5ELGA

The structure of dhar1 from arabidopsis thaliana
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
ALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Arabidopsis thaliana DHAR1 apo structure
rcsb
molecule keywords Glutathione S-transferase DHAR1, mitochondrial
molecule tags Transferase
source organism Arabidopsis thaliana
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5elgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5elgA01
4KCEA 3F3RA 5IOXA 3ZREA 1OC8A 2B1LA 2CQ9A 1GUKA 2XBIA 3ZTLA 2H1BA 2HSHA 3FRCA 5IMFA 2WS2A 4OFTA 5ECRB 3O3TA 2FWFA 2P0GA 5F0GA 1O8WA 2B6MA 1U3IA 4HQZA 1WJKA 4TRXA 3GH6A 1XOBA 1BEDA 2BMXA 1Z7PA 1OVNA 3LXTA 3ZMKA 1Q4JA 3MWHA 2DIZA 4HU9A 1TP9A 1SL0B 3M9KA 2BJXA 5D93A 3TKSE 4I2TA 9GSSA 4AJ7A 4X0XA 3LYPA 2ON7A 1ERUA 2EIQA 2N5FA 2O8VB 1PRXA 2HXKA 2MZCA 4EO3A 5ID2B 3H1NA 3GX0A 1JZOA 2DSAA 2LJRA 2V1MA 3DXBA 4N0VA 5F07A 3M3MA 2RLIA 3R3EA 2JACA 2B7JA 1M9BA 4OD7A 3APQA 3C73A 2GDRA 2WJUA 2V2GA 3VPQA 2VLTA 2H70A 2X64A 2ZCTA 3JCML 1GSYA 1VF3A 3ZFLA 3TJJA 4HI7A 3ZYWA 2OE3A 1LU4A 3FYGA 1XWGA 1SJ6A 3VLNA 4HJ2A 5CRGA 3RPPA 5LCZA 2JSYA 1GSDA 4RQXA 4K1FA 5L71A 1CQGA 3UMAA 4ZL8A 2LRCA 2AUVA 2FY6A 3NIVA 1XWAA 1PN9A 3EINA 4BWQA 4HZ4A 2HI7A 1OKDA 2DJ1A 1ACVA 3GUSA 1U3AA 2H8LA 5EPFA 3A2VA 2LJKA 3G7IA 4G19A 2YN1A 1QK8A 3NOFA 3BJ5A 4EL1A 4ZL7A 1T8EB 2FWEA 1X0RA 8GSSA 3IPZA 2DJ3A 3E9JB 1A0RP 4XRAA 1EV4A 2LRTA 4XHMA 2TIRA 3EMXA 1S3CA 5H5QA 2LJAA 1CQHA 2GTUA 3TKSA 2CAIA 2FA4A 2H01A 2N5AA 1GNWA 4WXTA 1I9DA 2A2RA 1GL8A 3U6VA 2V6KA 3PINA 2H72A 4XRDA 3GMFA 5GSSA 3CRUA 2C0FA 4WF4A 1B9YC 2YANA 3ERFA 2IIYA 2FWHA 4I2UA 4XIHA 3FEUA 2VCQA 2XHFA 2NBSA 3KP8A 3EU4A 4MP4A 4Q5FA 3TJGA 3E3EA 4FQUA 5E4WA 1BX9A 4CHSA 5F8BA 4PNGA 2PWJA 4D73A 4DSQA 2VL2A 4PX1A 3HHVA 1TXXA 5ENUA 4OFMA 2ZNMA 2EC4A 3GN3A 4BWSA 1FB0A 2DJ2A 1OC3A 3MNGA 2YV7A 3KP9A 5JWRB 3QPMA 6GSTA 4HOJA 3HVVA 4NPBA 3BOAA 3D5JA 4F0BA 1XWCA 1TW9A 5J41A 2L59A 5GAND 4IP1A 1GRXA 1KEBA 1ZCPA 1SK2A 3DRNA 1AUCA 1THXA 5A4WA 1TOFA 4KDXA 4OCEA 3I69A 3EYTA 4K9ZA 3QOUA 4DVCA 1DUGA 5IMVA 1TRSA 4RUVA 1K0BA 19GSA 1FVKA 2YWIA 1E2YA 4F03A 1A0FA 5LNKe 3EMPA 3D21A 4GXZA 1ILOA 3U5RE 2AB6A 2F3MA 1MD4A 2OBIA 5H5SA 3HJMA 1HNAA 2FLSA 3SBCA 2MMZA 1BJXA 2FHEA 1EEMA 2E7PA 2FUG2 1XIYA 4USSA 3GIXA 3LQ7A 2I81A 2CZ3A 3QFBC 3I6AA 2WULA 4XS1A 2H1DA 2HQTA 3WGEA 4ECIA 2R4VA 5AISA 1VF1A 4ML1A 5DDLA 2PU9C 1FW1A 4GRFA 3UEMA 1BAYA 2LTKA 1TRUA 5H5RA 3G9BA 4GTUA 3D0ZA 1R5AA 4JR6A 1QFNA 2RM5A 2R6KA 4NV2A 4ZXGA 2MYGA 3CXGA 5G2ZA 4IJIA 1GLQA 5CAXA 3F3QA 2GS3A 1FHEA 4K6XA 2L4CA 4D73B 5HR3A 2HT9A 3KZQA 1XWBA 3RHBA 5B6MA 5C00A 4GSTA 2GSSA 3US3A 5JCGA 5J5NA 2IJYA 3ZL5A 3BBYA 4MZBA 1FB6A 5ELAA 4POMA 3ZZXA 4JU5A 2H6XA 5HR1A 4ID0A 1J08A 5KN3A 3EE2A 1R26A 3BCIA 3PGTA 1KTEA 2IMEA 2YJHA 4P3YB 3TJFA 3DGQA 3IRAA 3IK9A 2UZ8A 2WFCA 1OE8A 3HCZA 3O6TA 1DE1A 3CRTA 5ECQB 4QQ7A 1UC7A 3VWVA 3GSSA 5ECOB 3VWXA 1XW9A 1C72A 3IE3A 1T4ZA 5J4UA 1K0MA 3TOUA 4ECCA 5J9BA 3GTUA 2H6ZA 1Z6NA 1GNEA 3L78A 1TU7A 2B5YA 3PH9A 2IMDA 4N10A 2R2JA 4Q5NA 2PN8A 1V58A 4KSOA 1KNGA 2ES7A 1SENA 1Z6MA 2YWOA 2C80A 4MH3A 4PGTA 3D22A 3DVXA 1ZOFA 1XW6A 1DE2A 5AN1A 2B7KA 2KHPA 1QXHA 3CYNA 4DEJA 4ACSA 3EWLA 2M80A 4EDYA 3EURA 2AHEA 2ZUPA 3M9JA 4POLA 2VM1A 3MAKA 1GSSA 3UARA 4NWYA 14GSA 1YZXA 3QR6A 2IMIA 4EXJA 2PVQA 2YOIA 1V2AA 2H76A 3IDVA 2DMMA 4X1UA 2CX3A 4NV5A 5G30A 5DBQA 1SD9A 5EY6A 3HDCA 1A8LA 2GVPA 2CVKA 5HR0A 2VO4A 4F82A 3H93A 3C1SA 3UOMA 1XZOA 2PUKC 1G6WA 2L57A 3C7MA 3Q18A 1A2JA 3GSTA 4JEDA 7GSSA 3GX8A 4CW9A 4E8EA 3ZIVA 3GKXA 1JZWA 3TGZA 4MZWA 3GYKA 1O6JA 1YKAA 2H0HA 4WKWA 1NSWA 1W4VA 3A3TA 1NHOA 5ECSA 5IIZA 3F4RA 1XPVA 2DJKA 3PPUA 3GFKA 1Y25A 1F6MC 3CSJA 1UN2A 4MF7A 3LGCA 1BG5A 1H75A 4EF0A 2RIIA 2X99A 3HXSA 3FK8A 3GTUB 1YDKA 4FYCA 5CP1A 3VWWA 4MA9A 5DQYA 5DVBA 2LQQA 4MJEA 5IQYA 4IJ3A 1YEPA 2CZ2A 5KN2A 2H74A 5F06A 1ML6A 4PQIA 1GTBA 2KUCA 1OC9A 1YKCA 1A2MA 1TK8B 2VD1A 2GLRA 5ECKB 5G5EA 4WETA 3VPTA 1AQXA 4ILFA 3IC8A 4ULXA 4EC0A 5DJLA 5B8AA 2FGXA 3KH7A 5HFGA 2WDUA 1B9XC 2H6YA 4O92A 3FR9A 4EE0A 4GF0A 1R4WA 5GSTA 2O85A 1ZYQB 5IMAA 1PX7A 1ABAA 2Z9SA 3ZITA 3L0HA 5B7CA 3WGDA 2GQLA 1RK4A 2VOCA 3J7Yk 1IYHA 3IR4A 2P5RA 4ZB9A 1YF1A 1O85A 3VWUA 4HZ2A 2B1KA 4TR1A 2GSTA 2GSQA 3M8NA 5DALA 2YNXA 1NHYA 4JZQA 1E6BA 6GSWA 4NAXA 3NZNA 3F6DA 2I1UA 1MEKA 1TK5B 2J23A 4K2DA 4F9ZA 2HRKA 3HZ4A 3W8JA 4J57E 2VLUA 3F9UA 4XS6A 3RAZA 5EL8A 3TOTA 4OO4A 1Y6EA 4IS0A 4MPGA 1JZDA 3HVXA 2DJ0A 2RM6A 2B5XA 3TKQA 2XC2A 2XPDA 5GAPD 4IHUA 1B4PA 4QL7A 1O7UA 2VUPA 1G0TA 2MMAA 1SJIA 3H79A 2ON5A 2EIOA 2R37A 3G7YA 1OC9B 4GQCA 5IOWA 1HQOA 2FWGA 3FHKA 1WE0A 4H86A 3WD6A 3RBTA 2O87A 1QMVA 1QGVA 1PGTA 2WCIA 4O7HA 4TN8A 3GL3A 3F63A 1TKDB 4KNDA 3WYWA 5AGYA 2X8HA 3TKPA 3LEFA 1JHBA 4OFNA 4L0UA 3HJPA 2XPEA 3IBHA 3E0UA 3LSZA 1XWKA 2YV9A 2JZTA 1XFLA 3IAM2 3M1GA 2HSNB 2VIMA 1FO5A 1BQ7A 1YEXA 3HA9A 1F37A 1TJDA 5ECLB 4TR1B 5CRWA 5KN0A 5INYA 4V2LA 5DALB 2H66A 2REMA 2WRTA 1M2AA 2MMNA 5AIXA 4HS1A 2VCXA 3GKNA 1M0UA 3HKRA 1UVZA 20GSA 2WB9A 2MBTA 4TR4A 1GTAA 4RI7A 1F3BA 3F4TA 1YY7A 1N2AA 4PUAA 2FCHA 3UL3A 2L6CA 2HRKB 1GP1A 1K0AA 5EVOA 2I9HA 1B8XA 2HNLA 5HFIA 5G1LA 4KDUA 3EVIA 4TW5A 3VURA 1T1VA 4ML6A 3L4NA 3TDGA 2K8VA 4ZB8A 3RDWA 1GSUA 2L6DA 5J3RA 4V2MA 1VRSD 2OBKA 3Q19A 4ZB6A 3L9SA 1MTCA 2H19A 4KE3A 2RUFA 3F6FA 1SYRA 1HNCA 1M7TA 17GSA 2VCTA 3QAGA 1K3OA 2PERA 4G0IA 2KLXA 4KB3A 1ZL9A 2HSYA 3QAWA 1FG4A 2CT6A 3P8WA 3C71A 5CO3A 3D6IA 4N11A 4LMVA 5CRHA 3HJOA 6GSYA 1N8JA 1PKWA 5ECIB 2CAQA 3KH9A 2RUEA 1AW9A 3DMLA 2IFQA 4MK3A 3FKFA 4PTSA 2M46A 2V32A 5FHIA 3VI5A 3TRXA 1M2BA 4KH7A 1GH2A 2GQKA 1G6YA 3UIWA 2E2MA 4KUNA 1K0OA 1SYXA 3QDNA 5CRDA 4KDYA 4ZIJA 3GV1A 13GSA 5J9CA 3H8QA 4K7IA 1LJRA 3KGKA 3FZ4A 1U6TA 4FH8A 4G0KA 5G5FA 4AJ8A 1EWXA 5IMZA 1YQ1A 4IELA 4IQAA 1A23A 2IPAA 4I5QA 4V2NA 2CA8A 4LL1B 3HD5A 3IV4A 4J2FA 2A2SA 1A2LA 4OMVA 1BYEA 4HU7A 4LLRA 3KIJA 2F9SA 3VK9A 3KM6A 1SD8A 2HLSA 1WOUA 