2VUPA 3EYTA 5HR3A 4CDOA 1S3AA 3UAPA 1FW1A 3R2QA 5D9WA 1SU9A 2YWMA 1M0UA 5BMUA 4PGTA 2YJHA 1C72A 5FHIA 2OJLA 1GSDA 2JL4A 3UBLA 1ZOFA 5FT3A 3ME8A 4Q5RA 1TRWA 2VCWA 1AC1A 3A2VA 1MTCA 3QFBC 2IMEA 5C04A 1MD3A 3HVVA 4PUAA 2DIYA 3VWUA 2J23A 2A2RA 2HFDA 2F9SA 2DLXA 3KP9A 5FWGA 3ZIVA 2QA2A 1YEXA 1OC9A 2KLXA 3GMFA 2VOCA 3H8QA 3PR8A 5J5NA 2TRXA 4X1UA 7GSSA 2YV9A 2PPTA 1ZYNA 5D73A 3N5OA 4ECCA 2X99A 1M99A 3KGKA 2L57A 4IQ1A 2RM5A 2VCTA 4GSNA 2VO4A 4L0WA 3A5WA 1V98A 2B5YA 4QQ7A 1QUWA 4NHZA 3APOA 4EIPA 3KM6A 1GSSA 3HA9A 4JE1A 2TRCP 3NIVA 3GURA 2VL2C 2ON7A 3RHBA 1UC7A 3A5IA 3QPMA 2FGXA 4EUYA 3LJRA 1W4VA 2MBSA 2LRNA 4CW9A 2LUSA 5IOXA 1KNGA 4JBBA 4POLA 5ENUA 2IWTA 1N25A 2K18A 1WMJA 4WBJA 2H01A 2R0PA 1T3BA 4N11A 3CXGA 3ZREA 1AW9A 2HSMB 1PKWA 2OE1A 2EFHA 1XOAA 4FYCA 4N10A 3IDVA 3FR6A 2HSNB 2K8VA 2H71A 2N5BA 4K9ZA 4WF5A 2C8UA 3IRAA 4O5UA 1OC3A 5C00A 1Y6EA 2FHEA 3GX0A 5DALB 3CTFA 5ECHB 5KEJA 1GWCA 2H1BA 4TXOB 2EIOA 3KCMA 1WJKA 4TR1B 1YJ6A 5ID2B 3HY2A 4FH8A 1FVJA 4W66A 5ECQB 3P2AA 1PA3A 4KCEA 4K2DA 1GTAA 5E59A 2YWIA 1GRXA 2VAFA 3FHKA 3ZYWA 2QA1A 2CZ2A 4J57E 4HU9A 3BCIA 3KZQA 4G0KA 3FK8A 2L6CA 1IYIA 4N0ZA 2LKUA 1A2JA 2HRKB 1A2MA 3TKPA 1SL2B 1T4ZA 3L9UA 1G6WA 2HNLA 1SYXA 1GSYA 1QGVA 3KD0A 4XS4B 4GF0A 5KN1A 1NHYA 4XRDA 4PNGA 1ZCPA 2RUFA 1EV4A 1TRSA 1LJRA 1PD21 2ES7A 2GVPA 1QK8A 4MA9A 1GLQA 1BYEA 2HQTA 1SVLA 1M2BA 2O89A 2AHEA 2L4QA 1WWJA 4KF9A 1SJ6A 2MMNA 1A8YA 1JLVA 2R3XA 4L5OA 2R5GA 4E68A 4AKXB 4EDYA 2FY6A 4ZBAA 4AJ7A 3OR5A 1YEPA 3ZVJD 2XPDA 3CSIA 3IE3A 5ELGA 5CRHA 3F9UA 1R26A 4KE3A 3UMAA 4YQMA 1MDIA 1KBNA 3EURA 4FQUA 1A24A 2I3YA 2WB9A 4GTUA 4BVXB 2DIZA 3KEBA 2E0QA 5B8BA 2E2GA 2PVQA 1XFLA 5J9CA 1MD4A 1U3AA 3F4SA 2HI7A 4AKIA 2L4CA 4XRAA 3RHCA 1A0FA 1S3DA 2R0GA 1YZXA 3DVWA 2A4HA 2GT5A 3O3TA 1SD9A 1SJIA 3QDNA 5G2ZA 4ECJA 3CSHA 4K7NA 3G7JA 3S9FA 1PL1A 4AGSA 3C1SA 4TOPA 2DJ1A 1TW9A 6GSXA 3F6DA 3TGZA 2CZ3A 4L5LA 1TU7A 2FLSA 2C3QA 1ZZYA 2C0EA 2FUG2 1GTIA 5E4WA 1BJXA 3D22A 2YV7A 2LJKA 4K5SA 1H75A 3KP8A 4ZIJA 4KB3A 1XIYA 2OACA 1Z6NA 3E0UA 2CVKA 3UVHA 3FRCA 4WBRD 1K3OA 4YH2A 2YWNA 3D5JA 5G1LA 2A4VA 2JSYA 3M9KA 5DJMA 3M9JA 3TKSC 3LXZA 1M7TA 1Q98A 2EFDA 3PGTA 2RIIA 2X49A 2GQKA 4IP6A 4IGJA 4WXTA 4BL7A 3L9SA 4K1FA 1QMVA 4ZL9A 3I69A 1JZWA 1GSEA 2O7KA 2CVDA 2VCQA 4E8EA 1FVKA 2H75A 3D0ZA 3TOUA 2B5EA 1ML6A 4GSSA 3IK7A 3F3QA 4O32A 1F3BA 2IMKA 4ID0A 1EWXA 2BMXA 1XWBA 3D6IA 5B7CA 3KJYA 2ZUPA 2RM6A 2RUEA 1OYJA 4KA0A 5IMVA 1VGLA 3DWVA 2OADA 3GRXA 3CRTA 4MH2A 1XCCA 5J9BA 1VF3A 3GTUA 3TJJA 1Z3EA 3E3EA 2AB6A 4KSMA 4DSQA 1U6TA 3L78A 1YKAA 4F0CA 5F0GA 4TR3A 2EFEA 4ILFA 5JCUA 4EDZA 4MZCA 1SVOA 4FYBA 4H86A 2VCZA 1O6JA 1F9MA 1TJDA 4X4JA 2VL9A 1GULA 4WF4A 3EE2A 4OO5A 4AJ6A 1TRUA 2QKEA 5HQPA 1ST9A 3DVXA 4XIHA 3QFAC 4BWQA 1U88A 1EGOA 2K6VA 2DMMA 1SL0B 3KXOA 5ECLB 4ISDA 1R7HA 1G7OA 4D73A 3GN3A 2VLTA 1VF1A 1EOGA 1LU4A 1N8JA 5DQYA 3WT1A 2V1MA 4HI7A 2X8GA 1SL1B 1X0RA 4TR1A 2XBIA 2CT6A 2YCDA 1HNCA 2PUKC 3VWWA 1HNBA 2LS5A 2C0FA 3GV1A 1Z7PA 3TJFA 1WOUA 3EMPA 4ICYA 4RQXA 4I8BA 3LSZA 4GQCA 4E8HA 5KN2A 4KSOA 3UL3A 2PN8A 2E2MA 1XW5A 1THXA 3Q6OA 1SENA 5GSTA 4ACSA 3ZMLA 3TKSE 4I97A 2AAWA 2D2ZA 4YQUA 1TXXA 4HU7A 1PL2A 2BTOT 3AY8A 1TK8B 1SYRA 2HRKA 1K0BA 5DDLA 1BG5A 3F6FA 5A1NB 3ZLPA 2DKHA 2HE3A 4F2IA 4WEYA 1PX6A 1AQXA 4ML6A 1Z9HA 4ZL8A 2M72A 2PVOC 4HJ2A 3IXRA 4IW9A 3MNGA 1OE8A 4O5QA 3LEFA 4OWYA 2MMOA 2H19A 4PX1A 3VI5A 4GWRA 4IKHA 5CRWA 4LMVA 4XS1A 3U5RE 2IPAA 4TW5A 3I6AA 3ERWA 1DBYA 4TKYA 5IMAA 4AKHA 4EL1A 5F8BA 1B48A 2FA4A 2VIMA 5ECNB 4MJBA 4QMKA 4MJCA 3TKRA 3TOTA 6GSYA 2P0GA 4G19A 5EY6A 5J4UA 4L8EA 1ILOA 4N0VA 4WETA 3A2XA 2H1LA 3MAKA 3HZ4A 2PU9C 1S3CA 4BA7A 1B4PA 2YNXA 1QXHA 2IL3A 5CAXA 1NM3A 1ZMAA 5J40A 5A34A 1TI1A 4ZILA 3L0HA 5A4WA 3GIXA 3GFKA 1TDIA 4EXJA 6GSTA 2QSIA 3HYPA 4MABA 1VF2A 1ZL9A 3FZ4A 3GH6A 1V57A 16GSA 2XPEA 3ED3A 1VF4A 1Z6MA 4WR5A 5EPFA 1RW1A 3APSA 1X5EA 2XC2A 1W89A 5G30A 4J2FA 1XW9A 4GQFA 2MMZA 5JCGA 2OE3A 2R4VA 2LQOA 3EVIA 2R37A 8GSSA 1GSQA 3HVSA 1J9BA 1OAZA 2V6OA 4IBPA 1YVLA 1DUGA 5HR1A 4EIQA 3KMOA 1RK4A 2FCHA 4ZXGA 2GQMA 3HXSA 3H93A 3TCOA 1SVMA 2GTUA 3EU4A 2H76A 1SKRB 2N5FA 1EV9A 4RI7A 5IMDA 4OD7A 1BAYA 4Z7XA 5J4YA 1EGRA 5KOXA 2H0GA 4OCFA 3ME7A 2TIRA 4G2EA 3MSZA 5HFKA 1SK0A 1QFNA 4JEDA 5J47A 4MMMA 4KUNA 4V2LA 2PGTA 3HCZA 2G2QA 1Z5YE 2HT9A 2XBQA 2LTKA 5A5HA 3DIEA 1BX9A 3ZMKA 3F4RA 5JCWA 3QCPA 5B6MA 4DSSB 1NSWA 1Q4JA 4MZBA 2HRFA 4KGIA 3NZNA 4MJEA 3IAM2 1GSFA 20GSA 1GH2A 4MZWA 3QAWA 1AUCA 1GTUA 2HLSA 4IJIA 1SK2A 1TI3A 2LNSA 1DE1A 3HDCA 3A3TA 1NW2A 2FNOA 3QOUA 1X9SB 4AI6A 4USSA 3K8NA 2IMDA 4P3YB 5G31A 1YF0A 2A2PA 1FB6A 5D96A 3IK9A 4K0GA 2IMIA 1JZOA 3F0IA 1B4QA 4JU5A 2YP6A 3BD2A 2V32A 2HRAA 2WFCA 3DYRA 3M3MA 2REMA 3UOMA 4Z2UA 1G0TA 3RBTA 2H6XA 3D4MA 10GSA 3KMNA 1BF5A 5IOWA 2CQ9A 4NPBA 4I6XA 5JWRB 1FG4A 2YJ7A 4POMA 13GSA 2NDOA 3L9VA 2AJQB 4OCEA 2VLUA 3DD3A 1JZDA 3TKQA 3W8JA 1XZOA 2GSSA 4LA1A 2VLVA 4L0UA 2HYXA 3Q19A 4MH3A 4AJ8A 1OC8A 4YAPA 1PN9A 4V1Ap 2YPMA 4G0LA 2O5VA 5DCHA 4MLYA 1URMA 2NPBA 4XHMA 2JU5A 4A5PA 2GSTA 5B8AA 4X43A 5ECRB 3W6GA 1M2AA 1V40A 3MYDA 3UARA 4XS6A 1YF1A 3W8SA 2WS2A 5AIVA 2H0IA 2ON5A 1EP8A 3E9JB 1V58A 1GTBA 4JZQA 1AIUA 5COHA 2AUVA 2GZYA 5J41A 3ZIJA 4I2TA 3O6TA 3PH9A 2KP1A 2GZPA 4KDUA 4K6XA 4Q5FA 1V2AA 2C1YA 1SKSB 2LQQA 1HNAA 5CNWA 1ZYQB 2VL2A 5BMUB 3FR3A 4IS0A 3GKKA 2UZ8A 1J08A 2KP2A 5JWQB 5IM9A 4ZBBA 2J9HA 5CO3A 4KCAA 2E7PA 4RI6A 5IPHA 1O85A 5L71A 4IELA 4ZL7A 2MBTA 2B3SA 4PNFA 4ZB8A 1XPVA 2X8CA 2BJXA 1GUKA 4LLRA 5DQSA 2H1AA 4HDEA 1SD8A 3RPPA 6GSWA 1ZGNA 5JWOB 3J7Yk 3TRXA 4IN0A 1OC9B 2FWFA 2JZTA 2V2GA 1WE0A 2FWHA 1M2DA 3DXBA 3G7IA 4POBA 3RDWA 2G0FA 1EP7A 4QL7A 1GP1A 3Q74A 4X0XA 1H4OA 4F03A 4LL1B 1PQNA 2UV8G 1WIKA 4OFNA 3NOFA 2B6MA 3A2WA 2OBKA 4PTSA 5CREA 1XOBA 1PGTA 3TJBA 4K7OA 3Q18A 2O87A 4EO3A 4NV5A 2DMLA 3ZL5A 4F82A 1K0CA 3LG6A 4LL4B 2B7JA 4K2XA 2V6KA 3V1WA 2OKAA 4YQVA 4MJAA 5H5SA 3FKFA 2R0CA 3CRUA 5CYYA 1KEBA 2B5XA 3HKRA 1I9DA 1J0FA 2HSMA 2C3NA 1WPIA 4KH7A 1XBSA 4Z2TA 4HZ2A 2HSNA 3WGDA 3VURA 1OKTA 2F8AA 2O85A 2WGRA 3WGXA 4BWSA 4YAVA 1XWAA 5DALA 3HJPA 4MF7A 5G5FA 1PX7A 4TXOA 1CQHA 1TK0B 4KNDA 4NHWA 2MYGA 5ID2A 3L4NA 3IAS2 1T7PB 1G6YA 5ECKB 2DKIA 1FHEA 1X5DA 1OVNA 2OT3A 1O7UA 5AISA 4YKGA 2MZCA 4N3ZA 3QAGA 5DVBA 3DKSA 4OMVA 3LYPA 2B7KA 2HZEB 1A0RP 4O92A 1K3YA 2IFQB 5LNKe 2H72A 1TTZA 3G9BA 5F06A 2H1GA 1GNEA 2HZFA 2DC5A 1PRXA 1ERTA 1TXUA 4ZB7A 4MP4A 5KN3A 5ECOB 1B9YC 4XS4A 4QL9A 1IYHA 2L59A 4HS1A 5HR2A 2GDRA 3FYGA 4GXZA 2H66A 1V9WA 5IMZA 5IMFA 2GT6A 2H74A 4BPYA 3TKSA 1WP0A 5D8IA 2EC4A 1YKCA 4PURA 1TRVA 1Y25A 3R3EA 3U6VA 1BG1A 1GLPA 5GAPD 2ALBA 3HHVA 4HQSA 2GQLA 2HSHA 3RAZA 1SKWB 2VD0A 5HFIA 4J56E 1B9XC 4V2MA 1ERWA 3P7XA 