3SWLA 5B8BA 6GSUA 4F0CA 6GSSA 1AC1A 4MJBA 3I43A 2OADA 4OWYA 2E0QA 4OO5A 4X43A 4E8HA 1T7PB 5GZZB 1SKWB 1FVJA 3GRXA 3DVWA 4PURA 4XCSA 4KX4A 5ECMB 5KN1A 4J56E 2OA7A 5D73A 1EGOA 2C8UA 1EGRA 3FW2A 5COHA 4YH2A 2F8AA 1A8YA 2V6OA 3D4TA 4DSRA 1Z3EA 2HRFA 1X5EA 4KA0A 3KTBA 3KD0A 1GSEA 2IFQB 1SK1A 1O81A 3Q6OA 4L0WA 3ZLPA 2HFDA 2GSRA 1Z5YE 2GZPA 2X8CA 3EU3A 3WGXA 2FD3A 2PBJA 3AY8A 4HJMA 2DBCA 4K7NA 2ALBA 2AV4A 2B5EA 4LA1A 1S3AA 3OR5A 3L9UA 2HRAA 2K6VA 4DSSA 5HFKA 5HQPA 2L4QA 1WWJA 1T00A 1VF4A 4TXVA 4Z7XA 3QMXA 3Q74A 3GL5A 4MDCA 2CVDA 3A2WA 4EDZA 3UJ1A 3KXOA 3QD9A 3CSHA 2C3TA 1V9WA 4PNFA 3FZ9A 2HRNA 3KEBA 3TKRA 1Z9HA 2H73A 3QCPA 4K0NA 1DBYA 4N0ZA 2L5LA 4ECBA 16GSA 2JZSA 3CMIA 4WR4A 5A4VA 1MDKA 3QFAC 2DMLA 4O5RA 1PKZA 2LSTA 1HNBA 1SKRB 2MMOA 5CYYA 1ON4A 4I8BA 3TKSC 1GTUA 1GUHA 2IN3A 4KGIA 5G1KA 1OE7A 2K8SA 1GULA 4YQVA 2WGRA 4WBJA 2YP6A 2C3QA 1U87A 2C4JA 5AIVA 3ZVJA 3F8UA 4MABA 4BVYA 4BL7A 6GSVA 5D9WA 4LL4B 3ZRDA 1XXUA 2HZEA 4I97A 4F2IA 2GZYA 5IMCA 4JBBA 3S9FA 2VM2A 5E59A 1EOGA 2OE0A 4HDEA 3ZVJD 4G2EA 3P7XA 4GCIA 2NPBA 3UBLA 5IPHA 1THOA 3P90A 3HYPA 2L5OA 2IMKA 2VL2C 4JE1A 4KW6A 2X8GA 4YQUA 1O73A 1EZKA 10GSA 2JZRA 1K3LA 3LFLA 4DSSB 4MPFA 4IKHA 5IO0A 1URMA 2TRCP 2JU5A 3K8NA 2JSZA 4YAPA 4QL9A 2LS5A 1ERVA 2H75A 3J7Yb 2JL4A 5DCHA 4WBRD 2VCVA 4PXOA 3TUEA 2CX4A 4N30A 1T4YA 3IA1A 1F3AA 3LYKA 2QKEA 4G9HA 1RW1A 2QC7A 2LRNA 4KF9A 2LNTA 3DKSA 5CREA 1NM3A 3CTGA 1GTIA 2GQMA 4AF2A 2C0DA 2P31A 4ZL9A 3IK7A 1IYIA 2YWNA 2PPTA 2GT6A 2C0GA 1TDIA 1S3DA 1PQNA 1MDIA 3LG6A 5BMUA 3GKKA 2H0IA 3A5WA 5HR2A 1SJZA 1M9AA 1PL1A 2FA8A 5JCWA 1K3YA 1UA5A 1TI3A 3ZMLA 3HZ8A 1GWCA 4XTSA 5D9XA 2IWTA 1QQ2A 3GHAA 5JWOB 4BVYB 4BL7B 1FAAA 2NTOA 2HZEB 2YJ7A 3IOSA 1YJ6A 4L5LA 1AQVA 3TB2A 2OKAA 3APOA 1EP7A 4WF5A 4AGSA 2HYXA 2H30A 3V1WA 2PVOC 3MDKA 4JRRA 5IO2A 5D96A 1H4OA 5D8IA 22GSA 4ECJA 1ERTA 2O89A 2HE3A 1RQMA 1PD21 2G2QA 4CDOA 3RHCA 1V98A 1K0NA 4K0GA 3VI7A 3M0FA 2GGTA 3G7JA 2O7KA 1W89A 4NHWA 2F51A 1SK0A 3PR8A 4Q5RA 4EUYA 1EV9A 3DWVA 2VLVA 1LBKA 3IXRA 4MH2A 1WRYA 2EIRA 2GZZA 1A24A 1EP8A 2LEGA 3FZAA 4JR4A 2J9HA 2R5GA 4OCFA 4GQFA 1SL2B 2DIYA 1WIKA 4FYBA 3KCMA 1EEJA 2HSMA 5F05A 5ECHB 5JCUA 4BPYA 3KMNA 2P5QA 4XS4A 1TRVA 1B48A 5ABRA 3FR3A 1OKTA 2DJJA 4EKZA 2DLXA 2VL9A 1AIUA 1K0DA 3ME8A 2QGVA 3RPNA 2CV4A 1XCCA 3TRQA 4KAEA 1MDJA 4NMUA 2AJQB 2LUSA 4G10A 1O8XA 4GSSA 1XOAA 4MMMA 6GSXA 1Q98A 4NXIA 4NHZA 3ZIJA 4TR3A 3GKMA 2IMFA 3TCOA 1WP0A 2KOKA 4K7OA 2FNOA 1V57A 3APSA 3O76A 4ISDA 4MF5A 2HZFA 2KP2A 2OE1A 3D4MA 3UVTA 1GSFA 1X9MB 4TR0A 4TKYA 1V40A 3ERGA 1QUWA 5IMDA 2TRXA 3P2AA 1J0FA 1J9BA 4IVFA 4PQ1A 3TJKA 1VGLA 2NDOA 4KCAA 1X9WB 3IHQA 11GSA 4MJCA 1G7OA 3C8EA 5ELGA 3DD3A 3ISOA 3WT2A 2LKUA 5JWQB 4GSNA 4ZBAA 4HEA2 4ZBBA 2A4VA 5D9VA 4MZCA 1TI1A 1ZYEA 4AJ6A 1DSBA 1PMTA 1TTZA 2I3YA 1I5GA 3I9V2 5DAKA 2HSMB 2GT5A 2M72A 4PQHA 4K8MA 1T3BA 3BCKA 1JFUA 2YZUA 1KBNA 3L9VA 5DCGA 2KP1A 3ERWA 4MCUA 4XS4B 4GLTA 1AXDA 1WMJA 2H1GA 5B6NA 2OACA 1MD3A 3F0IA 3GNJA 3FZ5A 3BD2A 1ZZYA 3HY2A 1GLPA 1U88A 4TXOA 4Q5QA 5KEJA 4G0LA 4POKA 3QAVA 5DJMA 1OAZA 1JLVA 2N5BA 3GURA 4TOPA 4POBA 1F2EA 5ECPB 3F4SA 4BA7A 2JADA 2C0EA 2F8FA 3MSZA 4GWRA 2CVBA 4IGJA 3UBKA 2VCWA 3N5OA 1NW2A 3FY7A 5LD0A 5A5KA 3DYRA 3VFIA 2YPMA 1G7EA 2C3NA 1YF0A 1X9SB 3LJRA 2H0GA 2WZ9A 3IC4A 3ED3A 5CNWA 1ZGNA 4MF6A 2VAFA 3WT1A 1OYJA 4IBPA 2V41A 5A4UA 1SL1B 1XVQA 2DC5A 2AYTA 3CSIA 1HD2A 1ZMAA 2H1AA 4BVXA 1SU9A 4WR5A 2VCZA 2E2GA 4IN0A 3KJYA 4IQ1A 2LNSA 2K18A 3DEXA 4EVMA 1R7HA 3ME7A 2VD0A 5C04A 18GSA 4RI6A 2R3XA 4TVEA 1EOHA 2I4AA 1M2DA 1PSQA 1XVWA 1USBA 4L8EA 1HYUA 2C1YA 1PA3A 4PUFC 1XW5A 4MLYA 2OJLA 5FT3A 5DAKB 2AAWA 3R2QA 4FIWA 5G31A 1X5CA 2NVLA 4ZBDA 2PGTA 4ZILA 3LXZA 3LWAA 4HQSA 1R5PA 3DIEA 1ERWA 1PL2A 3UVHA 4V1Ag 1WPIA 1Z7RA 3TRPA 4TXOB 5ECNB 3H4KA 1AAZA 2K9FA 4LMWA 3GA4A 5IM9A 2IL3A 1M99A 3CBUA 1GSQA 1F9MA 3KTLA 4YQMA 3GH9A 1PX6A 4MJAA 2LQOA 2H71A 4I6XA 4YAVA 2YWMA 3TJBA 1X5DA 4WEYA 5ID2A 3UAPA 3A2XA 3EC3A 1VF2A 3IAS2 2PMTA 4HUAA 2G0FA 1FOVA 5DQSA 2QSIA 1JLWA 1TRWA 3W8SA 5IPGA 1B4QA 3KMOA 4O32A 2LV3A 2YCDA 1AQWA 3CTFA 2VL3A 1JZRA 1TU8A 3N9JA 2YZHA 5D9TA 3C1RA 4BVXB 1TK0B 3LORA 2MBSA 3ZFBA 2B3SA 1GUMA 4FYUA 5FWGA 4IW9A 3HVSA 3W6GA 3FR6A 4KSMA 2BTOT 4IP6A 1ST9A 1SKSB 4RQRA 4FO5A 4L5OA 2XBQA 12GSA 4V1Ap 1K0CA 2D2ZA 1XBSA
chains in the Genus database with same CATH superfamily
4KCEA 3F3RA 4K5RA 5IOXA 3ZREA 1OC8A 2B1LA 2CQ9A 1GUKA 2XBIA 3ZTLA 2H1BA 2HSHA 3FRCA 5IMFA 2WS2A 4OFTA 5ECRB 3O3TA 2FWFA 2P0GA 5F0GA 1O8WA 2B6MA 1U3IA 4HQZA 5A34A 1WJKA 4TRXA 3GH6A 1XOBA 1BEDA 2BMXA 1Z7PA 1OVNA 3LXTA 3ZMKA 1Q4JA 3MWHA 2DIZA 4HU9A 1TP9A 1SL0B 3M9KA 2BJXA 5D93A 3TKSE 4I2TA 9GSSA 4AJ7A 4X0XA 3LYPA 2ON7A 1ERUA 2EIQA 2N5FA 2O8VB 1PRXA 2HXKA 2MZCA 4EO3A 5ID2B 3H1NA 3GX0A 1PFOA 1JZOA 3A5IA 2DSAA 2LJRA 4N3ZA 2V1MA 3DXBA 4N0VA 5F07A 3M3MA 1S3RA 2RLIA 3R3EA 2JACA 2B7JA 1M9BA 2QA2A 4OD7A 3APQA 3C73A 2GDRA 2WJUA 2V2GA 3VPQA 2VLTA 2H70A 2X64A 2ZCTA 3JCML 1GSYA 4FXYP 1VF3A 3ZFLA 3TJJA 4BIKA 4HI7A 3ZYWA 2OE3A 1LU4A 3FYGA 1XWGA 1SJ6A 5KOXA 3VLNA 4HJ2A 5CRGA 3RPPA 5LCZA 2JSYA 1GSDA 4RQXA 4K1FA 5L71A 1CQGA 3UMAA 4ZL8A 2LRCA 2AUVA 3MYDA 2FY6A 3NIVA 1XWAA 1PN9A 3EINA 4BWQA 4HZ4A 2HI7A 1OKDA 2DJ1A 1ACVA 3GUSA 1U3AA 2H8LA 5EPFA 2WVZA 3A2VA 2LJKA 3G7IA 4G19A 2YN1A 1QK8A 3NOFA 5A34B 3BJ5A 4EL1A 4ZL7A 1T8EB 2FWEA 1X0RA 8GSSA 3IPZA 2DJ3A 3E9JB 1A0RP 4XRAA 1EV4A 2LRTA 4XHMA 2TIRA 3EMXA 1S3CA 5H5QA 2LJAA 1CQHA 2GTUA 3TKSA 2CAIA 2FA4A 2H01A 2N5AA 1GNWA 4WXTA 1I9DA 2A2RA 1GL8A 3U6VA 2V6KA 3PINA 2H72A 4XRDA 3GMFA 5GSSA 3CRUA 2C0FA 4WF4A 1B9YC 2YANA 3ERFA 2IIYA 2FWHA 4I2UA 4XIHA 3FEUA 4G01A 4PI2C 2VCQA 2XHFA 2VKZG 2NBSA 3KP8A 3EU4A 1N25A 4MP4A 4Q5FA 3TJGA 3E3EA 4FQUA 1BG1A 5E4WA 1BX9A 4CHSA 5F8BA 4PNGA 2PWJA 4D73A 4DSQA 2VL2A 4PX1A 3HHVA 1TXXA 5ENUA 4OFMA 2ZNMA 2EC4A 3GN3A 4BWSA 1FB0A 2DJ2A 1OC3A 3MNGA 2YV7A 4EIPA 3KP9A 5JWRB 3QPMA 6GSTA 4HOJA 3HVVA 4NPBA 