4BVXA 4KX4A 1OE7A 1HD2A 3GKNA 4G01A 3GNJA 5BRTA 2R6KA 2FA8A 1GUHA 1EEJA 2H6ZA 1LBKA 5ECMB 5IO2A 3HMJG 5H5QA 2H70A 2LRCA 1ZYEA 11GSA 4IQAA 3C7MA 4CY8A 4XCSA 1Z7RA 2VM2A 3P8WA 4HUAA 2VCXA 1ERVA 1O8WA 4Z2RA 1TP9A 4GLTA 2KOKA 3GKXA 2LJRA 2YN1A 1ACVA 5LCZA 4G10A 2M46A 1K0MA 1UA5A 5A4UA 1K0DA 1EEMA 1JLWA 4RQRA 5LD0A 3GUSA 1XVQA 3F8UA 3LWAA 2CVBA 3KTBA 5HR0A 1K3LA 5IQYA 1U87A 3M8NA 3DGQA 2N5AA 3ISOA 4BL7B 2FWEA 2L5OA 5GZZB 4GCIA 3G7YA 3GA4A 2JACA 3IOSA 1ABAA 2CA8A 4MDCA 2HXKA 3FZ9A 3KH9A 3GHAA 4O5RA 1JHBA 1VRSD 4I2UA 4V2NA 3WD6A 3VFIA 4DSRA 4EE0A 1QQ2A 3GX8A 1DE2A 5IMCA 1AXDA 3SBCA 4AF2A 2WCIA 1HQOA 2EFCA 5J3RA 3EC3A 4N30A 4GSTA 5DBQA 5IIZA 4PQIA 3QR6A 4ECIA 3SWLA 4WR4A 4IJ3A 4BVYB 1A8LA 2GGTA 1XWKA 3CSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3A A;  3GTU B;  4MF6 A;  4IP1 A;  1BQ7 A;  2JZS A;  4CHS A;  5DCG A;  3KH7 A;  3GL5 A;  1FOV A;  6GSV A;  2AYT A;  2WDU A;  3GSS A;  3M1G A;  2V41 A;  12GS A;  2QGV A;  3HVX A;  3DML A;  2C80 A;  4EKZ A;  2IN3 A;  2H8L A;  1YY7 A;  3FZ5 A;  2IIY A;  3WYW A;  3ZFB A;  2WUL A;  5KN0 A;  2I4A A;  2X8H A;  1F37 A;  4XTS A;  3QAV A;  3HD5 A;  4K7I A;  4V1A g;  2JAD A;  1JZR A;  4D73 B;  2LST A;  4EVM A;  3KIJ A;  4ULX A;  4PXO A;  1I5G A;  1SK1 A;  2CX3 A;  4DVC A;  3VI7 A;  2AV4 A;  1K0N A;  4JR4 A;  3TJG A;  4F0B A;  2GLR A;  1F6M C;  2VL3 A;  2WZ9 A;  4Q5Q A;  17GS A;  3LYK A;  4HEA 2;  4KDX A;  3ZVJ A;  1TOF A;  2LNT A;  4NWY A;  3GST A;  1WRY A;  2CX4 A;  2I81 A;  3GL3 A;  2YZU A;  4F9Z A;  2IJY A;  4TR4 A;  3F3R A;  2C0D A;  4OFT A;  2I1U A;  1JFU A;  2HZE A;  2VM1 A;  2NVL A;  1TK5 B;  3BBY A;  2IFQ A;  3PPU A;  3EWL A;  4NXI A;  1TKD B;  4NAX A;  3IA1 A;  4JRR A;  3FR9 A;  4MF5 A;  4HZ4 A;  5D9X A;  3WGE A;  3P90 A;  1DSB A;  2X64 A;  3N9J A;  3PIN A;  3DRN A;  4G0I A;  1UN2 A;  4O7H A;  4I5Q A;  2CAI A;  4FIW A;  4ML1 A;  1M9B A;  3RPN A;  3VWV A;  2ZNM A;  2IMF A;  1PMT A;  19GS A;  4G9H A;  4ECB A;  4HJM A;  2F3M A;  4MPF A;  3BCK A;  5F07 A;  5A5K A;  4FYU A;  2GSR A;  5DAK B;  1K0O A;  1PSQ A;  3FY7 A;  5G5E A;  5D9V A;  2MMA A;  1AAZ A;  2HSY A;  2K8S A;  3UVT A;  1OKD A;  1XWG A;  5D9T A;  4MK3 A;  1FAA A;  1R5A A;  1TU8 A;  3LOR A;  1YQ1 A;  5ECP B;  4HQZ A;  2FD3 A;  1ON4 A;  1K0A A;  3C8E A;  1O8X A;  4WKW A;  1E6B A;  1SJZ A;  2CV4 A;  4JR6 A;  1MDJ A;  3ZFL A;  1M9A A;  2ZCT A;  2H6Y A;  5HFG A;  3APQ A;  4EF0 A;  4K8M A;  1X9W B;  3BOA A;  1N2A A;  3ZIT A;  2HRN A;  5AIX A;  2DJK A;  2PWJ A;  5ABR A;  2CAQ A;  5A4V A;  3HZ8 A;  3LFL A;  3CMI A;  1GUM A;  4EC0 A;  3LGC A;  3LQ7 A;  2P5R A;  1XWC A;  3ZZX A;  2P31 A;  1RQM A;  4KW6 A;  2YAN A;  2Z9S A;  3GYK A;  1XVW A;  2A2S A;  1UVZ A;  4MPG A;  3H79 A;  2GZZ A;  1F2E A;  3F4T A;  2NTO A;  3O76 A;  2B1K A;  3JCM L;  3C73 A;  1GSU A;  4K0N A;  2L5L A;  5ECI B;  4NV2 A;  3EIN A;  4PUF C;  2VCV A;  2YOI A;  3QMX A;  3FZA A;  1U3I A;  1MEK A;  3MWH A;  1T00 A;  2RLI A;  6GSU A;  2DBC A;  5CP1 A;  4HOJ A;  2DJ0 A;  4LMW A;  3ZTL A;  3TDG A;  3FEU A;  4TRX A;  3TRQ A;  3VPT A;  2DJ2 A;  3VLN A;  2C4J A;  3HJM A;  3ERF A;  2WRT A;  1AQV A;  4POK A;  1T8E B;  1USB A;  1X9M B;  3IBH A;  3VK9 A;  1R5P A;  1O81 A;  4RUV A;  2KHP A;  2H30 A;  3EU3 A;  1NHO A;  2NBS A;  5D93 A;  4BVY A;  3HJO A;  4DEJ A;  1YDK A;  2EIQ A;  5AN1 A;  2PBJ A;  2WJU A;  6GSS A;  4OO4 A;  1THO A;  22GS A;  4TR0 A;  1A2L A;  3DEX A;  4DSS A;  1EZK A;  3TJK A;  2H73 A;  3I9V 2;  3GH9 A;  5H5R A;  3MDK A;  4IVF A;  2H1D A;  3UBK A;  4FO5 A;  5IO0 A;  2QC7 A;  3TRP A;  2H0H A;  2LRT A;  3UJ1 A;  1T4Y A;  4KAE A;  4NMU A;  3C71 A;  5IPG A;  1A23 A;  3H4K A;  3US3 A;  3FW2 A;  2DJJ A;  2DSA A;  3D4T A;  5ELA A;  5DJL A;  2OE0 A;  5B6N A;  2B1L A;  5G1K A;  3J7Y b;  3IC4 A;  3F63 A;  4GRF A;  2LEG A;  5CRD A;  5F05 A;  1GL8 A;  3VWX A;  1PKZ A;  2GSQ A;  2VD1 A;  1XW6 A;  2JZR A;  3C1R A;  3UIW A;  2K9F A;  2M80 A;  2EIR A;  2PER A;  3GKM A;  4OFM A;  2P5Q A;  5CRG A;  3LXT A;  2YZH A;  3CTG A;  3D21 A;  4Q5N A;  2OA7 A;  5EL8 A;  2L6D A;  2C3T A;  3BJ5 A;  14GS A;  5AGY A;  4IHU A;  3TB2 A;  1CQG A;  4ZB6 A;  3CYN A;  3ERG A;  2JSZ A;  4MCU A;  1R4W A;  1E2Y A;  2GS3 A;  5EVO A;  2LJA A;  1B8X A;  3IC8 A;  2F51 A;  2YWO A;  3IHQ A;  4KDY A;  5ECS A;  1G7E A;  1EOH A;  2DJ3 A;  2R2J A;  4ZBD A;  1GNW A;  4TN8 A;  18GS A;  1O73 A;  3H1N A;  1BED A;  2OBI A;  4TVE A;  1X5C A;  5DAK A;  2FWG A;  9GSS A;  3I43 A;  2O8V B;  1AQW A;  3IV4 A;  2F8F A;  3M0F A;  4ZB9 A;  5INY A;  1ERU A;  1KTE A;  4PQ1 A;  3VPQ A;  5GAN D;  3WT2 A;  1FB0 A;  3ZRD A;  3IPZ A;  3QD9 A;  1HYU A;  3TUE A;  4PQH A;  3KTL A;  4TXV A;  2PMT A;  2KUC A;  5GSS A;  2LV3 A;  1T1V A;  3EMX A;  3IR4 A;  1XXU A;  2I9H A;  3CBU A;  3UEM A;  1FO5 A;  1MDK A;  2C0G A;  2XHF A;  2VUP A;  3EYT A;  5HR3 A;  4CDO A;  1S3A A;  3UAP A;  1FW1 A;  3R2Q A;  5D9W A;  1SU9 A;  2YWM A;  1M0U A;  5BMU A;  4PGT A;  2YJH A;  1C72 A;  5FHI A;  2OJL A;  1GSD A;  2JL4 A;  3UBL A;  1ZOF A;  5FT3 A;  3ME8 A;  4Q5R A;  1TRW A;  2VCW A;  1AC1 A;  3A2V A;  1MTC A;  3QFB C;  2IME A;  5C04 A;  1MD3 A;  3HVV A;  4PUA A;  2DIY A;  3VWU A;  2J23 A;  2A2R A;  2HFD A;  2F9S A;  2DLX A;  3KP9 A;  5FWG A;  3ZIV A;  1YEX A;  1OC9 A;  2KLX A;  3GMF A;  2VOC A;  3H8Q A;  3PR8 A;  5J5N A;  2TRX A;  4X1U A;  7GSS A;  2YV9 A;  2PPT A;  5D73 A;  3N5O A;  4ECC A;  2X99 A;  1M99 A;  3KGK A;  2L57 A;  4IQ1 A;  2RM5 A;  2VCT A;  4GSN A;  2VO4 A;  4L0W A;  3A5W A;  1V98 A;  2B5Y A;  4QQ7 A;  1QUW A;  4NHZ A;  3APO A;  3KM6 A;  1GSS A;  3HA9 A;  4JE1 A;  2TRC P;  3NIV A;  3GUR A;  2VL2 C;  2ON7 A;  3RHB A;  1UC7 A;  3QPM A;  2FGX A;  4EUY A;  3LJR A;  1W4V A;  2MBS A;  2LRN A;  4CW9 A;  2LUS A;  5IOX A;  1KNG A;  4JBB A;  4POL A;  5ENU A;  2IWT A;  2K18 A;  1WMJ A;  4WBJ A;  2H01 A;  1T3B A;  4N11 A;  3CXG A;  3ZRE A;  1AW9 A;  2HSM B;  1PKW A;  2OE1 A;  1XOA A;  4FYC A;  4N10 A;  3IDV A;  3FR6 A;  2HSN B;  2K8V A;  2H71 A;  2N5B A;  4K9Z A;  4WF5 A;  2C8U A;  3IRA A;  1OC3 A;  5C00 A;  1Y6E A;  2FHE A;  3GX0 A;  5DAL B;  3CTF A;  5ECH B;  5KEJ A;  1GWC A;  2H1B A;  4TXO B;  2EIO A;  3KCM A;  1WJK A;  4TR1 B;  1YJ6 A;  5ID2 B;  3HY2 A;  4FH8 A;  1FVJ A;  5ECQ B;  3P2A A;  1PA3 A;  4KCE A;  4K2D A;  1GTA A;  5E59 A;  2YWI A;  1GRX A;  2VAF A;  3FHK A;  3ZYW A;  2CZ2 A;  4J57 E;  4HU9 A;  3BCI A;  3KZQ A;  4G0K A;  3FK8 A;  2L6C A;  1IYI A;  4N0Z A;  2LKU A;  1A2J A;  2HRK B;  1A2M A;  3TKP A;  1SL2 B;  1T4Z A;  3L9U A;  1G6W A;  2HNL A;  1SYX A;  1GSY A;  1QGV A;  3KD0 A;  4XS4 B;  4GF0 A;  5KN1 