3BOAA 3D5JA 4F0BA 1XWCA 1TW9A 5J41A 2L59A 5GAND 4IP1A 1GRXA 1KEBA 4Z2RA 1ZCPA 1SK2A 3DRNA 1AUCA 1THXA 4Z2TA 5A4WA 1TOFA 4KDXA 4OCEA 3I69A 3EYTA 3HVNA 4K9ZA 3QOUA 4DVCA 1DUGA 5IMVA 1TRSA 4RUVA 1K0BA 19GSA 1FVKA 2YWIA 1E2YA 4F03A 1A0FA 5LNKe 3EMPA 3D21A 4GXZA 1ILOA 3U5RE 2AB6A 2F3MA 1MD4A 2OBIA 5H5SA 3HJMA 2A2PA 1HNAA 2FLSA 4YKGA 3SBCA 4AI6A 2MMZA 1BJXA 2FHEA 1EEMA 2E7PA 2FUG2 1XIYA 4USSA 3GIXA 3LQ7A 2I81A 2CZ3A 3QFBC 3I6AA 2WULA 4XS1A 2H1DA 2HQTA 3WGEA 4ECIA 2R4VA 5AISA 1VF1A 4ML1A 5DDLA 2PU9C 1FW1A 4GRFA 3UEMA 1BAYA 2LTKA 1TRUA 5H5RA 3G9BA 4GTUA 3D0ZA 1R5AA 3LW9A 4JR6A 1QFNA 2RM5A 2R6KA 4NV2A 4ZXGA 2MYGA 3CXGA 5G2ZA 4IJIA 1GLQA 5CAXA 3F3QA 2GS3A 1FHEA 4K6XA 2L4CA 1TXUA 4D73B 5HR3A 2HT9A 3KZQA 5J4VA 1XWBA 4O5UA 3RHBA 5B6MA 5C00A 4GSTA 2GSSA 3US3A 5JCGA 5J5NA 2IJYA 3ZL5A 3BBYA 4MZBA 1FB6A 5ELAA 4POMA 3ZZXA 4JU5A 2H6XA 5HR1A 5KOWA 4ID0A 1J08A 5KN3A 3EE2A 1R26A 3BCIA 3PGTA 1KTEA 2IMEA 2YJHA 4P3YB 3TJFA 3DGQA 4A5PA 3IRAA 3IK9A 2UZ8A 2WFCA 1OE8A 3HCZA 3O6TA 1DE1A 3CRTA 5ECQB 4ICYA 4QQ7A 1UC7A 3VWVA 3GSSA 5ECOB 3VWXA 1XW9A 1C72A 1I1IP 3IE3A 1T4ZA 5J4UA 1K0MA 3TOUA 4ECCA 5J9BA 3GTUA 2H6ZA 1Z6NA 1GNEA 3L78A 1TU7A 2B5YA 3PH9A 2IMDA 4N10A 2R2JA 4Q5NA 2PN8A 1V58A 4KSOA 1KNGA 2ES7A 1SENA 1Z6MA 2YWOA 3CQFA 2C80A 4MH3A 4PGTA 3D22A 3DVXA 1ZOFA 1XW6A 1DE2A 5AN1A 2B7KA 2KHPA 1QXHA 3CYNA 4DEJA 4ACSA 3EWLA 2M80A 4EDYA 3EURA 2AHEA 2ZUPA 3M9JA 4POLA 2VM1A 3MAKA 1GSSA 3UARA 4NWYA 14GSA 1YZXA 3QR6A 2IMIA 4EXJA 2PVQA 2YOIA 1V2AA 2H76A 3IDVA 4ZB7A 2DMMA 4X1UA 2CX3A 4NV5A 5G30A 5DBQA 1SD9A 5EY6A 3HDCA 1A8LA 2GVPA 2CVKA 5HR0A 2VO4A 4F82A 3H93A 3C1SA 3UOMA 1XZOA 2PUKC 1G6WA 2L57A 3C7MA 3Q18A 1Y1UA 1A2JA 3GSTA 4JEDA 7GSSA 3GX8A 4CW9A 4E8EA 3ZIVA 3GKXA 1JZWA 3TGZA 4MZWA 3GYKA 1O6JA 1YKAA 2H0HA 4WKWA 1NSWA 1W4VA 3A3TA 1NHOA 5ECSA 5IIZA 2WW2A 3F4RA 1XPVA 2DJKA 3PPUA 3GFKA 1Y25A 1F6MC 3CSJA 1UN2A 4MF7A 3LGCA 1BG5A 1H75A 4EF0A 2RIIA 2X99A 3HXSA 3FK8A 3GTUB 1YDKA 4FYCA 5CP1A 3VWWA 4MA9A 5DQYA 5DVBA 2LQQA 4MJEA 5IQYA 4IJ3A 1YEPA 2CZ2A 5KN2A 2H74A 5F06A 1ML6A 4AKGA 4PQIA 1GTBA 2KUCA 1OC9A 1YKCA 2WZSA 1A2MA 1TK8B 2VD1A 2GLRA 5ECKB 5G5EA 4WETA 3VPTA 1AQXA 4ILFA 3IC8A 4ULXA 4EC0A 5DJLA 5B8AA 2FGXA 3KH7A 5HFGA 2WDUA 1B9XC 2H6YA 4O92A 3FR9A 4EE0A 4GF0A 1R4WA 5GSTA 2O85A 1ZYQB 5IMAA 1PX7A 1ABAA 2Z9SA 3ZITA 3L0HA 5B7CA 3WGDA 2GQLA 1RK4A 2VOCA 2HSNA 3J7Yk 1IYHA 3IR4A 2P5RA 4ZB9A 1YF1A 1O85A 3VWUA 4HZ2A 2B1KA 2X4AA 4TR1A 2GSTA 2GSQA 3M8NA 5DALA 2YNXA 1NHYA 1XG8A 4JZQA 1E6BA 6GSWA 4NAXA 3NZNA 3F6DA 2I1UA 1MEKA 1TK5B 2J23A 4K2DA 4F9ZA 2HRKA 3HZ4A 3W8JA 4J57E 2VLUA 3F9UA 4XS6A 3RAZA 5EL8A 1S4BP 3TOTA 4OO4A 1Y6EA 4IS0A 4MPGA 1JZDA 3TU3B 3HVXA 2DJ0A 2RM6A 2B5XA 3TKQA 4PHZC 2XC2A 2XPDA 5GAPD 4IHUA 1B4PA 4QL7A 4W66A 1O7UA 2VUPA 1G0TA 2MMAA 1SJIA 3H79A 2ON5A 2EIOA 2R37A 3G7YA 1OC9B 4GQCA 5IOWA 2DKIA 1HQOA 2FWGA 3FHKA 1WE0A 4H86A 3WD6A 3RBTA 2O87A 1SVOA 1QMVA 1QGVA 1PGTA 2WCIA 4O7HA 4TN8A 3GL3A 3F63A 1TKDB 4KNDA 3WYWA 5AGYA 2X8HA 3TKPA 3LEFA 1JHBA 4OFNA 1YEWC 4L0UA 3HJPA 2XPEA 3IBHA 3E0UA 3LSZA 1XWKA 2YV9A 2JZTA 1XFLA 3IAM2 3M1GA 2HSNB 2VIMA 1FO5A 1BQ7A 1YEXA 3HA9A 1F37A 1TJDA 5ECLB 4TR1B 5CRWA 5KN0A 5INYA 4V2LA 5DALB 2H66A 2REMA 2WRTA 1M2AA 2MMNA 5AIXA 4HS1A 2VCXA 3GKNA 1M0UA 3HKRA 1UVZA 20GSA 2WB9A 2MBTA 4TR4A 1GTAA 4RI7A 1F3BA 3F4TA 1YY7A 1N2AA 4PUAA 2FCHA 3UL3A 2L6CA 2HRKB 1GP1A 1K0AA 5EVOA 2I9HA 3MIXA 1B8XA 2HNLA 5HFIA 5G1LA 5BRTA 4KDUA 2WW0A 3EVIA 4TW5A 3VURA 1T1VA 4ML6A 3L4NA 3TDGA 2K8VA 4ZB8A 3RDWA 1GSUA 2L6DA 5J3RA 4V2MA 1VRSD 2OBKA 2A4HA 3Q19A 4ZB6A 3L9SA 1MTCA 2H19A 4KE3A 2RUFA 5J47A 3F6FA 4E68A 1SYRA 1HNCA 1M7TA 17GSA 2VCTA 3QAGA 1K3OA 2PERA 4G0IA 2KLXA 4KB3A 1ZL9A 2HSYA 3QAWA 1FG4A 2CT6A 3P8WA 3C71A 5CO3A 3D6IA 3CWGA 4N11A 4LMVA 5CRHA 3HJOA 6GSYA 1N8JA 1PKWA 5ECIB 2CAQA 3KH9A 2RUEA 1AW9A 3DMLA 2EFEA 2IFQA 4MK3A 3FKFA 4PTSA 1FOHA 2M46A 2V32A 5FHIA 3VI5A 3TRXA 1M2BA 4KH7A 1GH2A 2GQKA 1G6YA 3UIWA 2E2MA 4KUNA 1K0OA 1SYXA 3QDNA 5CRDA 4KDYA 4ZIJA 3GV1A 13GSA 5J9CA 3H8QA 4K7IA 1LJRA 3KGKA 3FZ4A 1U6TA 4FH8A 4G0KA 2H1LA 5G5FA 4AJ8A 2WVXA 1ZYNA 1EWXA 5IMZA 1YQ1A 4IELA 4IQAA 1A23A 2IPAA 4I5QA 2EFCA 4V2NA 2CA8A 4LL1B 3HD5A 3IV4A 4J2FA 2A2SA 1A2LA 4OMVA 4K2XA 1BYEA 4HU7A 4LLRA 3KIJA 2F9SA 3VK9A 3KM6A 1SD8A 2HLSA 1WOUA 3SWLA 5B8BA 6GSUA 4F0CA 6GSSA 5J4YA 1AC1A 4MJBA 3I43A 2OADA 4OWYA 2E0QA 4OO5A 4X43A 4E8HA 1T7PB 5GZZB 1SKWB 1FVJA 3GRXA 3DVWA 3EPTA 4YKFA 4PURA 4XCSA 4KX4A 5ECMB 5KN1A 4J56E 2OA7A 5D73A 1EGOA 2C8UA 1EGRA 3FW2A 5COHA 4YH2A 2F8AA 1A8YA 2V6OA 3D4TA 4DSRA 1Z3EA 2HRFA 1X5EA 4KA0A 3KTBA 3KD0A 1GSEA 2IFQB 1M3JA 1SK1A 1O81A 3Q6OA 4L0WA 3ZLPA 2HFDA 2GSRA 1Z5YE 2GZPA 4AKIA 4AKXB 2X8CA 3EU3A 3WGXA 2FD3A 2PBJA 3AY8A 4HJMA 2DBCA 4K7NA 2ALBA 2AV4A 2B5EA 4LA1A 1S3AA 3OR5A 5J40A 3L9UA 2HRAA 2K6VA 4DSSA 5HFKA 5HQPA 2L4QA 1WWJA 1T00A 1VF4A 4TXVA 4Z7XA 3QMXA 3Q74A 2DKHA 3GL5A 4EIQA 4MDCA 2CVDA 3A2WA 4EDZA 2WVXB 3UJ1A 3KXOA 3QD9A 3CSHA 2C3TA 1V9WA 4PNFA 3FZ9A 2HRNA 3KEBA 3TKRA 1Z9HA 2H73A 3QCPA 4K0NA 1DBYA 4N0ZA 2L5LA 4ECBA 16GSA 2JZSA 3CMIA 1M3IA 4WR4A 5A4VA 1MDKA 3QFAC 2DMLA 1SVMA 4O5RA 1PKZA 2LSTA 1HNBA 1SKRB 2MMOA 5CYYA 1ON4A 4I8BA 3TKSC 1GTUA 1GUHA 2IN3A 4KGIA 5G1KA 1OE7A 2K8SA 1GULA 4YQVA 1YVLA 2WGRA 4WBJA 2YP6A 2C3QA 1U87A 2C4JA 5AIVA 3ZVJA 3F8UA 4MABA 4BVYA 4BL7A 6GSVA 5D9WA 4LL4B 3ZRDA 1XXUA 2HZEA 4I97A 4F2IA 2GZYA 5IMCA 4JBBA 3S9FA 2VM2A 2EFDA 3RFRC 5E59A 1EOGA 2OE0A 4HDEA 3ZVJD 4G2EA 3P7XA 4GCIA 2NPBA 3UBLA 5IPHA 1THOA 3P90A 3HYPA 2L5OA 2IMKA 2VL2C 4JE1A 4KW6A 2X8GA 4YQUA 1O73A 1EZKA 10GSA 2JZRA 1K3LA 3LFLA 4DSSB 4MPFA 4IKHA 5IO0A 1URMA 2TRCP 2JU5A 3K8NA 2JSZA 4YAPA 4QL9A 2LS5A 1ERVA 2H75A 3J7Yb 2JL4A 5DCHA 4WBRD 2VCVA 4PXOA 3TUEA 2CX4A 4N30A 1T4YA 3IA1A 2O3EA 1F3AA 3LYKA 4Z2UA 2QKEA 4G9HA 1RW1A 2QC7A 2EFHA 2LRNA 4KF9A 2LNTA 3DKSA 5CREA 1NM3A 2R0CA 3CTGA 1GTIA 2GQMA 4AF2A 2C0DA 2P31A 4ZL9A 3IK7A 1IYIA 2YWNA 2O5VA 2PPTA 2GT6A 