A;  1NHY A;  4XRD A;  4PNG A;  1ZCP A;  2RUF A;  1EV4 A;  1TRS A;  1LJR A;  1PD2 1;  2ES7 A;  2GVP A;  1QK8 A;  4MA9 A;  1GLQ A;  1BYE A;  2HQT A;  1M2B A;  2O89 A;  2AHE A;  2L4Q A;  1WWJ A;  4KF9 A;  1SJ6 A;  2MMN A;  1A8Y A;  1JLV A;  2R3X A;  4L5O A;  2R5G A;  4EDY A;  2FY6 A;  4ZBA A;  4AJ7 A;  3OR5 A;  1YEP A;  3ZVJ D;  2XPD A;  3CSI A;  3IE3 A;  5ELG A;  5CRH A;  3F9U A;  1R26 A;  4KE3 A;  3UMA A;  4YQM A;  1MDI A;  1KBN A;  3EUR A;  4FQU A;  1A24 A;  2I3Y A;  2WB9 A;  4GTU A;  4BVX B;  2DIZ A;  3KEB A;  2E0Q A;  5B8B A;  2E2G A;  2PVQ A;  1XFL A;  5J9C A;  1MD4 A;  1U3A A;  3F4S A;  2HI7 A;  2L4C A;  4XRA A;  3RHC A;  1A0F A;  1S3D A;  1YZX A;  3DVW A;  2GT5 A;  3QDN A;  3O3T A;  1SD9 A;  1SJI A;  5G2Z A;  4K7N A;  4ECJ A;  3CSH A;  3G7J A;  3S9F A;  1PL1 A;  4AGS A;  3C1S A;  4TOP A;  2DJ1 A;  1TW9 A;  6GSX A;  3F6D A;  3TGZ A;  2CZ3 A;  4L5L A;  1TU7 A;  2FLS A;  2C3Q A;  1ZZY A;  2C0E A;  2FUG 2;  1GTI A;  5E4W A;  1BJX A;  3D22 A;  2YV7 A;  2LJK A;  1H75 A;  3KP8 A;  4ZIJ A;  4KB3 A;  1XIY A;  2OAC A;  1Z6N A;  3E0U A;  2CVK A;  3UVH A;  3FRC A;  4WBR D;  1K3O A;  4YH2 A;  2YWN A;  3D5J A;  5G1L A;  2A4V A;  2JSY A;  3M9K A;  5DJM A;  3M9J A;  3TKS C;  3LXZ A;  1M7T A;  1Q98 A;  3PGT A;  2RII A;  4IP6 A;  2GQK A;  4IGJ A;  4WXT A;  4BL7 A;  3L9S A;  4K1F A;  1QMV A;  4ZL9 A;  3I69 A;  1JZW A;  1GSE A;  2O7K A;  2CVD A;  2VCQ A;  4E8E A;  1FVK A;  2H75 A;  3D0Z A;  3TOU A;  2B5E A;  1ML6 A;  4GSS A;  3IK7 A;  3F3Q A;  4O32 A;  1F3B A;  2IMK A;  4ID0 A;  1EWX A;  2BMX A;  1XWB A;  3D6I A;  5B7C A;  3KJY A;  2ZUP A;  2RM6 A;  2RUE A;  1OYJ A;  4KA0 A;  5IMV A;  1VGL A;  3DWV A;  2OAD A;  3GRX A;  3CRT A;  4MH2 A;  1XCC A;  5J9B A;  1VF3 A;  3GTU A;  3TJJ A;  1Z3E A;  3E3E A;  2AB6 A;  4KSM A;  4DSQ A;  1U6T A;  3L78 A;  1YKA A;  4F0C A;  5F0G A;  4TR3 A;  4ILF A;  5JCU A;  4EDZ A;  4MZC A;  4FYB A;  4H86 A;  2VCZ A;  1O6J A;  1F9M A;  1TJD A;  2VL9 A;  1GUL A;  4WF4 A;  3EE2 A;  4OO5 A;  4AJ6 A;  1TRU A;  2QKE A;  5HQP A;  1ST9 A;  3DVX A;  4XIH A;  3QFA C;  4BWQ A;  1U88 A;  1EGO A;  2K6V A;  2DMM A;  1SL0 B;  3KXO A;  5ECL B;  4ISD A;  1R7H A;  1G7O A;  4D73 A;  3GN3 A;  2VLT A;  1VF1 A;  1EOG A;  1LU4 A;  1N8J A;  5DQY A;  3WT1 A;  2V1M A;  4HI7 A;  2X8G A;  1SL1 B;  1X0R A;  4TR1 A;  2XBI A;  2CT6 A;  2YCD A;  1HNC A;  2PUK C;  3VWW A;  1HNB A;  2LS5 A;  2C0F A;  3GV1 A;  1Z7P A;  3TJF A;  1WOU A;  3EMP A;  4RQX A;  4I8B A;  3LSZ A;  4GQC A;  4E8H A;  5KN2 A;  4KSO A;  3UL3 A;  2PN8 A;  2E2M A;  1XW5 A;  1THX A;  3Q6O A;  1SEN A;  5GST A;  4ACS A;  3ZML A;  3TKS E;  4I97 A;  2AAW A;  2D2Z A;  4YQU A;  1TXX A;  4HU7 A;  1PL2 A;  2BTO T;  3AY8 A;  1TK8 B;  1SYR A;  2HRK A;  1K0B A;  5DDL A;  1BG5 A;  3F6F A;  3ZLP A;  2HE3 A;  4F2I A;  4WEY A;  1PX6 A;  1AQX A;  4ML6 A;  1Z9H A;  4ZL8 A;  2M72 A;  2PVO C;  4HJ2 A;  3IXR A;  4IW9 A;  3MNG A;  1OE8 A;  3LEF A;  4OWY A;  2MMO A;  2H19 A;  4PX1 A;  3VI5 A;  4GWR A;  4IKH A;  5CRW A;  4LMV A;  4XS1 A;  3U5R E;  2IPA A;  4TW5 A;  3I6A A;  3ERW A;  1DBY A;  4TKY A;  5IMA A;  4EL1 A;  5F8B A;  1B48 A;  2FA4 A;  2VIM A;  5ECN B;  4MJB A;  4MJC A;  3TKR A;  3TOT A;  6GSY A;  2P0G A;  4G19 A;  5EY6 A;  5J4U A;  4L8E A;  1ILO A;  4N0V A;  4WET A;  3A2X A;  3MAK A;  3HZ4 A;  2PU9 C;  1S3C A;  4BA7 A;  1B4P A;  2YNX A;  1QXH A;  2IL3 A;  5CAX A;  1NM3 A;  1ZMA A;  1TI1 A;  4ZIL A;  3L0H A;  5A4W A;  3GIX A;  3GFK A;  1TDI A;  4EXJ A;  6GST A;  2QSI A;  3HYP A;  4MAB A;  1VF2 A;  1ZL9 A;  3FZ4 A;  3GH6 A;  1V57 A;  16GS A;  2XPE A;  3ED3 A;  1VF4 A;  1Z6M A;  4WR5 A;  5EPF A;  1RW1 A;  3APS A;  1X5E A;  2XC2 A;  1W89 A;  5G30 A;  4J2F A;  1XW9 A;  4GQF A;  2MMZ A;  5JCG A;  2OE3 A;  2R4V A;  2LQO A;  3EVI A;  2R37 A;  8GSS A;  1GSQ A;  3HVS A;  1J9B A;  1OAZ A;  2V6O A;  4IBP A;  1DUG A;  5HR1 A;  3KMO A;  1RK4 A;  2FCH A;  4ZXG A;  2GQM A;  3HXS A;  3H93 A;  3TCO A;  2GTU A;  3EU4 A;  2H76 A;  1SKR B;  2N5F A;  1EV9 A;  4RI7 A;  5IMD A;  4OD7 A;  1BAY A;  4Z7X A;  1EGR A;  2H0G A;  4OCF A;  3ME7 A;  2TIR A;  4G2E A;  3MSZ A;  5HFK A;  1SK0 A;  1QFN A;  4JED A;  4MMM A;  4KUN A;  4V2L A;  2PGT A;  3HCZ A;  2G2Q A;  1Z5Y E;  2HT9 A;  2XBQ A;  2LTK A;  3DIE A;  1BX9 A;  3ZMK A;  3F4R A;  5JCW A;  3QCP A;  5B6M A;  4DSS B;  1NSW A;  1Q4J A;  4MZB A;  2HRF A;  4KGI A;  3NZN A;  4MJE A;  3IAM 2;  1GSF A;  20GS A;  1GH2 A;  4MZW A;  3QAW A;  1AUC A;  1GTU A;  2HLS A;  4IJI A;  1SK2 A;  1TI3 A;  2LNS A;  1DE1 A;  3HDC A;  3A3T A;  1NW2 A;  2FNO A;  3QOU A;  1X9S B;  4USS A;  3K8N A;  2IMD A;  4P3Y B;  5G31 A;  1YF0 A;  1FB6 A;  5D96 A;  3IK9 A;  4K0G A;  2IMI A;  1JZO A;  3F0I A;  1B4Q A;  4JU5 A;  2YP6 A;  3BD2 A;  2V32 A;  2HRA A;  2WFC A;  3DYR A;  3M3M A;  2REM A;  3UOM A;  1G0T A;  3RBT A;  2H6X A;  3D4M A;  10GS A;  3KMN A;  5IOW A;  2CQ9 A;  4NPB A;  4I6X A;  5JWR B;  1FG4 A;  2YJ7 A;  4POM A;  13GS A;  2NDO A;  3L9V A;  2AJQ B;  4OCE A;  2VLU A;  3DD3 A;  1JZD A;  3TKQ A;  3W8J A;  1XZO A;  2GSS A;  4LA1 A;  2VLV A;  4L0U A;  2HYX A;  3Q19 A;  4MH3 A;  4AJ8 A;  1OC8 A;  4YAP A;  1PN9 A;  4V1A p;  2YPM A;  4G0L A;  5DCH A;  4MLY A;  1URM A;  2NPB A;  4XHM A;  2JU5 A;  2GST A;  5B8A A;  4X43 A;  5ECR B;  3W6G A;  1M2A A;  1V40 A;  3UAR A;  4XS6 A;  1YF1 A;  3W8S A;  2WS2 A;  5AIV A;  2H0I A;  2ON5 A;  1EP8 A;  3E9J B;  1V58 A;  1GTB A;  4JZQ A;  1AIU A;  5COH A;  2AUV A;  2GZY A;  5J41 A;  3ZIJ A;  4I2T A;  3O6T A;  3PH9 A;  2KP1 A;  2GZP A;  4KDU A;  4K6X A;  4Q5F A;  1V2A A;  2C1Y A;  1SKS B;  2LQQ A;  1HNA A;  5CNW A;  1ZYQ B;  2VL2 A;  3FR3 A;  4IS0 A;  3GKK A;  2UZ8 A;  1J08 A;  2KP2 A;  5JWQ B;  5IM9 A;  4ZBB A;  2J9H A;  5CO3 A;  4KCA A;  2E7P A;  4RI6 A;  5IPH A;  1O85 A;  5L71 A;  4IEL A;  4ZL7 A;  2MBT A;  2B3S A;  4PNF A;  4ZB8 A;  1XPV A;  2X8C A;  2BJX A;  1GUK A;  4LLR A;  5DQS A;  2H1A A;  4HDE A;  1SD8 A;  3RPP A;  6GSW A;  1ZGN A;  5JWO B;  3J7Y k;  3TRX A;  4IN0 A;  1OC9 B;  2FWF A;  2JZT A;  2V2G A;  1WE0 A;  2FWH A;  1M2D A;  3DXB A;  3G7I A;  4POB A;  3RDW A;  2G0F A;  1EP7 A;  4QL7 A;  1GP1 A;  3Q74 A;  4X0X A;  1H4O A;  4F03 A;  4LL1 B;  1PQN A;  1WIK A;  4OFN A;  3NOF A;  2B6M A;  3A2W A;  2OBK A;  4PTS A;  5CRE A;  1XOB A;  1PGT A;  3TJB A;  4K7O A;  3Q18 A;  2O87 A;  4EO3 A;  4NV5 A;  2DML A;  3ZL5 A;  4F82 A;  1K0C A;  3LG6 A;  4LL4 B;  2B7J A;  2V6K A;  3V1W A;  2OKA A;  4YQV A;  4MJA A;  5H5S A;  3FKF A;  3CRU A;  5CYY A;  1KEB A;  2B5X A;  3HKR A;  1I9D A;  1J0F A;  2HSM A;  2C3N A;  1WPI A;  4KH7 A;  