2C0GA 1TDIA 1S3DA 2O36A 1PQNA 1MDIA 3LG6A 5BMUA 3GKKA 2H0IA 3A5WA 5HR2A 1PN0A 1SJZA 1M9AA 1PL1A 2FA8A 5JCWA 1K3YA 1UA5A 1TI3A 3ZMLA 3HZ8A 1GWCA 4XTSA 5D9XA 2IWTA 1QQ2A 3GHAA 5JWOB 4BVYB 4BL7B 1FAAA 2NTOA 2HZEB 2YJ7A 3IOSA 1YJ6A 4L5LA 1AQVA 3TB2A 2OKAA 3APOA 1EP7A 4WF5A 4AGSA 4MNNA 2HYXA 2H30A 3V1WA 2PVOC 3MDKA 4JRRA 5IO2A 5D96A 1H4OA 5D8IA 22GSA 4GDFA 4ECJA 1ERTA 2O89A 2HE3A 1RQMA 1PD21 2G2QA 4CDOA 3RHCA 1V98A 1K0NA 4K0GA 3VI7A 3M0FA 2GGTA 3G7JA 2O7KA 1W89A 4NHWA 2F51A 1SK0A 3PR8A 4Q5RA 4EUYA 1EV9A 3DWVA 2VLVA 1LBKA 3IXRA 4MH2A 1WRYA 2EIRA 2GZZA 1A24A 1EP8A 2LEGA 3FZAA 4JR4A 2J9HA 2R5GA 4OCFA 4GQFA 1SL2B 2UV8G 2DIYA 1WIKA 1SVLA 4FYBA 3KCMA 1EEJA 2HSMA 5F05A 5ECHB 5JCUA 4BPYA 3KMNA 2P5QA 4XS4A 1TRVA 5BMUB 1B48A 5ABRA 3FR3A 2R0PA 5A1NA 1OKTA 2DJJA 4EKZA 2DLXA 2VL9A 1AIUA 1K0DA 3IHGA 3ME8A 2QGVA 3RPNA 2CV4A 1XCCA 3TRQA 4KAEA 1MDJA 4NMUA 2AJQB 2LUSA 4G10A 2R0GA 4PI0C 1O8XA 2WW1A 4GSSA 1XOAA 4MMMA 6GSXA 1Q98A 4NXIA 4NHZA 3ZIJA 4TR3A 3GKMA 2IMFA 3TCOA 1WP0A 2KOKA 4K7OA 2FNOA 3RGBC 1V57A 3APSA 3O76A 4ISDA 4MF5A 2HZFA 5A5HA 2KP2A 2OE1A 3D4MA 3UVTA 1GSFA 1X9MB 4TR0A 4TKYA 1V40A 3ERGA 1QUWA 5IMDA 2TRXA 3P2AA 1J0FA 1J9BA 4IVFA 4PQ1A 3TJKA 1VGLA 2NDOA 4KCAA 1X9WB 3IHQA 11GSA 4MJCA 1G7OA 3C8EA 5ELGA 3DD3A 3ISOA 3WT2A 2LKUA 5JWQB 4GSNA 4ZBAA 4HEA2 4ZBBA 2A4VA 5D9VA 2QA1A 4MZCA 1TI1A 1ZYEA 4AJ6A 1DSBA 1PMTA 1TTZA 2I3YA 1I5GA 3I9V2 5DAKA 2HSMB 2GT5A 2M72A 4PQHA 1T3BA 3BCKA 4K8MA 1JFUA 2YZUA 1KBNA 3L9VA 5DCGA 2KP1A 3ERWA 4MCUA 4XS4B 4GLTA 1AXDA 1WMJA 2H1GA 5B6NA 5A1NB 2OACA 1MD3A 3F0IA 3GNJA 3FZ5A 3BD2A 1ZZYA 3HY2A 4AKHA 1GLPA 1U88A 4TXOA 4Q5QA 5KEJA 2WVYA 4G0LA 4POKA 3QAVA 5DJMA 2WW3A 1OAZA 1JLVA 2N5BA 3GURA 4TOPA 4POBA 1F2EA 2X49A 3F4SA 5ECPB 1ZYPA 2JADA 4BA7A 2C0EA 2F8FA 3MSZA 4GWRA 2CVBA 4IGJA 3UBKA 2VCWA 3N5OA 5A5HB 1NW2A 3FY7A 5LD0A 5A5KA 3DYRA 3VFIA 2YPMA 1G7EA 2C3NA 1YF0A 1X9SB 3LJRA 2H0GA 2WZ9A 3IC4A 3ED3A 5CNWA 1ZGNA 4MF6A 2VAFA 3WT1A 1OYJA 4IBPA 2V41A 5A4UA 1SL1B 1XVQA 2DC5A 2AYTA 3CSIA 1HD2A 1ZMAA 2OT3A 2H1AA 4BVXA 1SU9A 4WR5A 2VCZA 2E2GA 4IN0A 4O5QA 3KJYA 4IQ1A 2LNSA 2K18A 3DEXA 4EVMA 1R7HA 3ME7A 2VD0A 5C04A 18GSA 4RI6A 2R3XA 4TVEA 1EOHA 2I4AA 1M2DA 1PSQA 1XVWA 1USBA 4X4JA 4L8EA 1HYUA 2C1YA 1PA3A 4PUFC 1XW5A 4MLYA 2OJLA 5FT3A 5DAKB 2AAWA 3R2QA 4FIWA 4CY8A 5G31A 1X5CA 2NVLA 4ZBDA 4HSCX 2PGTA 4ZILA 3LXZA 3LWAA 4HQSA 1R5PA 3DIEA 1ERWA 3FMWA 1PL2A 3UVHA 4V1Ag 1WPIA 1Z7RA 3TRPA 4TXOB 5ECNB 3H4KA 1AAZA 2K9FA 4LMWA 3GA4A 5IM9A 2IL3A 1M99A 3CBUA 1GSQA 1F9MA 3KTLA 4YQMA 1BF5A 3GH9A 1PX6A 4MJAA 2LQOA 2H71A 4I6XA 4YAVA 2YWMA 3TJBA 1X5DA 4WEYA 5ID2A 3UAPA 3A2XA 3EC3A 1VF2A 3IAS2 2PMTA 4HUAA 2G0FA 1FOVA 5DQSA 2QSIA 1JLWA 4QMKA 3W8SA 1TRWA 5IPGA 1B4QA 3KMOA 4CY6A 4K5SA 4O32A 2LV3A 2YCDA 1AQWA 3CTFA 2VL3A 1JZRA 3CHXC 1TU8A 3N9JA 2YZHA 5D9TA 3C1RA 4BVXB 1TK0B 3LORA 2MBSA 3HMJG 3ZFBA 2B3SA 1GUMA 4FYUA 5FWGA 4IW9A 3HVSA 3W6GA 3FR6A 4KSMA 2BTOT 4IP6A 1ST9A 1SKSB 4RQRA 4FO5A 4L5OA 2XBQA 12GSA 4V1Ap 1K0CA 2D2ZA 1XBSA
chains in the Genus database with same CATH topology
4KCEA 3F3RA 4K5RA 5IOXA 3ZREA 1OC8A 2B1LA 2CQ9A 1GUKA 2XBIA 3ZTLA 2H1BA 2HSHA 3FRCA 5IMFA 2WS2A 4OFTA 5ECRB 3O3TA 2FWFA 2P0GA 5F0GA 1O8WA 2B6MA 1U3IA 4HQZA 5A34A 1WJKA 4TRXA 3GH6A 1XOBA 1BEDA 2BMXA 1Z7PA 1OVNA 3LXTA 3ZMKA 1Q4JA 3MWHA 2DIZA 4HU9A 1TP9A 1SL0B 3M9KA 2BJXA 5D93A 3TKSE 4I2TA 9GSSA 4AJ7A 4X0XA 3LYPA 2ON7A 1ERUA 2EIQA 2N5FA 2O8VB 1PRXA 2HXKA 2MZCA 4EO3A 5ID2B 3H1NA 3GX0A 1JZOA 3A5IA 2DSAA 2LJRA 4N3ZA 2V1MA 3DXBA 4N0VA 5F07A 3M3MA 2RLIA 3R3EA 2JACA 2B7JA 1M9BA 2QA2A 4OD7A 3APQA 3C73A 2GDRA 2WJUA 2V2GA 3VPQA 2VLTA 2H70A 2X64A 2ZCTA 3JCML 1GSYA 1VF3A 3ZFLA 3TJJA 4HI7A 3ZYWA 2OE3A 1LU4A 3FYGA 1XWGA 1SJ6A 5KOXA 3VLNA 4HJ2A 5CRGA 3RPPA 5LCZA 2JSYA 1GSDA 4RQXA 4K1FA 5L71A 1CQGA 3UMAA 4ZL8A 2LRCA 2AUVA 3MYDA 2FY6A 3NIVA 1XWAA 1PN9A 3EINA 4BWQA 4HZ4A 2HI7A 1OKDA 2DJ1A 1ACVA 3GUSA 1U3AA 2H8LA 5EPFA 3A2VA 2LJKA 3G7IA 4G19A 2YN1A 1QK8A 3NOFA 5A34B 3BJ5A 4EL1A 4ZL7A 1T8EB 2FWEA 1X0RA 8GSSA 3IPZA 2DJ3A 3E9JB 1A0RP 4XRAA 1EV4A 2LRTA 4XHMA 2TIRA 3EMXA 1S3CA 5H5QA 2LJAA 1CQHA 2GTUA 3TKSA 2CAIA 2FA4A 2H01A 2N5AA 1GNWA 4WXTA 1I9DA 2A2RA 1GL8A 3U6VA 2V6KA 3PINA 2H72A 4XRDA 3GMFA 5GSSA 3CRUA 2C0FA 4WF4A 1B9YC 2YANA 3ERFA 2IIYA 2FWHA 4I2UA 4XIHA 3FEUA 4G01A 2VCQA 2XHFA 2VKZG 2NBSA 3KP8A 3EU4A 1N25A 4MP4A 4Q5FA 3TJGA 3E3EA 4FQUA 1BG1A 5E4WA 1BX9A 4CHSA 5F8BA 4PNGA 2PWJA 4D73A 4DSQA 2VL2A 4PX1A 3HHVA 1TXXA 5ENUA 4OFMA 2ZNMA 2EC4A 3GN3A 4BWSA 1FB0A 2DJ2A 1OC3A 3MNGA 2YV7A 4EIPA 3KP9A 5JWRB 3QPMA 6GSTA 4HOJA 3HVVA 4NPBA 3BOAA 3D5JA 4F0BA 1XWCA 1TW9A 5J41A 2L59A 5GAND 4IP1A 1GRXA 1KEBA 4Z2RA 1ZCPA 1SK2A 3DRNA 1AUCA 1THXA 4Z2TA 5A4WA 1TOFA 4KDXA 4OCEA 3I69A 3EYTA 4K9ZA 3QOUA 4DVCA 1DUGA 5IMVA 1TRSA 4RUVA 1K0BA 19GSA 1FVKA 2YWIA 1E2YA 4F03A 1A0FA 5LNKe 3EMPA 3D21A 4GXZA 1ILOA 3U5RE 2AB6A 2F3MA 1MD4A 2OBIA 5H5SA 3HJMA 2A2PA 1HNAA 2FLSA 4YKGA 3SBCA 4AI6A 2MMZA 1BJXA 2FHEA 1EEMA 2E7PA 2FUG2 1XIYA 4USSA 3GIXA 3LQ7A 2I81A 2CZ3A 3QFBC 3I6AA 2WULA 4XS1A 2H1DA 2HQTA 3WGEA 4ECIA 2R4VA 5AISA 1VF1A 4ML1A 5DDLA 2PU9C 1FW1A 4GRFA 3UEMA 1BAYA 2LTKA 1TRUA 5H5RA 3G9BA 4GTUA 3D0ZA 1R5AA 3LW9A 4JR6A 1QFNA 2RM5A 2R6KA 4NV2A 4ZXGA 2MYGA 3CXGA 5G2ZA 4IJIA 1GLQA 5CAXA 3F3QA 2GS3A 1FHEA 4K6XA 2L4CA 1TXUA 4D73B 5HR3A 2HT9A 3KZQA 5J4VA 1XWBA 4O5UA 3RHBA 5B6MA 5C00A 4GSTA 2GSSA 3US3A 5JCGA 5J5NA 2IJYA 3ZL5A 3BBYA 4MZBA 1FB6A 5ELAA 4POMA 3ZZXA 4JU5A 2H6XA 5HR1A 5KOWA 4ID0A 1J08A 5KN3A 3EE2A 1R26A 3BCIA 3PGTA 1KTEA 2IMEA 2YJHA 4P3YB 3TJFA 3DGQA 4A5PA 3IRAA 3IK9A 2UZ8A 2WFCA 1OE8A 3HCZA 3O6TA 1DE1A 3CRTA 5ECQB 4ICYA 4QQ7A 1UC7A 3VWVA 3GSSA 5ECOB 3VWXA 1XW9A 1C72A 3IE3A 1T4ZA 5J4UA 1K0MA 3TOUA 4ECCA 5J9BA 3GTUA 2H6ZA 1Z6NA 1GNEA 3L78A 1TU7A 2B5YA 3PH9A 2IMDA 4N10A 2R2JA 4Q5NA 2PN8A 1V58A 4KSOA 1KNGA 2ES7A 1SENA 1Z6MA 2YWOA 2C80A 4MH3A 4PGTA 3D22A 3DVXA 1ZOFA 1XW6A 1DE2A 5AN1A 