1XBS A;  4HZ2 A;  3WGD A;  3VUR A;  1OKT A;  2F8A A;  2O85 A;  2WGR A;  3WGX A;  4BWS A;  4YAV A;  1XWA A;  5DAL A;  3HJP A;  4MF7 A;  5G5F A;  1PX7 A;  4TXO A;  1CQH A;  1TK0 B;  4KND A;  4NHW A;  2MYG A;  5ID2 A;  3L4N A;  3IAS 2;  1T7P B;  1G6Y A;  5ECK B;  1FHE A;  1X5D A;  1OVN A;  1O7U A;  5AIS A;  2MZC A;  3QAG A;  5DVB A;  3DKS A;  4OMV A;  3LYP A;  2B7K A;  2HZE B;  1A0R P;  4O92 A;  1K3Y A;  2IFQ B;  5LNK e;  2H72 A;  1TTZ A;  3G9B A;  5F06 A;  2H1G A;  1GNE A;  2HZF A;  2DC5 A;  1PRX A;  1ERT A;  4MP4 A;  5KN3 A;  5ECO B;  1B9Y C;  4XS4 A;  4QL9 A;  1IYH A;  2L59 A;  4HS1 A;  5HR2 A;  2GDR A;  3FYG A;  4GXZ A;  2H66 A;  1V9W A;  5IMZ A;  5IMF A;  2GT6 A;  2H74 A;  4BPY A;  3TKS A;  1WP0 A;  5D8I A;  2EC4 A;  1YKC A;  4PUR A;  1TRV A;  1Y25 A;  3R3E A;  3U6V A;  1GLP A;  5GAP D;  2ALB A;  3HHV A;  4HQS A;  2GQL A;  2HSH A;  3RAZ A;  1SKW B;  2VD0 A;  5HFI A;  4J56 E;  1B9X C;  4V2M A;  1ERW A;  3P7X A;  4BVX A;  4KX4 A;  1OE7 A;  1HD2 A;  3GKN A;  3GNJ A;  2R6K A;  2FA8 A;  1GUH A;  1EEJ A;  2H6Z A;  1LBK A;  5ECM B;  5IO2 A;  5H5Q A;  2H70 A;  2LRC A;  1ZYE A;  11GS A;  4IQA A;  3C7M A;  4XCS A;  1Z7R A;  2VM2 A;  3P8W A;  4HUA A;  2VCX A;  1ERV A;  1O8W A;  1TP9 A;  4GLT A;  2KOK A;  3GKX A;  2LJR A;  2YN1 A;  1ACV A;  5LCZ A;  4G10 A;  2M46 A;  1K0M A;  1UA5 A;  5A4U A;  1K0D A;  1EEM A;  1JLW A;  4RQR A;  5LD0 A;  3GUS A;  1XVQ A;  3F8U A;  3LWA A;  2CVB A;  3KTB A;  5HR0 A;  1K3L A;  5IQY A;  1U87 A;  3M8N A;  3DGQ A;  2N5A A;  3ISO A;  4BL7 B;  2FWE A;  2L5O A;  5GZZ B;  4GCI A;  3G7Y A;  3GA4 A;  2JAC A;  3IOS A;  1ABA A;  2CA8 A;  4MDC A;  2HXK A;  3FZ9 A;  3KH9 A;  3GHA A;  4O5R A;  1JHB A;  1VRS D;  4I2U A;  4V2N A;  3WD6 A;  3VFI A;  4DSR A;  4EE0 A;  1QQ2 A;  3GX8 A;  1DE2 A;  5IMC A;  1AXD A;  3SBC A;  4AF2 A;  2WCI A;  1HQO A;  5J3R A;  3EC3 A;  4N30 A;  4GST A;  5DBQ A;  5IIZ A;  4PQI A;  3QR6 A;  4ECI A;  3SWL A;  4WR4 A;  4IJ3 A;  4BVY B;  1A8L A;  2GGT A;  1XWK A;  3CSJ A; 
#chains in the Genus database with same CATH topology
 1F3A A;  4FXY P;  3GTU B;  4MF6 A;  4IP1 A;  1BQ7 A;  2JZS A;  4CHS A;  5DCG A;  3KH7 A;  3GL5 A;  1FOV A;  6GSV A;  3RFR C;  2AYT A;  2WDU A;  3GSS A;  3M1G A;  3LW9 A;  2V41 A;  12GS A;  2QGV A;  3HVX A;  3DML A;  2C80 A;  4EKZ A;  2IN3 A;  2H8L A;  1YY7 A;  2WW0 A;  3FZ5 A;  2IIY A;  3WYW A;  3ZFB A;  2WUL A;  5KN0 A;  2I4A A;  1M3I A;  2X8H A;  1F37 A;  4XTS A;  3QAV A;  3HD5 A;  4K7I A;  4V1A g;  2JAD A;  1JZR A;  4D73 B;  2LST A;  4EVM A;  3KIJ A;  4ULX A;  4PXO A;  1I5G A;  1SK1 A;  2CX3 A;  4DVC A;  3VI7 A;  2AV4 A;  1K0N A;  4JR4 A;  1Y1U A;  3TJG A;  4F0B A;  2GLR A;  1F6M C;  2VL3 A;  2WZ9 A;  4Q5Q A;  2X4A A;  17GS A;  3LYK A;  4HEA 2;  4KDX A;  3ZVJ A;  1TOF A;  2LNT A;  4NWY A;  3GST A;  1WRY A;  2CX4 A;  2I81 A;  3GL3 A;  2YZU A;  4F9Z A;  2IJY A;  4TR4 A;  3F3R A;  2C0D A;  4OFT A;  2I1U A;  1JFU A;  2HZE A;  2VM1 A;  2NVL A;  1TK5 B;  3BBY A;  2IFQ A;  3PPU A;  3EWL A;  4NXI A;  1TKD B;  4NAX A;  5A1N A;  3IA1 A;  4JRR A;  3FR9 A;  4MF5 A;  4HZ4 A;  5D9X A;  3WGE A;  3P90 A;  1DSB A;  2X64 A;  3N9J A;  3PIN A;  3DRN A;  4G0I A;  1UN2 A;  4O7H A;  4I5Q A;  2CAI A;  4FIW A;  4ML1 A;  1M9B A;  3RPN A;  3VWV A;  2ZNM A;  2IMF A;  1PMT A;  19GS A;  4G9H A;  4ECB A;  4HJM A;  2F3M A;  4MPF A;  4GDF A;  3BCK A;  5F07 A;  5A5K A;  4FYU A;  2GSR A;  5DAK B;  1K0O A;  1PSQ A;  3FY7 A;  5G5E A;  3MIX A;  5D9V A;  2MMA A;  1AAZ A;  2HSY A;  2K8S A;  3UVT A;  1OKD A;  1XWG A;  5D9T A;  4MK3 A;  1FAA A;  1R5A A;  1TU8 A;  3LOR A;  1YQ1 A;  5ECP B;  4HQZ A;  2FD3 A;  1PN0 A;  1ON4 A;  1K0A A;  3C8E A;  1O8X A;  4WKW A;  1E6B A;  1SJZ A;  2CV4 A;  4JR6 A;  5A34 B;  1MDJ A;  3ZFL A;  1M9A A;  2ZCT A;  2H6Y A;  5HFG A;  3APQ A;  4EF0 A;  4K8M A;  1X9W B;  3BOA A;  1N2A A;  3ZIT A;  1FOH A;  2HRN A;  5AIX A;  2DJK A;  2PWJ A;  5ABR A;  2CAQ A;  5A4V A;  3HZ8 A;  3LFL A;  1S3R A;  3CMI A;  3CWG A;  1GUM A;  4EC0 A;  3LGC A;  3LQ7 A;  2P5R A;  1XWC A;  3ZZX A;  2P31 A;  1RQM A;  4KW6 A;  2YAN A;  2Z9S A;  3GYK A;  1XVW A;  2A2S A;  1UVZ A;  4MPG A;  3H79 A;  2GZZ A;  1F2E A;  3F4T A;  2NTO A;  3O76 A;  2B1K A;  4MNN A;  3JCM L;  3C73 A;  1GSU A;  4K0N A;  3RGB C;  2L5L A;  5ECI B;  4NV2 A;  3EIN A;  4PUF C;  2VCV A;  2YOI A;  3QMX A;  3FZA A;  1U3I A;  1MEK A;  3MWH A;  1T00 A;  2RLI A;  6GSU A;  2DBC A;  5KOW A;  5CP1 A;  4HOJ A;  2DJ0 A;  4LMW A;  3ZTL A;  3TDG A;  3FEU A;  4TRX A;  3TRQ A;  3VPT A;  2DJ2 A;  3VLN A;  2C4J A;  3HJM A;  2WRT A;  3ERF A;  1AQV A;  4POK A;  1T8E B;  1USB A;  1X9M B;  3IBH A;  3VK9 A;  4K5R A;  1R5P A;  1O81 A;  4RUV A;  2KHP A;  2H30 A;  3EU3 A;  1NHO A;  3TU3 B;  2NBS A;  5D93 A;  4BVY A;  3HJO A;  4DEJ A;  1YDK A;  2WVX A;  5A5H B;  2EIQ A;  5AN1 A;  2PBJ A;  2WJU A;  6GSS A;  4OO4 A;  1THO A;  22GS A;  4TR0 A;  2VKZ G;  1A2L A;  3DEX A;  4DSS A;  1EZK A;  3TJK A;  2H73 A;  3I9V 2;  3GH9 A;  5H5R A;  3MDK A;  4IVF A;  2H1D A;  3UBK A;  4FO5 A;  3EPT A;  5IO0 A;  2QC7 A;  3TRP A;  2H0H A;  2LRT A;  3UJ1 A;  1T4Y A;  4KAE A;  4NMU A;  3C71 A;  5IPG A;  1A23 A;  3H4K A;  3US3 A;  3FW2 A;  2DJJ A;  2DSA A;  3D4T A;  5ELA A;  5DJL A;  2WZS A;  2OE0 A;  5B6N A;  2B1L A;  5G1K A;  3J7Y b;  3IC4 A;  3F63 A;  4GRF A;  2LEG A;  1ZYP A;  5CRD A;  5F05 A;  2WW2 A;  1GL8 A;  3VWX A;  1PKZ A;  2GSQ A;  2VD1 A;  1XW6 A;  2JZR A;  3C1R A;  3UIW A;  2K9F A;  2M80 A;  2EIR A;  2PER A;  3GKM A;  4OFM A;  4AKG A;  2P5Q A;  5CRG A;  3LXT A;  2YZH A;  3CTG A;  3D21 A;  4Q5N A;  2OA7 A;  5EL8 A;  2L6D A;  2C3T A;  3BJ5 A;  14GS A;  3FMW A;  5AGY A;  4IHU A;  3TB2 A;  1CQG A;  4ZB6 A;  3CYN A;  3ERG A;  4BIK A;  2JSZ A;  4MCU A;  1R4W A;  1E2Y A;  2GS3 A;  5EVO A;  2LJA A;  1B8X A;  3IC8 A;  2F51 A;  1PFO A;  2YWO A;  3IHQ A;  4KDY A;  5ECS A;  1G7E A;  1EOH A;  3CQF A;  2DJ3 A;  3IHG A;  2R2J A;  4ZBD A;  1GNW A;  4TN8 A;  18GS A;  1O73 A;  3H1N A;  1BED A;  2OBI A;  5J4V A;  4TVE A;  1X5C A;  5DAK A;  2FWG A;  9GSS A;  3I43 A;  2O8V B;  1AQW A;  3IV4 A;  2F8F A;  3M0F A;  4ZB9 A;  5INY A;  1ERU A;  1KTE A;  4PQ1 A;  3VPQ A;  5GAN D;  3WT2 A;  1FB0 A;  3ZRD A;  3IPZ A;  3QD9 A;  1HYU A;  4CY6 A;  3TUE A;  4PQH A;  3KTL A;  4YKF A;  4TXV A;  2PMT A;  2KUC A;  5GSS A;  2LV3 A;  1T1V A;  3EMX A;  3IR4 A;  1XXU A;  2I9H A;  3CBU A;  3UEM A;  1FO5 A;  1MDK A;  2C0G A;  2XHF A;  2VUP A;  3EYT A;  5HR3 A;  4CDO A;  1S3A A;  3UAP A;  1FW1 A;  2WW1 A;  3R2Q A;  5D9W A;  1SU9 A;  2YWM A;  1M0U A;  5BMU A;  4PGT A;  2YJH A;  1C72 A;  5FHI A;  2OJL A;  1GSD A;  2JL4 A;  3UBL A;  1ZOF A;  5FT3 A;  3ME8 A;  4Q5R A;  1TRW A;  2VCW A;  1AC1 A;  3A2V A;  1MTC A;  3QFB C;  2IME A;  5C04 A;  1MD3 A;  3HVV A;  4PUA A;  2DIY A;  3VWU A;  2J23 A;  2A2R A;  2HFD A;  2F9S A;  2DLX A;  3KP9 A;  5FWG A;  3ZIV A;  2QA2 A;  1YEX A;  1OC9 A;  2KLX A;  3GMF A;  2VOC A;  3H8Q A;  3PR8 A;  5J5N A;  2TRX A;  4X1U A;  7GSS A;  2YV9 A;  2PPT A;  1ZYN A;  5D73 A;  3N5O A;  4ECC A;  2X99 A;  1M99 A;  3KGK A;  2L57 A;  4IQ1 A;  2RM5 A;  2VCT A;  4GSN A;  2VO4 A;  4L0W A;  3A5W A;  1V98 A;  2B5Y A;  4QQ7 A;  1QUW A;  4NHZ A;  3APO A;  4EIP A;  3KM6 A;  1GSS A;  3HA9 A;  4JE1 A;  2TRC P;  3NIV A;  3GUR A;  2VL2 C;  2ON7 A;  3RHB A;  1UC7 A;  3A5I A;  3QPM A;  2FGX A;  4EUY A;  3LJR A;  1W4V A;  2MBS A;  2LRN A;  4CW9 A;  2LUS A;  5IOX A;  1KNG A;  4JBB A;  4POL A;  5ENU A;  2IWT A;  1N25 A;  2K18 A;  1WMJ A;  4WBJ A;  2H01 A;  2R0P A;  1T3B A;  4N11 A;  3CXG A;  3ZRE A;  1AW9 A;  2HSM B;  1PKW A;  2OE1 A;  4HSC X;  2EFH A;  1XOA A;  4FYC A;  4N10 A;  3IDV A;  3FR6 A;  2HSN B;  2K8V A;  2H71 A;  2N5B A;  4K9Z A;  4WF5 A;  2C8U A;  3IRA A;  4O5U A;  1OC3 A;  5C00 A;  1Y6E A;  2FHE A;  3GX0 A;  5DAL B;  3CTF A;  5ECH B;  5KEJ A;  1GWC A;  2H1B A;  4TXO B;  2EIO A;  3KCM A;  1WJK A;  4TR1 B;  1YJ6 A;  5ID2 B;  3HY2 A;  4FH8 A;  1FVJ A;  4W66 A;  5ECQ B;  3P2A A;  1PA3 A;  4KCE A;  4K2D A;  1GTA A;  5E59 A;  2YWI A;  1GRX A;  2VAF A;  3FHK A;  3ZYW A;  2QA1 A;  2CZ2 A;  4J57 E;  4HU9 A;  3BCI A;  3KZQ A;  4G0K A;  3FK8 A;  2L6C A;  1IYI A;  4N0Z A;  2LKU A;  1A2J A;  2HRK B;  1A2M A;  3TKP A;  1SL2 B;  1T4Z A;  3L9U A;  1G6W A;  2HNL A;  1SYX A;  1GSY A;  1QGV A;  3KD0 A;  4XS4 B;  4GF0 A;  5KN1 A;  1NHY A;  4XRD A;  4PNG A;  1ZCP A;  2RUF A;  1EV4 A;  1TRS A;  1LJR A;  1PD2 1;  2ES7 A;  2GVP A;  1QK8 A;  4MA9 A;  1GLQ A;  1BYE A;  2HQT A;  1SVL A;  1M2B A;  2O89 A;  2AHE A;  2L4Q A;  1WWJ A;  4KF9 A;  1SJ6 A;  2MMN A;  1A8Y A;  1JLV A;  2R3X A;  4L5O A;  2R5G A;  4E68 A;  4AKX B;  4EDY A;  2FY6 A;  4ZBA A;  4AJ7 A;  3OR5 A;  1YEP A;  3ZVJ D;  2XPD A;  3CSI A;  3IE3 A;  5ELG A;  5CRH A;  3F9U A;  1R26 A;  4KE3 A;  3UMA A;  4YQM A;  1MDI A;  1KBN A;  3EUR A;  4FQU A;  1A24 A;  2I3Y A;  2WB9 A;  4GTU A;  4BVX B;  2DIZ A;  3KEB A;  2E0Q A;  5B8B A;  2E2G A;  2PVQ A;  1XFL A;  5J9C A;  1MD4 A;  1U3A A;  3F4S A;  2HI7 A;  4AKI A;  2L4C A;  4XRA A;  3RHC A;  1A0F A;  1S3D A;  2R0G A;  1YZX A;  3DVW A;  2A4H A;  2GT5 A;  3O3T A;  1SD9 A;  1SJI A;  3QDN A;  2WVZ A;  5G2Z A;  4ECJ A;  3CSH A;  4K7N A;  3G7J A;  3S9F A;  1PL1 A;  4AGS A;  3C1S A;  4TOP A;  2DJ1 A;  1TW9 A;  6GSX A;  3F6D A;  3TGZ A;  2CZ3 A;  4L5L A;  1TU7 A;  2FLS A;  2C3Q A;  1ZZY A;  2C0E A;  2FUG 2;  1GTI A;  5E4W A;  1BJX A;  3D22 A;  2YV7 A;  2LJK A;  4K5S A;  1H75 A;  3KP8 A;  4ZIJ A;  4KB3 A;  1XIY A;  2OAC A;  1Z6N A;  3E0U A;  2CVK A;  3UVH A;  3FRC A;  4WBR D;  1K3O A;  4YH2 A;  2YWN A;  3D5J A;  5G1L A;  2A4V A;  2JSY A;  3M9K A;  5DJM A;  3M9J A;  3TKS C;  3LXZ A;  1M7T A;  1Q98 A;  2EFD A;  3PGT A;  2RII A;  2X49 A;  2GQK A;  4IP6 A;  4IGJ A;  4WXT A;  4BL7 A;  3L9S A;  4K1F A;  1QMV A;  4ZL9 A;  3I69 A;  1JZW A;  1GSE A;  2O7K A;  2CVD A;  2VCQ A;  4E8E A;  1FVK A;  2H75 A;  3D0Z A;  3TOU A;  2B5E A;  1ML6 A;  4GSS A;  3IK7 A;  3F3Q A;  4O32 A;  1F3B A;  2IMK A;  4ID0 A;  1EWX A;  2BMX A;  1XWB A;  3D6I A;  5B7C A;  3KJY A;  2ZUP A;  2RM6 A;  2RUE A;  1OYJ A;  4KA0 A;  5IMV A;  1VGL A;  3DWV A;  2OAD A;  3GRX A;  3CRT A;  4MH2 A;  1XCC A;  5J9B A;  1VF3 A;  3GTU A;  3TJJ A;  1Z3E A;  3E3E A;  2AB6 A;  4KSM A;  4DSQ A;  1U6T A;  3L78 A;  1YKA A;  4F0C A;  5F0G A;  4TR3 A;  2EFE A;  4ILF A;  5JCU A;  4EDZ A;  4MZC A;  1SVO A;  4FYB A;  4H86 A;  2VCZ A;  1O6J A;  1F9M A;  1TJD A;  4X4J A;  2VL9 A;  1GUL A;  4WF4 A;  3EE2 A;  4OO5 A;  4AJ6 A;  1TRU A;  2QKE A;  5HQP A;  1ST9 A;  3DVX A;  4XIH A;  3QFA C;  4BWQ A;  1U88 A;  1EGO A;  2K6V A;  2DMM A;  1SL0 B;  3KXO A;  5ECL B;  4ISD A;  1R7H A;  1G7O A;  4D73 A;  3GN3 A;  2VLT A;  1VF1 A;  1EOG A;  1LU4 A;  1N8J A;  5DQY A;  3WT1 A;  2V1M A;  4HI7 A;  2X8G A;  1SL1 B;  1X0R A;  4TR1 A;  2XBI A;  2CT6 A;  2YCD A;  1HNC A;  2PUK C;  3VWW A;  1HNB A;  2LS5 A;  2C0F A;  3GV1 A;  1Z7P A;  3TJF A;  1WOU A;  3EMP A;  4ICY A;  4RQX A;  4I8B A;  3LSZ A;  4GQC A;  4E8H A;  5KN2 A;  4KSO A;  3UL3 A;  2PN8 A;  2E2M A;  1XW5 A;  1THX A;  3Q6O A;  1SEN A;  5GST A;  4ACS A;  3ZML A;  3TKS E;  4I97 A;  2AAW A;  2D2Z A;  4YQU A;  1TXX A;  4HU7 A;  1PL2 A;  2BTO T;  3AY8 A;  1TK8 B;  1SYR A;  2HRK A;  1K0B A;  5DDL A;  1BG5 A;  3F6F A;  5A1N B;  3ZLP A;  2DKH A;  2HE3 A;  4F2I A;  4WEY A;  1PX6 A;  1AQX A;  4ML6 A;  1Z9H A;  4ZL8 A;  2M72 A;  2PVO C;  4HJ2 A;  3IXR A;  4IW9 A;  3MNG A;  1OE8 A;  4O5Q A;  3LEF A;  4OWY A;  2MMO A;  2H19 A;  4PX1 A;  3VI5 A;  4GWR A;  4IKH A;  5CRW A;  4LMV A;  4XS1 A;  3U5R E;  2IPA A;  4TW5 A;  3I6A A;  3ERW A;  1DBY A;  4TKY A;  5IMA A;  4AKH A;  4EL1 A;  5F8B A;  1B48 A;  2FA4 A;  2VIM A;  5ECN B;  4MJB A;  4QMK A;  4MJC A;  3TKR A;  3TOT A;  6GSY A;  2P0G A;  4G19 A;  5EY6 A;  5J4U A;  4L8E A;  1ILO A;  4N0V A;  4WET A;  3A2X A;  2H1L A;  3MAK A;  3HZ4 A;  2PU9 C;  1S3C A;  4BA7 A;  1B4P A;  2YNX A;  1QXH A;  2IL3 A;  5CAX A;  1NM3 A;  1ZMA A;  5J40 A;  5A34 A;  1TI1 A;  4ZIL A;  3L0H A;  5A4W A;  3GIX A;  3GFK A;  1TDI A;  4EXJ A;  6GST A;  2QSI A;  3HYP A;  4MAB A;  1VF2 A;  1ZL9 A;  3FZ4 A;  3GH6 A;  1V57 A;  16GS A;  2XPE A;  3ED3 A;  1VF4 A;  1Z6M A;  4WR5 A;  5EPF A;  1RW1 A;  3APS A;  1X5E A;  2XC2 A;  1W89 A;  5G30 A;  4J2F A;  1XW9 A;  4GQF A;  2MMZ A;  5JCG A;  1M3J A;  2OE3 A;  2R4V A;  2LQO A;  3EVI A;  2R37 A;  8GSS A;  1GSQ A;  3HVS A;  1J9B A;  1OAZ A;  2V6O A;  4IBP A;  1YVL A;  1DUG A;  5HR1 A;  4EIQ A;  3KMO A;  1RK4 A;  2FCH A;  4ZXG A;  2GQM A;  3HXS A;  3H93 A;  3TCO A;  1S4B P;  1SVM A;  2GTU A;  3EU4 A;  2H76 A;  1SKR B;  2N5F A;  1EV9 A;  4RI7 A;  5IMD A;  4OD7 A;  1BAY A;  4Z7X A;  5J4Y A;  1EGR A;  5KOX A;  2H0G A;  4OCF A;  3ME7 A;  2O3E A;  2TIR A;  4G2E A;  3MSZ A;  5HFK A;  1SK0 A;  1QFN A;  4JED A;  5J47 A;  4MMM A;  4KUN A;  4V2L A;  2PGT A;  3HCZ A;  2G2Q A;  1Z5Y E;  2HT9 A;  2WVX B;  2XBQ A;  2LTK A;  5A5H A;  3DIE A;  1BX9 A;  3ZMK A;  3F4R A;  5JCW A;  3QCP A;  5B6M A;  2O36 A;  4DSS B;  1NSW A;  1Q4J A;  4MZB A;  2HRF A;  4KGI A;  3NZN A;  4MJE A;  3IAM 2;  1GSF A;  20GS A;  1GH2 A;  4MZW A;  3QAW A;  1AUC A;  1GTU A;  2HLS A;  4IJI A;  1SK2 A;  1TI3 A;  2LNS A;  1DE1 