2B7KA 2KHPA 1QXHA 3CYNA 4DEJA 4ACSA 3EWLA 2M80A 4EDYA 3EURA 2AHEA 2ZUPA 3M9JA 4POLA 2VM1A 3MAKA 1GSSA 3UARA 4NWYA 14GSA 1YZXA 3QR6A 2IMIA 4EXJA 2PVQA 2YOIA 1V2AA 2H76A 3IDVA 4ZB7A 2DMMA 4X1UA 2CX3A 4NV5A 5G30A 5DBQA 1SD9A 5EY6A 3HDCA 1A8LA 2GVPA 2CVKA 5HR0A 2VO4A 4F82A 3H93A 3C1SA 3UOMA 1XZOA 2PUKC 1G6WA 2L57A 3C7MA 3Q18A 1Y1UA 1A2JA 3GSTA 4JEDA 7GSSA 3GX8A 4CW9A 4E8EA 3ZIVA 3GKXA 1JZWA 3TGZA 4MZWA 3GYKA 1O6JA 1YKAA 2H0HA 4WKWA 1NSWA 1W4VA 3A3TA 1NHOA 5ECSA 5IIZA 3F4RA 1XPVA 2DJKA 3PPUA 3GFKA 1Y25A 1F6MC 3CSJA 1UN2A 4MF7A 3LGCA 1BG5A 1H75A 4EF0A 2RIIA 2X99A 3HXSA 3FK8A 3GTUB 1YDKA 4FYCA 5CP1A 3VWWA 4MA9A 5DQYA 5DVBA 2LQQA 4MJEA 5IQYA 4IJ3A 1YEPA 2CZ2A 5KN2A 2H74A 5F06A 1ML6A 4AKGA 4PQIA 1GTBA 2KUCA 1OC9A 1YKCA 1A2MA 1TK8B 2VD1A 2GLRA 5ECKB 5G5EA 4WETA 3VPTA 1AQXA 4ILFA 3IC8A 4ULXA 4EC0A 5DJLA 5B8AA 2FGXA 3KH7A 5HFGA 2WDUA 1B9XC 2H6YA 4O92A 3FR9A 4EE0A 4GF0A 1R4WA 5GSTA 2O85A 1ZYQB 5IMAA 1PX7A 1ABAA 2Z9SA 3ZITA 3L0HA 5B7CA 3WGDA 2GQLA 1RK4A 2VOCA 2HSNA 3J7Yk 1IYHA 3IR4A 2P5RA 4ZB9A 1YF1A 1O85A 3VWUA 4HZ2A 2B1KA 2X4AA 4TR1A 2GSTA 2GSQA 3M8NA 5DALA 2YNXA 1NHYA 4JZQA 1E6BA 6GSWA 4NAXA 3NZNA 3F6DA 2I1UA 1MEKA 1TK5B 2J23A 4K2DA 4F9ZA 2HRKA 3HZ4A 3W8JA 4J57E 2VLUA 3F9UA 4XS6A 3RAZA 5EL8A 3TOTA 4OO4A 1Y6EA 4IS0A 4MPGA 1JZDA 3TU3B 3HVXA 2DJ0A 2RM6A 2B5XA 3TKQA 2XC2A 2XPDA 5GAPD 4IHUA 1B4PA 4QL7A 4W66A 1O7UA 2VUPA 1G0TA 2MMAA 1SJIA 3H79A 2ON5A 2EIOA 2R37A 3G7YA 1OC9B 4GQCA 5IOWA 2DKIA 1HQOA 2FWGA 3FHKA 1WE0A 4H86A 3WD6A 3RBTA 2O87A 1SVOA 1QMVA 1QGVA 1PGTA 2WCIA 4O7HA 4TN8A 3GL3A 3F63A 1TKDB 4KNDA 3WYWA 5AGYA 2X8HA 3TKPA 3LEFA 1JHBA 4OFNA 4L0UA 3HJPA 2XPEA 3IBHA 3E0UA 3LSZA 1XWKA 2YV9A 2JZTA 1XFLA 3IAM2 3M1GA 2HSNB 2VIMA 1FO5A 1BQ7A 1YEXA 3HA9A 1F37A 1TJDA 5ECLB 4TR1B 5CRWA 5KN0A 5INYA 4V2LA 5DALB 2H66A 2REMA 2WRTA 1M2AA 2MMNA 5AIXA 4HS1A 2VCXA 3GKNA 1M0UA 3HKRA 1UVZA 20GSA 2WB9A 2MBTA 4TR4A 1GTAA 4RI7A 1F3BA 3F4TA 1YY7A 1N2AA 4PUAA 2FCHA 3UL3A 2L6CA 2HRKB 1GP1A 1K0AA 5EVOA 2I9HA 3MIXA 1B8XA 2HNLA 5HFIA 5G1LA 5BRTA 4KDUA 3EVIA 4TW5A 3VURA 1T1VA 4ML6A 3L4NA 3TDGA 2K8VA 4ZB8A 3RDWA 1GSUA 2L6DA 5J3RA 4V2MA 1VRSD 2OBKA 2A4HA 3Q19A 4ZB6A 3L9SA 1MTCA 2H19A 4KE3A 2RUFA 5J47A 3F6FA 4E68A 1SYRA 1HNCA 1M7TA 17GSA 2VCTA 3QAGA 1K3OA 2PERA 4G0IA 2KLXA 4KB3A 1ZL9A 2HSYA 3QAWA 1FG4A 2CT6A 3P8WA 3C71A 5CO3A 3D6IA 3CWGA 4N11A 4LMVA 5CRHA 3HJOA 6GSYA 1N8JA 1PKWA 5ECIB 2CAQA 3KH9A 2RUEA 1AW9A 3DMLA 2EFEA 2IFQA 4MK3A 3FKFA 4PTSA 1FOHA 2M46A 2V32A 5FHIA 3VI5A 3TRXA 1M2BA 4KH7A 1GH2A 2GQKA 1G6YA 3UIWA 2E2MA 4KUNA 1K0OA 1SYXA 3QDNA 5CRDA 4KDYA 4ZIJA 3GV1A 13GSA 5J9CA 3H8QA 4K7IA 1LJRA 3KGKA 3FZ4A 1U6TA 4FH8A 4G0KA 2H1LA 5G5FA 4AJ8A 1ZYNA 1EWXA 5IMZA 1YQ1A 4IELA 4IQAA 1A23A 2IPAA 4I5QA 2EFCA 4V2NA 2CA8A 4LL1B 3HD5A 3IV4A 4J2FA 2A2SA 1A2LA 4OMVA 4K2XA 1BYEA 4HU7A 4LLRA 3KIJA 2F9SA 3VK9A 3KM6A 1SD8A 2HLSA 1WOUA 3SWLA 5B8BA 6GSUA 4F0CA 6GSSA 5J4YA 1AC1A 4MJBA 3I43A 2OADA 4OWYA 2E0QA 4OO5A 4X43A 4E8HA 1T7PB 5GZZB 1SKWB 1FVJA 3GRXA 3DVWA 3EPTA 4YKFA 4PURA 4XCSA 4KX4A 5ECMB 5KN1A 4J56E 2OA7A 5D73A 1EGOA 2C8UA 1EGRA 3FW2A 5COHA 4YH2A 2F8AA 1A8YA 2V6OA 3D4TA 4DSRA 1Z3EA 2HRFA 1X5EA 4KA0A 3KTBA 3KD0A 1GSEA 2IFQB 1SK1A 1O81A 3Q6OA 4L0WA 3ZLPA 2HFDA 2GSRA 1Z5YE 2GZPA 4AKIA 4AKXB 2X8CA 3EU3A 3WGXA 2FD3A 2PBJA 3AY8A 4HJMA 2DBCA 4K7NA 2ALBA 2AV4A 2B5EA 4LA1A 1S3AA 3OR5A 5J40A 3L9UA 2HRAA 2K6VA 4DSSA 5HFKA 5HQPA 2L4QA 1WWJA 1T00A 1VF4A 4TXVA 4Z7XA 3QMXA 3Q74A 2DKHA 3GL5A 4EIQA 4MDCA 2CVDA 3A2WA 4EDZA 3UJ1A 3KXOA 3QD9A 3CSHA 2C3TA 1V9WA 4PNFA 3FZ9A 2HRNA 3KEBA 3TKRA 1Z9HA 2H73A 3QCPA 4K0NA 1DBYA 4N0ZA 2L5LA 4ECBA 16GSA 2JZSA 3CMIA 4WR4A 5A4VA 1MDKA 3QFAC 2DMLA 1SVMA 4O5RA 1PKZA 2LSTA 1HNBA 1SKRB 2MMOA 5CYYA 1ON4A 4I8BA 3TKSC 1GTUA 1GUHA 2IN3A 4KGIA 5G1KA 1OE7A 2K8SA 1GULA 4YQVA 1YVLA 2WGRA 4WBJA 2YP6A 2C3QA 1U87A 2C4JA 5AIVA 3ZVJA 3F8UA 4MABA 4BVYA 4BL7A 6GSVA 5D9WA 4LL4B 3ZRDA 1XXUA 2HZEA 4I97A 4F2IA 2GZYA 5IMCA 4JBBA 3S9FA 2VM2A 2EFDA 5E59A 1EOGA 2OE0A 4HDEA 3ZVJD 4G2EA 3P7XA 4GCIA 2NPBA 3UBLA 5IPHA 1THOA 3P90A 3HYPA 2L5OA 2IMKA 2VL2C 4JE1A 4KW6A 2X8GA 4YQUA 1O73A 1EZKA 10GSA 2JZRA 1K3LA 3LFLA 4DSSB 4MPFA 4IKHA 5IO0A 1URMA 2TRCP 2JU5A 3K8NA 2JSZA 4YAPA 4QL9A 2LS5A 1ERVA 2H75A 3J7Yb 2JL4A 5DCHA 4WBRD 2VCVA 4PXOA 3TUEA 2CX4A 4N30A 1T4YA 3IA1A 1F3AA 3LYKA 4Z2UA 2QKEA 4G9HA 1RW1A 2QC7A 2EFHA 2LRNA 4KF9A 2LNTA 3DKSA 5CREA 1NM3A 2R0CA 3CTGA 1GTIA 2GQMA 4AF2A 2C0DA 2P31A 4ZL9A 3IK7A 1IYIA 2YWNA 2O5VA 2PPTA 2GT6A 2C0GA 1TDIA 1S3DA 1PQNA 1MDIA 3LG6A 5BMUA 3GKKA 2H0IA 3A5WA 5HR2A 1PN0A 1SJZA 1M9AA 1PL1A 2FA8A 5JCWA 1K3YA 1UA5A 1TI3A 3ZMLA 3HZ8A 1GWCA 4XTSA 5D9XA 2IWTA 1QQ2A 3GHAA 5JWOB 4BVYB 4BL7B 1FAAA 2NTOA 2HZEB 2YJ7A 3IOSA 1YJ6A 4L5LA 1AQVA 3TB2A 2OKAA 3APOA 1EP7A 4WF5A 4AGSA 4MNNA 2HYXA 2H30A 3V1WA 2PVOC 3MDKA 4JRRA 5IO2A 5D96A 1H4OA 5D8IA 22GSA 4GDFA 4ECJA 1ERTA 2O89A 2HE3A 1RQMA 1PD21 2G2QA 4CDOA 3RHCA 1V98A 1K0NA 4K0GA 3VI7A 3M0FA 2GGTA 3G7JA 2O7KA 1W89A 4NHWA 2F51A 1SK0A 3PR8A 4Q5RA 4EUYA 1EV9A 3DWVA 2VLVA 1LBKA 3IXRA 4MH2A 1WRYA 2EIRA 2GZZA 1A24A 1EP8A 2LEGA 3FZAA 4JR4A 2J9HA 2R5GA 4OCFA 4GQFA 1SL2B 2UV8G 2DIYA 1WIKA 1SVLA 4FYBA 3KCMA 1EEJA 2HSMA 5F05A 5ECHB 5JCUA 4BPYA 3KMNA 2P5QA 4XS4A 1TRVA 5BMUB 1B48A 5ABRA 3FR3A 2R0PA 5A1NA 1OKTA 2DJJA 4EKZA 2DLXA 2VL9A 1AIUA 1K0DA 3IHGA 3ME8A 2QGVA 3RPNA 2CV4A 1XCCA 3TRQA 4KAEA 1MDJA 4NMUA 2AJQB 2LUSA 4G10A 2R0GA 1O8XA 4GSSA 1XOAA 4MMMA 6GSXA 1Q98A 4NXIA 4NHZA 3ZIJA 4TR3A 3GKMA 2IMFA 3TCOA 1WP0A 2KOKA 4K7OA 2FNOA 1V57A 3APSA 3O76A 4ISDA 4MF5A 2HZFA 5A5HA 2KP2A 2OE1A 3D4MA 3UVTA 1GSFA 1X9MB 4TR0A 4TKYA 1V40A 3ERGA 1QUWA 5IMDA 2TRXA 3P2AA 1J0FA 1J9BA 4IVFA 4PQ1A 3TJKA 1VGLA 2NDOA 4KCAA 1X9WB 3IHQA 11GSA 4MJCA 1G7OA 3C8EA 5ELGA 3DD3A 3ISOA 3WT2A 2LKUA 5JWQB 4GSNA 4ZBAA 4HEA2 4ZBBA 2A4VA 5D9VA 2QA1A 4MZCA 1TI1A 1ZYEA 4AJ6A 1DSBA 1PMTA 1TTZA 2I3YA 1I5GA 3I9V2 5DAKA 2HSMB 2GT5A 2M72A 4PQHA 