A;  3HDC A;  3A3T A;  1NW2 A;  2FNO A;  3QOU A;  1X9S B;  4AI6 A;  4USS A;  3K8N A;  2IMD A;  4P3Y B;  5G31 A;  1YF0 A;  2A2P A;  1FB6 A;  5D96 A;  3HVN A;  3IK9 A;  4K0G A;  2IMI A;  1JZO A;  3F0I A;  1B4Q A;  4JU5 A;  2YP6 A;  3BD2 A;  2V32 A;  2HRA A;  2WFC A;  3DYR A;  3M3M A;  2REM A;  3UOM A;  4Z2U A;  1G0T A;  3RBT A;  2H6X A;  3D4M A;  10GS A;  3KMN A;  1BF5 A;  5IOW A;  2CQ9 A;  4NPB A;  4I6X A;  5JWR B;  1FG4 A;  2YJ7 A;  4POM A;  13GS A;  2NDO A;  3L9V A;  2AJQ B;  4OCE A;  2VLU A;  3DD3 A;  1JZD A;  3TKQ A;  3W8J A;  1XZO A;  2WVY A;  2GSS A;  4LA1 A;  2VLV A;  4L0U A;  2HYX A;  3Q19 A;  4PI0 C;  4MH3 A;  4AJ8 A;  1OC8 A;  4YAP A;  1PN9 A;  1I1I P;  4V1A p;  2YPM A;  4G0L A;  2O5V A;  5DCH A;  4MLY A;  1URM A;  2NPB A;  4XHM A;  2JU5 A;  1XG8 A;  4A5P A;  2GST A;  5B8A A;  4X43 A;  5ECR B;  3W6G A;  1M2A A;  1V40 A;  3MYD A;  1YEW C;  3UAR A;  4XS6 A;  1YF1 A;  3W8S A;  2WS2 A;  5AIV A;  2H0I A;  2ON5 A;  1EP8 A;  3E9J B;  1V58 A;  1GTB A;  4JZQ A;  1AIU A;  5COH A;  2AUV A;  2GZY A;  5J41 A;  3ZIJ A;  4I2T A;  3O6T A;  3PH9 A;  2KP1 A;  2GZP A;  4KDU A;  4K6X A;  4Q5F A;  1V2A A;  2C1Y A;  1SKS B;  2LQQ A;  1HNA A;  5CNW A;  1ZYQ B;  2VL2 A;  5BMU B;  3FR3 A;  4IS0 A;  3GKK A;  2UZ8 A;  1J08 A;  2KP2 A;  5JWQ B;  5IM9 A;  4ZBB A;  2J9H A;  5CO3 A;  4KCA A;  2E7P A;  4RI6 A;  5IPH A;  1O85 A;  5L71 A;  4IEL A;  4ZL7 A;  2MBT A;  2B3S A;  4PNF A;  4ZB8 A;  1XPV A;  2X8C A;  2BJX A;  1GUK A;  4LLR A;  5DQS A;  2WW3 A;  2H1A A;  4HDE A;  1SD8 A;  3RPP A;  6GSW A;  1ZGN A;  5JWO B;  3J7Y k;  3TRX A;  4IN0 A;  1OC9 B;  2FWF A;  2JZT A;  2V2G A;  1WE0 A;  2FWH A;  1M2D A;  3DXB A;  3G7I A;  4POB A;  3RDW A;  2G0F A;  1EP7 A;  4QL7 A;  1GP1 A;  3Q74 A;  4X0X A;  1H4O A;  4F03 A;  4LL1 B;  1PQN A;  2UV8 G;  1WIK A;  4OFN A;  3NOF A;  2B6M A;  3A2W A;  2OBK A;  4PTS A;  5CRE A;  1XOB A;  1PGT A;  3TJB A;  4K7O A;  3Q18 A;  2O87 A;  4EO3 A;  4NV5 A;  2DML A;  3ZL5 A;  4F82 A;  1K0C A;  3LG6 A;  4LL4 B;  2B7J A;  4K2X A;  2V6K A;  3V1W A;  2OKA A;  4YQV A;  4MJA A;  5H5S A;  3FKF A;  2R0C A;  3CRU A;  5CYY A;  1KEB A;  2B5X A;  3HKR A;  1I9D A;  1J0F A;  2HSM A;  2C3N A;  1WPI A;  4KH7 A;  1XBS A;  4Z2T A;  4HZ2 A;  2HSN A;  3WGD A;  3VUR A;  1OKT A;  2F8A A;  2O85 A;  2WGR A;  3WGX A;  4BWS A;  4YAV A;  1XWA A;  5DAL A;  3HJP A;  4MF7 A;  5G5F A;  1PX7 A;  4TXO A;  1CQH A;  1TK0 B;  4KND A;  4NHW A;  2MYG A;  5ID2 A;  3L4N A;  3IAS 2;  1T7P B;  1G6Y A;  5ECK B;  2DKI A;  1FHE A;  1X5D A;  1OVN A;  2OT3 A;  1O7U A;  5AIS A;  4YKG A;  2MZC A;  4N3Z A;  3QAG A;  5DVB A;  3DKS A;  4OMV A;  3LYP A;  2B7K A;  2HZE B;  1A0R P;  4O92 A;  1K3Y A;  2IFQ B;  5LNK e;  2H72 A;  1TTZ A;  3G9B A;  5F06 A;  2H1G A;  1GNE A;  2HZF A;  2DC5 A;  1PRX A;  1ERT A;  1TXU A;  4PHZ C;  4ZB7 A;  4MP4 A;  5KN3 A;  5ECO B;  1B9Y C;  4XS4 A;  4QL9 A;  1IYH A;  2L59 A;  4HS1 A;  5HR2 A;  2GDR A;  3FYG A;  4GXZ A;  2H66 A;  1V9W A;  5IMZ A;  5IMF A;  2GT6 A;  2H74 A;  4BPY A;  3TKS A;  1WP0 A;  5D8I A;  2EC4 A;  1YKC A;  4PUR A;  1TRV A;  1Y25 A;  3R3E A;  3U6V A;  1BG1 A;  1GLP A;  5GAP D;  2ALB A;  3HHV A;  4HQS A;  2GQL A;  2HSH A;  3RAZ A;  1SKW B;  2VD0 A;  5HFI A;  4J56 E;  1B9X C;  4V2M A;  1ERW A;  3P7X A;  4BVX A;  4KX4 A;  1OE7 A;  1HD2 A;  3CHX C;  3GKN A;  4G01 A;  3GNJ A;  5BRT A;  2R6K A;  2FA8 A;  1GUH A;  1EEJ A;  2H6Z A;  1LBK A;  5ECM B;  5IO2 A;  3HMJ G;  5H5Q A;  2H70 A;  2LRC A;  1ZYE A;  11GS A;  4IQA A;  3C7M A;  4CY8 A;  4XCS A;  1Z7R A;  2VM2 A;  3P8W A;  4HUA A;  2VCX A;  1ERV A;  1O8W A;  4Z2R A;  1TP9 A;  4GLT A;  2KOK A;  3GKX A;  2LJR A;  2YN1 A;  1ACV A;  5LCZ A;  4G10 A;  2M46 A;  1K0M A;  1UA5 A;  5A4U A;  1K0D A;  1EEM A;  1JLW A;  4RQR A;  5LD0 A;  3GUS A;  1XVQ A;  3F8U A;  3LWA A;  2CVB A;  3KTB A;  5HR0 A;  1K3L A;  5IQY A;  1U87 A;  3M8N A;  3DGQ A;  2N5A A;  3ISO A;  4BL7 B;  2FWE A;  2L5O A;  5GZZ B;  4GCI A;  3G7Y A;  3GA4 A;  2JAC A;  4PI2 C;  3IOS A;  1ABA A;  2CA8 A;  4MDC A;  2HXK A;  3FZ9 A;  3KH9 A;  3GHA A;  4O5R A;  1JHB A;  1VRS D;  4I2U A;  4V2N A;  3WD6 A;  3VFI A;  4DSR A;  4EE0 A;  1QQ2 A;  3GX8 A;  1DE2 A;  5IMC A;  1AXD A;  3SBC A;  4AF2 A;  2WCI A;  1HQO A;  2EFC A;  5J3R A;  3EC3 A;  4N30 A;  4GST A;  5DBQ A;  5IIZ A;  4PQI A;  3QR6 A;  4ECI A;  3SWL A;  4WR4 A;  4IJ3 A;  4BVY B;  1A8L A;  2GGT A;  1XWK A;  3CSJ A; 
#chains in the Genus database with same CATH homology
 1F3A A;  3GTU B;  4MF6 A;  4IP1 A;  1BQ7 A;  2JZS A;  4CHS A;  5DCG A;  3KH7 A;  3GL5 A;  1FOV A;  6GSV A;  2AYT A;  2WDU A;  3GSS A;  3M1G A;  3LW9 A;  2V41 A;  12GS A;  2QGV A;  3HVX A;  3DML A;  2C80 A;  4EKZ A;  2IN3 A;  2H8L A;  1YY7 A;  3FZ5 A;  2IIY A;  3WYW A;  3ZFB A;  2WUL A;  5KN0 A;  2I4A A;  2X8H A;  1F37 A;  4XTS A;  3QAV A;  3HD5 A;  4K7I A;  4V1A g;  2JAD A;  1JZR A;  4D73 B;  2LST A;  4EVM A;  3KIJ A;  4ULX A;  4PXO A;  1I5G A;  1SK1 A;  2CX3 A;  4DVC A;  3VI7 A;  2AV4 A;  1K0N A;  4JR4 A;  1Y1U A;  3TJG A;  4F0B A;  2GLR A;  1F6M C;  2VL3 A;  2WZ9 A;  4Q5Q A;  2X4A A;  17GS A;  3LYK A;  4HEA 2;  4KDX A;  3ZVJ A;  1TOF A;  2LNT A;  4NWY A;  3GST A;  1WRY A;  2CX4 A;  2I81 A;  3GL3 A;  2YZU A;  4F9Z A;  2IJY A;  4TR4 A;  3F3R A;  2C0D A;  4OFT A;  2I1U A;  1JFU A;  2HZE A;  2VM1 A;  2NVL A;  1TK5 B;  3BBY A;  2IFQ A;  3PPU A;  3EWL A;  4NXI A;  1TKD B;  4NAX A;  5A1N A;  3IA1 A;  4JRR A;  3FR9 A;  4MF5 A;  4HZ4 A;  5D9X A;  3WGE A;  3P90 A;  1DSB A;  2X64 A;  3N9J A;  3PIN A;  3DRN A;  4G0I A;  1UN2 A;  4O7H A;  4I5Q A;  2CAI A;  4FIW A;  4ML1 A;  1M9B A;  3RPN A;  3VWV A;  2ZNM A;  2IMF A;  1PMT A;  19GS A;  4G9H A;  4ECB A;  4HJM A;  2F3M A;  4MPF A;  4GDF A;  3BCK A;  5F07 A;  5A5K A;  4FYU A;  2GSR A;  5DAK B;  1K0O A;  1PSQ A;  3FY7 A;  5G5E A;  3MIX A;  5D9V A;  2MMA A;  1AAZ A;  2HSY A;  2K8S A;  3UVT A;  1OKD A;  1XWG A;  5D9T A;  4MK3 A;  1FAA A;  1R5A A;  1TU8 A;  3LOR A;  1YQ1 A;  5ECP B;  4HQZ A;  2FD3 A;  1PN0 A;  1ON4 A;  1K0A A;  3C8E A;  1O8X A;  4WKW A;  1E6B A;  1SJZ A;  2CV4 A;  4JR6 A;  5A34 B;  1MDJ A;  3ZFL A;  1M9A A;  2ZCT A;  2H6Y A;  5HFG A;  3APQ A;  4EF0 A;  4K8M A;  1X9W B;  3BOA A;  1N2A A;  3ZIT A;  1FOH A;  2HRN A;  5AIX A;  2DJK A;  2PWJ A;  5ABR A;  2CAQ A;  5A4V A;  3HZ8 A;  3LFL A;  3CMI A;  3CWG A;  1GUM A;  4EC0 A;  3LGC A;  3LQ7 A;  2P5R A;  1XWC A;  3ZZX A;  2P31 A;  1RQM A;  4KW6 A;  2YAN A;  2Z9S A;  3GYK A;  1XVW A;  2A2S A;  1UVZ A;  4MPG A;  3H79 A;  2GZZ A;  1F2E A;  3F4T A;  2NTO A;  3O76 A;  2B1K A;  4MNN A;  3JCM L;  3C73 A;  1GSU A;  4K0N A;  2L5L A;  5ECI B;  4NV2 A;  3EIN A;  4PUF C;  2VCV A;  2YOI A;  3QMX A;  3FZA A;  1U3I A;  1MEK A;  3MWH A;  1T00 A;  2RLI A;  6GSU A;  2DBC A;  5KOW A;  5CP1 A;  4HOJ A;  2DJ0 A;  4LMW A;  3ZTL A;  3TDG A;  3FEU A;  4TRX A;  3TRQ A;  3VPT A;  2DJ2 A;  3VLN A;  2C4J A;  3HJM A;  2WRT A;  3ERF A;  1AQV A;  4POK A;  1T8E B;  1USB A;  1X9M B;  3IBH A;  3VK9 A;  4K5R A;  1R5P A;  1O81 A;  4RUV A;  2KHP A;  2H30 A;  3EU3 A;  1NHO A;  3TU3 B;  2NBS A;  5D93 A;  4BVY A;  3HJO A;  4DEJ A;  1YDK A;  5A5H B;  2EIQ A;  5AN1 A;  2PBJ A;  2WJU A;  6GSS A;  4OO4 A;  1THO A;  22GS A;  4TR0 A;  2VKZ G;  1A2L A;  3DEX A;  4DSS A;  1EZK A;  3TJK A;  2H73 A;  3I9V 2;  3GH9 A;  5H5R A;  3MDK A;  4IVF A;  2H1D A;  3UBK A;  4FO5 A;  3EPT A;  5IO0 A;  2QC7 A;  3TRP A;  2H0H A;  2LRT A;  3UJ1 A;  1T4Y A;  4KAE A;  4NMU A;  3C71 A;  5IPG A;  1A23 A;  3H4K A;  3US3 A;  3FW2 A;  2DJJ A;  2DSA A;  3D4T A;  5ELA A;  5DJL A;  2OE0 A;  5B6N A;  2B1L A;  5G1K A;  3J7Y b;  3IC4 A;  3F63 A;  4GRF A;  2LEG A;  1ZYP A;  5CRD A;  5F05 A;  1GL8 A;  3VWX A;  1PKZ A;  2GSQ A;  2VD1 A;  1XW6 A;  2JZR A;  3C1R A;  3UIW A;  2K9F A;  2M80 A;  2EIR A;  2PER A;  3GKM A;  4OFM A;  4AKG A;  2P5Q A;  5CRG A;  3LXT A;  2YZH A;  3CTG A;  3D21 A;  4Q5N A;  2OA7 A;  5EL8 A;  2L6D A;  2C3T A;  3BJ5 A;  14GS A;  3FMW A;  5AGY A;  4IHU A;  3TB2 A;  1CQG A;  4ZB6 A;  3CYN A;  3ERG A;  2JSZ A;  4MCU A;  1R4W A;  1E2Y A;  2GS3 A;  5EVO A;  2LJA A;  1B8X A;  3IC8 A;  2F51 A;  2YWO A;  3IHQ A;  4KDY A;  5ECS A;  1G7E A;  1EOH A;  2DJ3 A;  3IHG A;  2R2J A;  4ZBD A;  1GNW A;  4TN8 A;  18GS A;  1O73 A;  3H1N A;  1BED A;  2OBI A;  5J4V A;  4TVE A;  1X5C A;  5DAK A;  2FWG A;  9GSS A;  3I43 A;  2O8V B;  1AQW A;  3IV4 A;  2F8F A;  3M0F A;  4ZB9 A;  5INY A;  1ERU A;  1KTE A;  4PQ1 A;  3VPQ A;  5GAN D;  3WT2 A;  1FB0 A;  3ZRD A;  3IPZ A;  3QD9 A;  1HYU A;  4CY6 A;  3TUE A;  4PQH A;  3KTL A;  4YKF A;  4TXV A;  2PMT A;  2KUC A;  5GSS A;  2LV3 A;  1T1V A;  3EMX A;  3IR4 A;  1XXU A;  2I9H A;  3CBU A;  3UEM A;  1FO5 A;  1MDK A;  2C0G A;  2XHF A;  2VUP A;  3EYT A;  5HR3 A;  4CDO A;  1S3A A;  3UAP A;  1FW1 A;  3R2Q A;  5D9W A;  1SU9 A;  2YWM A;  1M0U A;  5BMU A;  4PGT A;  2YJH A;  1C72 A;  5FHI A;  2OJL A;  1GSD A;  2JL4 A;  3UBL A;  1ZOF A;  5FT3 A;  3ME8 A;  4Q5R A;  1TRW A;  2VCW A;  1AC1 A;  3A2V A;  1MTC A;  3QFB C;  2IME A;  5C04 A;  1MD3 A;  3HVV A;  4PUA A;  2DIY A;  3VWU A;  2J23 A;  2A2R A;  2HFD A;  2F9S A;  2DLX A;  3KP9 A;  5FWG A;  3ZIV A;  2QA2 A;  1YEX A;  1OC9 A;  2KLX A;  3GMF A;  2VOC A;  3H8Q A;  3PR8 A;  5J5N A;  2TRX A;  4X1U A;  7GSS A;  2YV9 A;  2PPT A;  1ZYN A;  5D73 A;  3N5O A;  4ECC A;  2X99 A;  1M99 A;  3KGK A;  2L57 A;  4IQ1 A;  2RM5 A;  2VCT A;  4GSN A;  2VO4 A;  4L0W A;  3A5W A;  1V98 A;  2B5Y A;  4QQ7 A;  1QUW A;  4NHZ A;  3APO A;  4EIP A;  3KM6 A;  1GSS A;  3HA9 A;  4JE1 A;  2TRC P;  3NIV A;  3GUR A;  2VL2 C;  2ON7 A;  3RHB A;  1UC7 A;  3A5I A;  3QPM A;  2FGX A;  4EUY A;  3LJR A;  1W4V A;  2MBS A;  2LRN A;  4CW9 A;  2LUS A;  5IOX A;  1KNG A;  4JBB A;  4POL A;  5ENU A;  2IWT A;  1N25 A;  2K18 A;  1WMJ A;  4WBJ A;  2H01 A;  2R0P A;  1T3B A;  4N11 A;  3CXG A;  3ZRE A;  1AW9 A;  2HSM B;  1PKW A;  2OE1 A;  2EFH A;  1XOA A;  4FYC A;  4N10 A;  3IDV A;  3FR6 A;  2HSN B;  2K8V A;  2H71 A;  2N5B A;  4K9Z A;  4WF5 A;  2C8U A;  3IRA A;  4O5U A;  1OC3 A;  5C00 A;  1Y6E A;  2FHE A;  3GX0 A;  5DAL B;  3CTF A;  5ECH B;  5KEJ A;  1GWC A;  2H1B A;  4TXO B;  2EIO A;  3KCM A;  1WJK A;  4TR1 B;  1YJ6 A;  5ID2 B;  3HY2 A;  4FH8 A;  1FVJ A;  4W66 A;  5ECQ B;  3P2A A;  1PA3 A;  4KCE A;  4K2D A;  1GTA A;  5E59 A;  2YWI A;  1GRX A;  2VAF A;  3FHK A;  3ZYW A;  2QA1 A;  2CZ2 A;  4J57 E;  4HU9 A;  3BCI A;  3KZQ A;  4G0K A;  3FK8 A;  2L6C A;  1IYI A;  4N0Z A;  2LKU A;  1A2J A;  2HRK B;  1A2M A;  3TKP A;  1SL2 B;  1T4Z A;  3L9U A;  1G6W A;  2HNL A;  1SYX A;  1GSY A;  1QGV A;  3KD0 A;  4XS4 B;  4GF0 A;  5KN1 A;  1NHY A;  4XRD A;  4PNG A;  1ZCP A;  2RUF A;  1EV4 A;  1TRS A;  1LJR A;  1PD2 1;  2ES7 A;  2GVP A;  1QK8 A;  4MA9 A;  1GLQ A;  1BYE A;  2HQT A;  1SVL A;  1M2B A;  2O89 A;  2AHE A;  2L4Q A;  1WWJ A;  4KF9 A;  1SJ6 A;  2MMN A;  1A8Y A;  1JLV A;  2R3X A;  4L5O A;  2R5G A;  4E68 A;  4AKX B;  4EDY A;  2FY6 A;  4ZBA A;  4AJ7 A;  3OR5 A;  1YEP A;  3ZVJ D;  2XPD A;  3CSI A;  3IE3 A;  5ELG A;  5CRH A;  3F9U A;  1R26 A;  4KE3 A;  3UMA A;  4YQM A;  1MDI A;  1KBN A;  3EUR A;  4FQU A;  1A24 A;  2I3Y A;  2WB9 A;  4GTU A;  4BVX B;  2DIZ A;  3KEB A;  2E0Q A;  5B8B A;  2E2G A;  2PVQ A;  1XFL A;  5J9C A;  1MD4 A;  1U3A A;  3F4S A;  2HI7 A;  4AKI A;  2L4C A;  4XRA A;  3RHC A;  1A0F A;  1S3D A;  2R0G A;  1YZX A;  3DVW A;  2A4H A;  2GT5 A;  3O3T A;  1SD9 A;  1SJI A;  3QDN A;  5G2Z A;  4ECJ A;  3CSH A;  4K7N A;  3G7J A;  3S9F A;  1PL1 A;  4AGS A;  3C1S A;  4TOP A;  2DJ1 A;  1TW9 A;  6GSX A;  3F6D A;  3TGZ A;  2CZ3 A;  4L5L A;  1TU7 A;  2FLS A;  2C3Q A;  1ZZY A;  2C0E A;  2FUG 2;  1GTI A;  5E4W A;  1BJX A;  3D22 A;  2YV7 A;  2LJK A;  4K5S A;  1H75 A;  3KP8 A;  4ZIJ A;  4KB3 A;  1XIY A;  2OAC A;  1Z6N A;  3E0U A;  2CVK A;  3UVH A;  3FRC A;  4WBR D;  1K3O A;  4YH2 A;  2YWN A;  3D5J A;  5G1L A;  2A4V A;  2JSY A;  3M9K A;  5DJM A;  3M9J A;  3TKS C;  3LXZ A;  1M7T A;  1Q98 A;  2EFD A;  3PGT A;  2RII A;  2X49 A;  2GQK A;  4IP6 A;  4IGJ A;  4WXT A;  4BL7 A;  3L9S A;  4K1F A;  1QMV A;  4ZL9 A;  3I69 A;  1JZW A;  1GSE A;  2O7K A;  2CVD A;  2VCQ A;  4E8E A;  1FVK A;  2H75 A;  3D0Z A;  3TOU A;  2B5E A;  1ML6 A;  4GSS A;  3IK7 A;  3F3Q A;  4O32 A;  1F3B A;  2IMK A;  4ID0 A;  1EWX A;  2BMX A;  1XWB A;  3D6I A;  5B7C A;  3KJY A;  2ZUP A;  2RM6 A;  2RUE A;  1OYJ A;  4KA0 A;  5IMV A;  1VGL A;  3DWV A;  2OAD A;  3GRX A;  3CRT A;  4MH2 A;  1XCC A;  5J9B A;  1VF3 A;  3GTU A;  3TJJ A;  1Z3E A;  3E3E A;  2AB6 A;  4KSM A;  4DSQ A;  1U6T A;  3L78 A;  1YKA A;  4F0C A;  5F0G A;  4TR3 A;  2EFE A;  4ILF A;  5JCU A;  4EDZ A;  4MZC A;  1SVO A;  4FYB A;  4H86 A;  2VCZ A;  1O6J A;  1F9M A;  1TJD A;  4X4J A;  2VL9 A;  1GUL A;  4WF4 A;  3EE2 A;  4OO5 A;  4AJ6 A;  1TRU A;  2QKE A;  5HQP A;  1ST9 A;  3DVX A;  4XIH A;  3QFA C;  4BWQ A;  1U88 A;  1EGO A;  2K6V A;  2DMM A;  1SL0 B;  3KXO A;  5ECL B;  4ISD A;  1R7H A;  1G7O A;  4D73 A;  3GN3 A;  2VLT A;  1VF1 A;  1EOG A;  1LU4 A;  1N8J A;  5DQY A;  3WT1 A;  2V1M A;  4HI7 A;  2X8G A;  1SL1 B;  1X0R A;  4TR1 A;  2XBI A;  2CT6 A;  2YCD A;  1HNC A;  2PUK C;  3VWW A;  1HNB A;  2LS5 A;  2C0F A;  3GV1 A;  1Z7P A;  3TJF A;  1WOU A;  3EMP A;  