1T3BA 3BCKA 4K8MA 1JFUA 2YZUA 1KBNA 3L9VA 5DCGA 2KP1A 3ERWA 4MCUA 4XS4B 4GLTA 1AXDA 1WMJA 2H1GA 5B6NA 5A1NB 2OACA 1MD3A 3F0IA 3GNJA 3FZ5A 3BD2A 1ZZYA 3HY2A 4AKHA 1GLPA 1U88A 4TXOA 4Q5QA 5KEJA 4G0LA 4POKA 3QAVA 5DJMA 1OAZA 1JLVA 2N5BA 3GURA 4TOPA 4POBA 1F2EA 2X49A 3F4SA 5ECPB 1ZYPA 2JADA 4BA7A 2C0EA 2F8FA 3MSZA 4GWRA 2CVBA 4IGJA 3UBKA 2VCWA 3N5OA 5A5HB 1NW2A 3FY7A 5LD0A 5A5KA 3DYRA 3VFIA 2YPMA 1G7EA 2C3NA 1YF0A 1X9SB 3LJRA 2H0GA 2WZ9A 3IC4A 3ED3A 5CNWA 1ZGNA 4MF6A 2VAFA 3WT1A 1OYJA 4IBPA 2V41A 5A4UA 1SL1B 1XVQA 2DC5A 2AYTA 3CSIA 1HD2A 1ZMAA 2OT3A 2H1AA 4BVXA 1SU9A 4WR5A 2VCZA 2E2GA 4IN0A 4O5QA 3KJYA 4IQ1A 2LNSA 2K18A 3DEXA 4EVMA 1R7HA 3ME7A 2VD0A 5C04A 18GSA 4RI6A 2R3XA 4TVEA 1EOHA 2I4AA 1M2DA 1PSQA 1XVWA 1USBA 4X4JA 4L8EA 1HYUA 2C1YA 1PA3A 4PUFC 1XW5A 4MLYA 2OJLA 5FT3A 5DAKB 2AAWA 3R2QA 4FIWA 4CY8A 5G31A 1X5CA 2NVLA 4ZBDA 2PGTA 4ZILA 3LXZA 3LWAA 4HQSA 1R5PA 3DIEA 1ERWA 3FMWA 1PL2A 3UVHA 4V1Ag 1WPIA 1Z7RA 3TRPA 4TXOB 5ECNB 3H4KA 1AAZA 2K9FA 4LMWA 3GA4A 5IM9A 2IL3A 1M99A 3CBUA 1GSQA 1F9MA 3KTLA 4YQMA 1BF5A 3GH9A 1PX6A 4MJAA 2LQOA 2H71A 4I6XA 4YAVA 2YWMA 3TJBA 1X5DA 4WEYA 5ID2A 3UAPA 3A2XA 3EC3A 1VF2A 3IAS2 2PMTA 4HUAA 2G0FA 1FOVA 5DQSA 2QSIA 1JLWA 4QMKA 3W8SA 1TRWA 5IPGA 1B4QA 3KMOA 4CY6A 4K5SA 4O32A 2LV3A 2YCDA 1AQWA 3CTFA 2VL3A 1JZRA 1TU8A 3N9JA 2YZHA 5D9TA 3C1RA 4BVXB 1TK0B 3LORA 2MBSA 3HMJG 3ZFBA 2B3SA 1GUMA 4FYUA 5FWGA 4IW9A 3HVSA 3W6GA 3FR6A 4KSMA 2BTOT 4IP6A 1ST9A 1SKSB 4RQRA 4FO5A 4L5OA 2XBQA 12GSA 4V1Ap 1K0CA 2D2ZA 1XBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KCE A;  3F3R A;  5IOX A;  3ZRE A;  1OC8 A;  2B1L A;  2CQ9 A;  1GUK A;  2XBI A;  3ZTL A;  2H1B A;  2HSH A;  3FRC A;  5IMF A;  2WS2 A;  4OFT A;  5ECR B;  3O3T A;  2FWF A;  2P0G A;  5F0G A;  1O8W A;  2B6M A;  1U3I A;  4HQZ A;  1WJK A;  4TRX A;  3GH6 A;  1XOB A;  1BED A;  2BMX A;  1Z7P A;  1OVN A;  3LXT A;  3ZMK A;  1Q4J A;  3MWH A;  2DIZ A;  4HU9 A;  1TP9 A;  1SL0 B;  3M9K A;  2BJX A;  5D93 A;  3TKS E;  4I2T A;  9GSS A;  4AJ7 A;  4X0X A;  3LYP A;  2ON7 A;  1ERU A;  2EIQ A;  2N5F A;  2O8V B;  1PRX A;  2HXK A;  2MZC A;  4EO3 A;  5ID2 B;  3H1N A;  3GX0 A;  1JZO A;  2DSA A;  2LJR A;  2V1M A;  3DXB A;  4N0V A;  5F07 A;  3M3M A;  2RLI A;  3R3E A;  2JAC A;  2B7J A;  1M9B A;  4OD7 A;  3APQ A;  3C73 A;  2GDR A;  2WJU A;  2V2G A;  3VPQ A;  2VLT A;  2H70 A;  2X64 A;  2ZCT A;  3JCM L;  1GSY A;  1VF3 A;  3ZFL A;  3TJJ A;  4HI7 A;  3ZYW A;  2OE3 A;  1LU4 A;  3FYG A;  1XWG A;  1SJ6 A;  3VLN A;  4HJ2 A;  5CRG A;  3RPP A;  5LCZ A;  2JSY A;  1GSD A;  4RQX A;  4K1F A;  5L71 A;  1CQG A;  3UMA A;  4ZL8 A;  2LRC A;  2AUV A;  2FY6 A;  3NIV A;  1XWA A;  1PN9 A;  3EIN A;  4BWQ A;  4HZ4 A;  2HI7 A;  1OKD A;  2DJ1 A;  1ACV A;  3GUS A;  1U3A A;  2H8L A;  5EPF A;  3A2V A;  2LJK A;  3G7I A;  4G19 A;  2YN1 A;  1QK8 A;  3NOF A;  3BJ5 A;  4EL1 A;  4ZL7 A;  1T8E B;  2FWE A;  1X0R A;  8GSS A;  3IPZ A;  2DJ3 A;  3E9J B;  1A0R P;  4XRA A;  1EV4 A;  2LRT A;  4XHM A;  2TIR A;  3EMX A;  1S3C A;  5H5Q A;  2LJA A;  1CQH A;  2GTU A;  3TKS A;  2CAI A;  2FA4 A;  2H01 A;  2N5A A;  1GNW A;  4WXT A;  1I9D A;  2A2R A;  1GL8 A;  3U6V A;  2V6K A;  3PIN A;  2H72 A;  4XRD A;  3GMF A;  5GSS A;  3CRU A;  2C0F A;  4WF4 A;  1B9Y C;  2YAN A;  3ERF A;  2IIY A;  2FWH A;  4I2U A;  4XIH A;  3FEU A;  2VCQ A;  2XHF A;  2NBS A;  3KP8 A;  3EU4 A;  4MP4 A;  4Q5F A;  3TJG A;  3E3E A;  4FQU A;  5E4W A;  1BX9 A;  4CHS A;  5F8B A;  4PNG A;  2PWJ A;  4D73 A;  4DSQ A;  2VL2 A;  4PX1 A;  3HHV A;  1TXX A;  5ENU A;  4OFM A;  2ZNM A;  2EC4 A;  3GN3 A;  4BWS A;  1FB0 A;  2DJ2 A;  1OC3 A;  3MNG A;  2YV7 A;  3KP9 A;  5JWR B;  3QPM A;  6GST A;  4HOJ A;  3HVV A;  4NPB A;  3BOA A;  3D5J A;  4F0B A;  1XWC A;  1TW9 A;  5J41 A;  2L59 A;  5GAN D;  4IP1 A;  1GRX A;  1KEB A;  1ZCP A;  1SK2 A;  3DRN A;  1AUC A;  1THX A;  5A4W A;  1TOF A;  4KDX A;  4OCE A;  3I69 A;  3EYT A;  4K9Z A;  3QOU A;  4DVC A;  1DUG A;  5IMV A;  1TRS A;  4RUV A;  1K0B A;  19GS A;  1FVK A;  2YWI A;  1E2Y A;  4F03 A;  1A0F A;  5LNK e;  3EMP A;  3D21 A;  4GXZ A;  1ILO A;  3U5R E;  2AB6 A;  2F3M A;  1MD4 A;  2OBI A;  5H5S A;  3HJM A;  1HNA A;  2FLS A;  3SBC A;  2MMZ A;  1BJX A;  2FHE A;  1EEM A;  2E7P A;  2FUG 2;  1XIY A;  4USS A;  3GIX A;  3LQ7 A;  2I81 A;  2CZ3 A;  3QFB C;  3I6A A;  2WUL A;  4XS1 A;  2H1D A;  2HQT A;  3WGE A;  4ECI A;  2R4V A;  5AIS A;  1VF1 A;  4ML1 A;  5DDL A;  2PU9 C;  1FW1 A;  4GRF A;  3UEM A;  1BAY A;  2LTK A;  1TRU A;  5H5R A;  3G9B A;  4GTU A;  3D0Z A;  1R5A A;  4JR6 A;  1QFN A;  2RM5 A;  2R6K A;  4NV2 A;  4ZXG A;  2MYG A;  3CXG A;  5G2Z A;  4IJI A;  1GLQ A;  5CAX A;  3F3Q A;  2GS3 A;  1FHE A;  4K6X A;  2L4C A;  4D73 B;  5HR3 A;  2HT9 A;  3KZQ A;  1XWB A;  3RHB A;  5B6M A;  5C00 A;  4GST A;  2GSS A;  3US3 A;  5JCG A;  5J5N A;  2IJY A;  3ZL5 A;  3BBY A;  4MZB A;  1FB6 A;  5ELA A;  4POM A;  3ZZX A;  4JU5 A;  2H6X A;  5HR1 A;  4ID0 A;  1J08 A;  5KN3 A;  3EE2 A;  1R26 A;  3BCI A;  3PGT A;  1KTE A;  2IME A;  2YJH A;  4P3Y B;  3TJF A;  3DGQ A;  3IRA A;  3IK9 A;  2UZ8 A;  2WFC A;  1OE8 A;  3HCZ A;  3O6T A;  1DE1 A;  3CRT A;  5ECQ B;  4QQ7 A;  1UC7 A;  3VWV A;  3GSS A;  5ECO B;  3VWX A;  1XW9 A;  1C72 A;  3IE3 A;  1T4Z A;  5J4U A;  1K0M A;  3TOU A;  4ECC A;  5J9B A;  3GTU A;  2H6Z A;  1Z6N A;  1GNE A;  3L78 A;  1TU7 A;  2B5Y A;  3PH9 A;  2IMD A;  4N10 A;  2R2J A;  4Q5N A;  2PN8 A;  1V58 A;  4KSO A;  1KNG A;  2ES7 A;  1SEN A;  1Z6M A;  2YWO A;  2C80 A;  4MH3 A;  4PGT A;  3D22 A;  3DVX A;  1ZOF A;  1XW6 A;  1DE2 A;  5AN1 A;  2B7K A;  2KHP A;  1QXH A;  3CYN A;  4DEJ A;  4ACS A;  3EWL A;  2M80 A;  4EDY A;  3EUR A;  2AHE A;  2ZUP A;  3M9J A;  4POL A;  2VM1 A;  3MAK A;  1GSS A;  3UAR A;  4NWY A;  14GS A;  1YZX A;  3QR6 A;  2IMI A;  4EXJ A;  2PVQ A;  2YOI A;  1V2A A;  2H76 A;  3IDV A;  2DMM A;  4X1U A;  2CX3 A;  