4ICY A;  4RQX A;  4I8B A;  3LSZ A;  4GQC A;  4E8H A;  5KN2 A;  4KSO A;  3UL3 A;  2PN8 A;  2E2M A;  1XW5 A;  1THX A;  3Q6O A;  1SEN A;  5GST A;  4ACS A;  3ZML A;  3TKS E;  4I97 A;  2AAW A;  2D2Z A;  4YQU A;  1TXX A;  4HU7 A;  1PL2 A;  2BTO T;  3AY8 A;  1TK8 B;  1SYR A;  2HRK A;  1K0B A;  5DDL A;  1BG5 A;  3F6F A;  5A1N B;  3ZLP A;  2DKH A;  2HE3 A;  4F2I A;  4WEY A;  1PX6 A;  1AQX A;  4ML6 A;  1Z9H A;  4ZL8 A;  2M72 A;  2PVO C;  4HJ2 A;  3IXR A;  4IW9 A;  3MNG A;  1OE8 A;  4O5Q A;  3LEF A;  4OWY A;  2MMO A;  2H19 A;  4PX1 A;  3VI5 A;  4GWR A;  4IKH A;  5CRW A;  4LMV A;  4XS1 A;  3U5R E;  2IPA A;  4TW5 A;  3I6A A;  3ERW A;  1DBY A;  4TKY A;  5IMA A;  4AKH A;  4EL1 A;  5F8B A;  1B48 A;  2FA4 A;  2VIM A;  5ECN B;  4MJB A;  4QMK A;  4MJC A;  3TKR A;  3TOT A;  6GSY A;  2P0G A;  4G19 A;  5EY6 A;  5J4U A;  4L8E A;  1ILO A;  4N0V A;  4WET A;  3A2X A;  2H1L A;  3MAK A;  3HZ4 A;  2PU9 C;  1S3C A;  4BA7 A;  1B4P A;  2YNX A;  1QXH A;  2IL3 A;  5CAX A;  1NM3 A;  1ZMA A;  5J40 A;  5A34 A;  1TI1 A;  4ZIL A;  3L0H A;  5A4W A;  3GIX A;  3GFK A;  1TDI A;  4EXJ A;  6GST A;  2QSI A;  3HYP A;  4MAB A;  1VF2 A;  1ZL9 A;  3FZ4 A;  3GH6 A;  1V57 A;  16GS A;  2XPE A;  3ED3 A;  1VF4 A;  1Z6M A;  4WR5 A;  5EPF A;  1RW1 A;  3APS A;  1X5E A;  2XC2 A;  1W89 A;  5G30 A;  4J2F A;  1XW9 A;  4GQF A;  2MMZ A;  5JCG A;  2OE3 A;  2R4V A;  2LQO A;  3EVI A;  2R37 A;  8GSS A;  1GSQ A;  3HVS A;  1J9B A;  1OAZ A;  2V6O A;  4IBP A;  1YVL A;  1DUG A;  5HR1 A;  4EIQ A;  3KMO A;  1RK4 A;  2FCH A;  4ZXG A;  2GQM A;  3HXS A;  3H93 A;  3TCO A;  1SVM A;  2GTU A;  3EU4 A;  2H76 A;  1SKR B;  2N5F A;  1EV9 A;  4RI7 A;  5IMD A;  4OD7 A;  1BAY A;  4Z7X A;  5J4Y A;  1EGR A;  5KOX A;  2H0G A;  4OCF A;  3ME7 A;  2TIR A;  4G2E A;  3MSZ A;  5HFK A;  1SK0 A;  1QFN A;  4JED A;  5J47 A;  4MMM A;  4KUN A;  4V2L A;  2PGT A;  3HCZ A;  2G2Q A;  1Z5Y E;  2HT9 A;  2XBQ A;  2LTK A;  5A5H A;  3DIE A;  1BX9 A;  3ZMK A;  3F4R A;  5JCW A;  3QCP A;  5B6M A;  4DSS B;  1NSW A;  1Q4J A;  4MZB A;  2HRF A;  4KGI A;  3NZN A;  4MJE A;  3IAM 2;  1GSF A;  20GS A;  1GH2 A;  4MZW A;  3QAW A;  1AUC A;  1GTU A;  2HLS A;  4IJI A;  1SK2 A;  1TI3 A;  2LNS A;  1DE1 A;  3HDC A;  3A3T A;  1NW2 A;  2FNO A;  3QOU A;  1X9S B;  4AI6 A;  4USS A;  3K8N A;  2IMD A;  4P3Y B;  5G31 A;  1YF0 A;  2A2P A;  1FB6 A;  5D96 A;  3IK9 A;  4K0G A;  2IMI A;  1JZO A;  3F0I A;  1B4Q A;  4JU5 A;  2YP6 A;  3BD2 A;  2V32 A;  2HRA A;  2WFC A;  3DYR A;  3M3M A;  2REM A;  3UOM A;  4Z2U A;  1G0T A;  3RBT A;  2H6X A;  3D4M A;  10GS A;  3KMN A;  1BF5 A;  5IOW A;  2CQ9 A;  4NPB A;  4I6X A;  5JWR B;  1FG4 A;  2YJ7 A;  4POM A;  13GS A;  2NDO A;  3L9V A;  2AJQ B;  4OCE A;  2VLU A;  3DD3 A;  1JZD A;  3TKQ A;  3W8J A;  1XZO A;  2GSS A;  4LA1 A;  2VLV A;  4L0U A;  2HYX A;  3Q19 A;  4MH3 A;  4AJ8 A;  1OC8 A;  4YAP A;  1PN9 A;  4V1A p;  2YPM A;  4G0L A;  2O5V A;  5DCH A;  4MLY A;  1URM A;  2NPB A;  4XHM A;  2JU5 A;  4A5P A;  2GST A;  5B8A A;  4X43 A;  5ECR B;  3W6G A;  1M2A A;  1V40 A;  3MYD A;  3UAR A;  4XS6 A;  1YF1 A;  3W8S A;  2WS2 A;  5AIV A;  2H0I A;  2ON5 A;  1EP8 A;  3E9J B;  1V58 A;  1GTB A;  4JZQ A;  1AIU A;  5COH A;  2AUV A;  2GZY A;  5J41 A;  3ZIJ A;  4I2T A;  3O6T A;  3PH9 A;  2KP1 A;  2GZP A;  4KDU A;  4K6X A;  4Q5F A;  1V2A A;  2C1Y A;  1SKS B;  2LQQ A;  1HNA A;  5CNW A;  1ZYQ B;  2VL2 A;  5BMU B;  3FR3 A;  4IS0 A;  3GKK A;  2UZ8 A;  1J08 A;  2KP2 A;  5JWQ B;  5IM9 A;  4ZBB A;  2J9H A;  5CO3 A;  4KCA A;  2E7P A;  4RI6 A;  5IPH A;  1O85 A;  5L71 A;  4IEL A;  4ZL7 A;  2MBT A;  2B3S A;  4PNF A;  4ZB8 A;  1XPV A;  2X8C A;  2BJX A;  1GUK A;  4LLR A;  5DQS A;  2H1A A;  4HDE A;  1SD8 A;  3RPP A;  6GSW A;  1ZGN A;  5JWO B;  3J7Y k;  3TRX A;  4IN0 A;  1OC9 B;  2FWF A;  2JZT A;  2V2G A;  1WE0 A;  2FWH A;  1M2D A;  3DXB A;  3G7I A;  4POB A;  3RDW A;  2G0F A;  1EP7 A;  4QL7 A;  1GP1 A;  3Q74 A;  4X0X A;  1H4O A;  4F03 A;  4LL1 B;  1PQN A;  2UV8 G;  1WIK A;  4OFN A;  3NOF A;  2B6M A;  3A2W A;  2OBK A;  4PTS A;  5CRE A;  1XOB A;  1PGT A;  3TJB A;  4K7O A;  3Q18 A;  2O87 A;  4EO3 A;  4NV5 A;  2DML A;  3ZL5 A;  4F82 A;  1K0C A;  3LG6 A;  4LL4 B;  2B7J A;  4K2X A;  2V6K A;  3V1W A;  2OKA A;  4YQV A;  4MJA A;  5H5S A;  3FKF A;  2R0C A;  3CRU A;  5CYY A;  1KEB A;  2B5X A;  3HKR A;  1I9D A;  1J0F A;  2HSM A;  2C3N A;  1WPI A;  4KH7 A;  1XBS A;  4Z2T A;  4HZ2 A;  2HSN A;  3WGD A;  3VUR A;  1OKT A;  2F8A A;  2O85 A;  2WGR A;  3WGX A;  4BWS A;  4YAV A;  1XWA A;  5DAL A;  3HJP A;  4MF7 A;  5G5F A;  1PX7 A;  4TXO A;  1CQH A;  1TK0 B;  4KND A;  4NHW A;  2MYG A;  5ID2 A;  3L4N A;  3IAS 2;  1T7P B;  1G6Y A;  5ECK B;  2DKI A;  1FHE A;  1X5D A;  1OVN A;  2OT3 A;  1O7U A;  5AIS A;  4YKG A;  2MZC A;  4N3Z A;  3QAG A;  5DVB A;  3DKS A;  4OMV A;  3LYP A;  2B7K A;  2HZE B;  1A0R P;  4O92 A;  1K3Y A;  2IFQ B;  5LNK e;  2H72 A;  1TTZ A;  3G9B A;  5F06 A;  2H1G A;  1GNE A;  2HZF A;  2DC5 A;  1PRX A;  1ERT A;  1TXU A;  4ZB7 A;  4MP4 A;  5KN3 A;  5ECO B;  1B9Y C;  4XS4 A;  4QL9 A;  1IYH A;  2L59 A;  4HS1 A;  5HR2 A;  2GDR A;  3FYG A;  4GXZ A;  2H66 A;  1V9W A;  5IMZ A;  5IMF A;  2GT6 A;  2H74 A;  4BPY A;  3TKS A;  1WP0 A;  5D8I A;  2EC4 A;  1YKC A;  4PUR A;  1TRV A;  1Y25 A;  3R3E A;  3U6V A;  1BG1 A;  1GLP A;  5GAP D;  2ALB A;  3HHV A;  4HQS A;  2GQL A;  2HSH A;  3RAZ A;  1SKW B;  2VD0 A;  5HFI A;  4J56 E;  1B9X C;  4V2M A;  1ERW A;  3P7X A;  4BVX A;  4KX4 A;  1OE7 A;  1HD2 A;  3GKN A;  4G01 A;  3GNJ A;  5BRT A;  2R6K A;  2FA8 A;  1GUH A;  1EEJ A;  2H6Z A;  1LBK A;  5ECM B;  5IO2 A;  3HMJ G;  5H5Q A;  2H70 A;  2LRC A;  1ZYE A;  11GS A;  4IQA A;  3C7M A;  4CY8 A;  4XCS A;  1Z7R A;  2VM2 A;  3P8W A;  4HUA A;  2VCX A;  1ERV A;  1O8W A;  4Z2R A;  1TP9 A;  4GLT A;  2KOK A;  3GKX A;  2LJR A;  2YN1 A;  1ACV A;  5LCZ A;  4G10 A;  2M46 A;  1K0M A;  1UA5 A;  5A4U A;  1K0D A;  1EEM A;  1JLW A;  4RQR A;  5LD0 A;  3GUS A;  1XVQ A;  3F8U A;  3LWA A;  2CVB A;  3KTB A;  5HR0 A;  1K3L A;  5IQY A;  1U87 A;  3M8N A;  3DGQ A;  2N5A A;  3ISO A;  4BL7 B;  2FWE A;  2L5O A;  5GZZ B;  4GCI A;  3G7Y A;  3GA4 A;  2JAC A;  3IOS A;  1ABA A;  2CA8 A;  4MDC A;  2HXK A;  3FZ9 A;  3KH9 A;  3GHA A;  4O5R A;  1JHB A;  1VRS D;  4I2U A;  4V2N A;  3WD6 A;  3VFI A;  4DSR A;  4EE0 A;  1QQ2 A;  3GX8 A;  1DE2 A;  5IMC A;  1AXD A;  3SBC A;  4AF2 A;  2WCI A;  1HQO A;  2EFC A;  5J3R A;  3EC3 A;  4N30 A;  4GST A;  5DBQ A;  5IIZ A;  4PQI A;  3QR6 A;  4ECI A;  3SWL A;  4WR4 A;  4IJ3 A;  4BVY B;  1A8L A;  2GGT A;  1XWK A;  3CSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...