4NV5 A;  5G30 A;  5DBQ A;  1SD9 A;  5EY6 A;  3HDC A;  1A8L A;  2GVP A;  2CVK A;  5HR0 A;  2VO4 A;  4F82 A;  3H93 A;  3C1S A;  3UOM A;  1XZO A;  2PUK C;  1G6W A;  2L57 A;  3C7M A;  3Q18 A;  1A2J A;  3GST A;  4JED A;  7GSS A;  3GX8 A;  4CW9 A;  4E8E A;  3ZIV A;  3GKX A;  1JZW A;  3TGZ A;  4MZW A;  3GYK A;  1O6J A;  1YKA A;  2H0H A;  4WKW A;  1NSW A;  1W4V A;  3A3T A;  1NHO A;  5ECS A;  5IIZ A;  3F4R A;  1XPV A;  2DJK A;  3PPU A;  3GFK A;  1Y25 A;  1F6M C;  3CSJ A;  1UN2 A;  4MF7 A;  3LGC A;  1BG5 A;  1H75 A;  4EF0 A;  2RII A;  2X99 A;  3HXS A;  3FK8 A;  3GTU B;  1YDK A;  4FYC A;  5CP1 A;  3VWW A;  4MA9 A;  5DQY A;  5DVB A;  2LQQ A;  4MJE A;  5IQY A;  4IJ3 A;  1YEP A;  2CZ2 A;  5KN2 A;  2H74 A;  5F06 A;  1ML6 A;  4PQI A;  1GTB A;  2KUC A;  1OC9 A;  1YKC A;  1A2M A;  1TK8 B;  2VD1 A;  2GLR A;  5ECK B;  5G5E A;  4WET A;  3VPT A;  1AQX A;  4ILF A;  3IC8 A;  4ULX A;  4EC0 A;  5DJL A;  5B8A A;  2FGX A;  3KH7 A;  5HFG A;  2WDU A;  1B9X C;  2H6Y A;  4O92 A;  3FR9 A;  4EE0 A;  4GF0 A;  1R4W A;  5GST A;  2O85 A;  1ZYQ B;  5IMA A;  1PX7 A;  1ABA A;  2Z9S A;  3ZIT A;  3L0H A;  5B7C A;  3WGD A;  2GQL A;  1RK4 A;  2VOC A;  3J7Y k;  1IYH A;  3IR4 A;  2P5R A;  4ZB9 A;  1YF1 A;  1O85 A;  3VWU A;  4HZ2 A;  2B1K A;  4TR1 A;  2GST A;  2GSQ A;  3M8N A;  5DAL A;  2YNX A;  1NHY A;  4JZQ A;  1E6B A;  6GSW A;  4NAX A;  3NZN A;  3F6D A;  2I1U A;  1MEK A;  1TK5 B;  2J23 A;  4K2D A;  4F9Z A;  2HRK A;  3HZ4 A;  3W8J A;  4J57 E;  2VLU A;  3F9U A;  4XS6 A;  3RAZ A;  5EL8 A;  3TOT A;  4OO4 A;  1Y6E A;  4IS0 A;  4MPG A;  1JZD A;  3HVX A;  2DJ0 A;  2RM6 A;  2B5X A;  3TKQ A;  2XC2 A;  2XPD A;  5GAP D;  4IHU A;  1B4P A;  4QL7 A;  1O7U A;  2VUP A;  1G0T A;  2MMA A;  1SJI A;  3H79 A;  2ON5 A;  2EIO A;  2R37 A;  3G7Y A;  1OC9 B;  4GQC A;  5IOW A;  1HQO A;  2FWG A;  3FHK A;  1WE0 A;  4H86 A;  3WD6 A;  3RBT A;  2O87 A;  1QMV A;  1QGV A;  1PGT A;  2WCI A;  4O7H A;  4TN8 A;  3GL3 A;  3F63 A;  1TKD B;  4KND A;  3WYW A;  5AGY A;  2X8H A;  3TKP A;  3LEF A;  1JHB A;  4OFN A;  4L0U A;  3HJP A;  2XPE A;  3IBH A;  3E0U A;  3LSZ A;  1XWK A;  2YV9 A;  2JZT A;  1XFL A;  3IAM 2;  3M1G A;  2HSN B;  2VIM A;  1FO5 A;  1BQ7 A;  1YEX A;  3HA9 A;  1F37 A;  1TJD A;  5ECL B;  4TR1 B;  5CRW A;  5KN0 A;  5INY A;  4V2L A;  5DAL B;  2H66 A;  2REM A;  2WRT A;  1M2A A;  2MMN A;  5AIX A;  4HS1 A;  2VCX A;  3GKN A;  1M0U A;  3HKR A;  1UVZ A;  20GS A;  2WB9 A;  2MBT A;  4TR4 A;  1GTA A;  4RI7 A;  1F3B A;  3F4T A;  1YY7 A;  1N2A A;  4PUA A;  2FCH A;  3UL3 A;  2L6C A;  2HRK B;  1GP1 A;  1K0A A;  5EVO A;  2I9H A;  1B8X A;  2HNL A;  5HFI A;  5G1L A;  4KDU A;  3EVI A;  4TW5 A;  3VUR A;  1T1V A;  4ML6 A;  3L4N A;  3TDG A;  2K8V A;  4ZB8 A;  3RDW A;  1GSU A;  2L6D A;  5J3R A;  4V2M A;  1VRS D;  2OBK A;  3Q19 A;  4ZB6 A;  3L9S A;  1MTC A;  2H19 A;  4KE3 A;  2RUF A;  3F6F A;  1SYR A;  1HNC A;  1M7T A;  17GS A;  2VCT A;  3QAG A;  1K3O A;  2PER A;  4G0I A;  2KLX A;  4KB3 A;  1ZL9 A;  2HSY A;  3QAW A;  1FG4 A;  2CT6 A;  3P8W A;  3C71 A;  5CO3 A;  3D6I A;  4N11 A;  4LMV A;  5CRH A;  3HJO A;  6GSY A;  1N8J A;  1PKW A;  5ECI B;  2CAQ A;  3KH9 A;  2RUE A;  1AW9 A;  3DML A;  2IFQ A;  4MK3 A;  3FKF A;  4PTS A;  2M46 A;  2V32 A;  5FHI A;  3VI5 A;  3TRX A;  1M2B A;  4KH7 A;  1GH2 A;  2GQK A;  1G6Y A;  3UIW A;  2E2M A;  4KUN A;  1K0O A;  1SYX A;  3QDN A;  5CRD A;  4KDY A;  4ZIJ A;  3GV1 A;  13GS A;  5J9C A;  3H8Q A;  4K7I A;  1LJR A;  3KGK A;  3FZ4 A;  1U6T A;  4FH8 A;  4G0K A;  5G5F A;  4AJ8 A;  1EWX A;  5IMZ A;  1YQ1 A;  4IEL A;  4IQA A;  1A23 A;  2IPA A;  4I5Q A;  4V2N A;  2CA8 A;  4LL1 B;  3HD5 A;  3IV4 A;  4J2F A;  2A2S A;  1A2L A;  4OMV A;  1BYE A;  4HU7 A;  4LLR A;  3KIJ A;  2F9S A;  3VK9 A;  3KM6 A;  1SD8 A;  2HLS A;  1WOU A;  3SWL A;  5B8B A;  6GSU A;  4F0C A;  6GSS A;  1AC1 A;  4MJB A;  3I43 A;  2OAD A;  4OWY A;  2E0Q A;  4OO5 A;  4X43 A;  4E8H A;  1T7P B;  5GZZ B;  1SKW B;  1FVJ A;  3GRX A;  3DVW A;  4PUR A;  4XCS A;  4KX4 A;  5ECM B;  5KN1 A;  4J56 E;  2OA7 A;  5D73 A;  1EGO A;  2C8U A;  1EGR A;  3FW2 A;  5COH A;  4YH2 A;  2F8A A;  1A8Y A;  2V6O A;  3D4T A;  4DSR A;  1Z3E A;  2HRF A;  1X5E A;  4KA0 A;  3KTB A;  3KD0 A;  1GSE A;  2IFQ B;  1SK1 A;  1O81 A;  3Q6O A;  4L0W A;  3ZLP A;  2HFD A;  2GSR A;  1Z5Y E;  2GZP A;  2X8C A;  3EU3 A;  3WGX A;  2FD3 A;  2PBJ A;  3AY8 A;  4HJM A;  2DBC A;  4K7N A;  2ALB A;  2AV4 A;  2B5E A;  4LA1 A;  1S3A A;  3OR5 A;  3L9U A;  2HRA A;  2K6V A;  4DSS A;  5HFK A;  5HQP A;  2L4Q A;  1WWJ A;  1T00 A;  1VF4 A;  4TXV A;  4Z7X A;  3QMX A;  3Q74 A;  3GL5 A;  4MDC A;  2CVD A;  3A2W A;  4EDZ A;  3UJ1 A;  3KXO A;  3QD9 A;  3CSH A;  2C3T A;  1V9W A;  4PNF A;  3FZ9 A;  2HRN A;  3KEB A;  3TKR A;  1Z9H A;  2H73 A;  3QCP A;  4K0N A;  1DBY A;  4N0Z A;  2L5L A;  4ECB A;  16GS A;  2JZS A;  3CMI A;  4WR4 A;  5A4V A;  1MDK A;  3QFA C;  2DML A;  4O5R A;  1PKZ A;  2LST A;  1HNB A;  1SKR B;  2MMO A;  5CYY A;  1ON4 A;  4I8B A;  3TKS C;  1GTU A;  1GUH A;  2IN3 A;  4KGI A;  5G1K A;  1OE7 A;  2K8S A;  1GUL A;  4YQV A;  2WGR A;  4WBJ A;  2YP6 A;  2C3Q A;  1U87 A;  2C4J A;  5AIV A;  3ZVJ A;  3F8U A;  4MAB A;  4BVY A;  4BL7 A;  6GSV A;  5D9W A;  4LL4 B;  3ZRD A;  1XXU A;  2HZE A;  4I97 A;  4F2I A;  2GZY A;  5IMC A;  4JBB A;  3S9F A;  2VM2 A;  5E59 A;  1EOG A;  2OE0 A;  4HDE A;  3ZVJ D;  4G2E A;  3P7X A;  4GCI A;  2NPB A;  3UBL A;  5IPH A;  1THO A;  3P90 A;  3HYP A;  2L5O A;  2IMK A;  2VL2 C;  4JE1 A;  4KW6 A;  2X8G A;  4YQU A;  1O73 A;  1EZK A;  10GS A;  2JZR A;  1K3L A;  3LFL A;  4DSS B;  4MPF A;  4IKH A;  5IO0 A;  1URM A;  2TRC P;  2JU5 A;  3K8N A;  2JSZ A;  4YAP A;  4QL9 A;  2LS5 A;  1ERV A;  2H75 A;  3J7Y b;  2JL4 A;  5DCH A;  4WBR D;  2VCV A;  4PXO A;  3TUE A;  2CX4 A;  4N30 A;  1T4Y A;  3IA1 A;  1F3A A;  3LYK A;  2QKE A;  4G9H A;  1RW1 A;  2QC7 A;  2LRN A;  4KF9 A;  2LNT A;  3DKS A;  5CRE A;  1NM3 A;  3CTG A;  1GTI A;  2GQM A;  4AF2 A;  2C0D A;  2P31 A;  4ZL9 A;  3IK7 A;  1IYI A;  2YWN A;  2PPT A;  2GT6 A;  2C0G A;  1TDI A;  1S3D A;  1PQN A;  1MDI A;  3LG6 A;  5BMU A;  3GKK A;  2H0I A;  3A5W A;  5HR2 A;  1SJZ A;  1M9A A;  1PL1 A;  2FA8 A;  5JCW A;  1K3Y A;  1UA5 A;  1TI3 A;  3ZML A;  3HZ8 A;  1GWC A;  4XTS A;  5D9X A;  2IWT A;  1QQ2 A;  3GHA A;  5JWO B;  4BVY B;  4BL7 B;  1FAA A;  2NTO A;  2HZE B;  2YJ7 A;  3IOS A;  1YJ6 A;  4L5L A;  1AQV A;  3TB2 A;  2OKA A;  3APO A;  1EP7 A;  4WF5 A;  4AGS A;  2HYX A;  2H30 A;  3V1W A;  2PVO C;  3MDK A;  4JRR A;  5IO2 A;  5D96 A;  1H4O A;  5D8I A;  22GS A;  4ECJ A;  1ERT A;  2O89 A;  2HE3 A;  1RQM A;  1PD2 1;  2G2Q A;  4CDO A;  3RHC A;  1V98 A;  1K0N A;  4K0G A;  3VI7 A;  3M0F A;  2GGT A;  3G7J A;  2O7K A;  1W89 A;  4NHW A;  2F51 A;  1SK0 A;  3PR8 A;  4Q5R A;  4EUY A;  1EV9 A;  3DWV A;  2VLV A;  1LBK A;  3IXR A;  4MH2 A;  1WRY A;  2EIR A;  2GZZ A;  1A24 A;  1EP8 A;  2LEG A;  3FZA A;  4JR4 A;  2J9H A;  2R5G A;  4OCF A;  4GQF A;  1SL2 B;  2DIY A;  1WIK A;  4FYB A;  3KCM A;  1EEJ A;  2HSM A;  5F05 A;  5ECH B;  5JCU A;  4BPY A;  3KMN A;  2P5Q A;  4XS4 A;  1TRV A;  1B48 A;  5ABR A;  3FR3 A;  1OKT A;  2DJJ A;  4EKZ A;  2DLX A;  2VL9 A;  1AIU A;  1K0D A;  3ME8 A;  2QGV A;  3RPN A;  2CV4 A;  1XCC A;  3TRQ A;  4KAE A;  1MDJ A;  4NMU A;  2AJQ B;  2LUS A;  4G10 A;  1O8X A;  4GSS A;  1XOA A;  4MMM A;  6GSX A;  1Q98 A;  4NXI A;  4NHZ A;  3ZIJ A;  4TR3 A;  3GKM A;  2IMF A;  3TCO A;  1WP0 A;  2KOK A;  4K7O A;  2FNO A;  1V57 A;  3APS A;  3O76 A;  4ISD A;  4MF5 A;  2HZF A;  2KP2 A;  2OE1 A;  3D4M A;  3UVT A;  1GSF A;  1X9M B;  4TR0 A;  4TKY A;  1V40 A;  3ERG A;  1QUW A;  5IMD A;  2TRX A;  3P2A A;  1J0F A;  1J9B A;  4IVF A;  4PQ1 A;  3TJK A;  1VGL A;  2NDO A;  4KCA A;  1X9W B;  3IHQ A;  11GS A;  4MJC A;  1G7O A;  3C8E A;  5ELG A;  3DD3 A;  3ISO A;  3WT2 A;  2LKU A;  5JWQ B;  4GSN A;  4ZBA A;  4HEA 2;  4ZBB A;  2A4V A;  5D9V A;  4MZC A;  1TI1 A;  1ZYE A;  4AJ6 A;  1DSB A;  1PMT A;  1TTZ A;  2I3Y A;  1I5G A;  3I9V 2;  5DAK A;  2HSM B;  2GT5 A;  2M72 A;  4PQH A;  4K8M A;  1T3B A;  3BCK A;  1JFU A;  2YZU A;  1KBN A;  3L9V A;  5DCG A;  2KP1 A;  3ERW A;  4MCU A;  4XS4 B;  4GLT A;  1AXD A;  1WMJ A;  2H1G A;  5B6N A;  2OAC A;  1MD3 A;  3F0I A;  3GNJ A;  3FZ5 A;  3BD2 A;  1ZZY A;  3HY2 A;  1GLP A;  1U88 A;  4TXO A;  4Q5Q A;  5KEJ A;  4G0L A;  4POK A;  3QAV A;  5DJM A;  1OAZ A;  1JLV A;  2N5B A;  3GUR A;  4TOP A;  4POB A;  1F2E A;  5ECP B;  3F4S A;  4BA7 A;  2JAD A;  2C0E A;  2F8F A;  3MSZ A;  4GWR A;  2CVB A;  4IGJ A;  3UBK A;  2VCW A;  3N5O A;  1NW2 A;  3FY7 A;  5LD0 A;  5A5K A;  3DYR A;  3VFI A;  2YPM A;  1G7E A;  2C3N A;  1YF0 A;  1X9S B;  3LJR A;  2H0G A;  2WZ9 A;  3IC4 A;  3ED3 A;  5CNW A;  1ZGN A;  4MF6 A;  2VAF A;  3WT1 A;  1OYJ A;  4IBP A;  2V41 A;  5A4U A;  1SL1 B;  1XVQ A;  2DC5 A;  2AYT A;  3CSI A;  1HD2 A;  1ZMA A;  2H1A A;  4BVX A;  1SU9 A;  4WR5 A;  2VCZ A;  2E2G A;  4IN0 A;  3KJY A;  4IQ1 A;  2LNS A;  2K18 A;  3DEX A;  4EVM A;  1R7H A;  3ME7 A;  2VD0 A;  5C04 A;  18GS A;  4RI6 A;  2R3X A;  4TVE A;  1EOH A;  2I4A A;  1M2D A;  1PSQ A;  1XVW A;  1USB A;  4L8E A;  1HYU A;  2C1Y A;  1PA3 A;  4PUF C;  1XW5 A;  4MLY A;  2OJL A;  5FT3 A;  5DAK B;  2AAW A;  3R2Q A;  4FIW A;  5G31 A;  1X5C A;  2NVL A;  4ZBD A;  2PGT A;  4ZIL A;  3LXZ A;  3LWA A;  4HQS A;  1R5P A;  3DIE A;  1ERW A;  1PL2 A;  3UVH A;  4V1A g;  1WPI A;  1Z7R A;  3TRP A;  4TXO B;  5ECN B;  3H4K A;  1AAZ A;  2K9F A;  4LMW A;  3GA4 A;  5IM9 A;  2IL3 A;  1M99 A;  3CBU A;  1GSQ A;  1F9M A;  3KTL A;  4YQM A;  3GH9 A;  1PX6 A;  4MJA A;  2LQO A;  2H71 A;  4I6X A;  4YAV A;  2YWM A;  3TJB A;  1X5D A;  4WEY A;  5ID2 A;  3UAP A;  3A2X A;  3EC3 A;  1VF2 A;  3IAS 2;  2PMT A;  4HUA A;  2G0F A;  1FOV A;  5DQS A;  2QSI A;  1JLW A;  1TRW A;  3W8S A;  5IPG A;  1B4Q A;  3KMO A;  4O32 A;  2LV3 A;  2YCD A;  1AQW A;  3CTF A;  2VL3 A;  1JZR A;  1TU8 A;  3N9J A;  2YZH A;  5D9T A;  3C1R A;  4BVX B;  1TK0 B;  3LOR A;  2MBS A;  3ZFB A;  2B3S A;  1GUM A;  4FYU A;  5FWG A;  4IW9 A;  3HVS A;  3W6G A;  3FR6 A;  4KSM A;  2BTO T;  4IP6 A;  1ST9 A;  1SKS B;  4RQR A;  4FO5 A;  4L5O A;  2XBQ A;  12GS A;  4V1A p;  1K0C A;  2D2Z A;  1XBS A; 
#chains in the Genus database with same CATH topology
 4KCE A;  3F3R A;  4K5R A;  5IOX A;  3ZRE A;  1OC8 A;  2B1L A;  2CQ9 A;  1GUK A;  2XBI A;  3ZTL A;  2H1B A;  2HSH A;  3FRC A;  5IMF A;  2WS2 A;  4OFT A;  5ECR B;  3O3T A;  2FWF A;  2P0G A;  5F0G A;  1O8W A;  2B6M A;  1U3I A;  4HQZ A;  5A34 A;  1WJK A;  4TRX A;  3GH6 A;  1XOB A;  1BED A;  2BMX A;  1Z7P A;  1OVN A;  3LXT A;  3ZMK A;  1Q4J A;  3MWH A;  2DIZ A;  4HU9 A;  1TP9 A;  1SL0 B;  3M9K A;  2BJX A;  5D93 A;  3TKS E;  4I2T A;  9GSS A;  4AJ7 A;  4X0X A;  3LYP A;  2ON7 A;  1ERU A;  2EIQ A;  2N5F A;  2O8V B;  1PRX A;  2HXK A;  2MZC A;  4EO3 A;  5ID2 B;  3H1N A;  3GX0 A;  1PFO A;  1JZO A;  3A5I A;  2DSA A;  2LJR A;  4N3Z A;  2V1M A;  3DXB A;  4N0V A;  5F07 A;  3M3M A;  1S3R A;  2RLI A;  3R3E A;  2JAC A;  2B7J A;  1M9B A;  2QA2 A;  4OD7 A;  3APQ A;  3C73 A;  2GDR A;  2WJU A;  2V2G A;  3VPQ A;  2VLT A;  2H70 A;  2X64 A;  2ZCT A;  3JCM L;  1GSY A;  4FXY P;  1VF3 A;  3ZFL A;  3TJJ A;  4BIK A;  4HI7 A;  3ZYW A;  2OE3 A;  1LU4 A;  3FYG A;  1XWG A;  1SJ6 A;  5KOX A;  3VLN A;  4HJ2 A;  5CRG A;  3RPP A;  5LCZ A;  2JSY A;  1GSD A;  4RQX A;  4K1F A;  5L71 A;  1CQG A;  3UMA A;  4ZL8 A;  2LRC A;  2AUV A;  3MYD A;  2FY6 A;  3NIV A;  1XWA A;  1PN9 A;  3EIN A;  4BWQ A;  4HZ4 A;  2HI7 A;  1OKD A;  2DJ1 A;  1ACV A;  3GUS A;  1U3A A;  2H8L A;  5EPF A;  2WVZ A;  3A2V A;  2LJK A;  3G7I A;  4G19 A;  2YN1 A;  1QK8 A;  3NOF A;  5A34 B;  3BJ5 A;  4EL1 A;  4ZL7 A;  1T8E B;  2FWE A;  1X0R A;  8GSS A;  3IPZ A;  2DJ3 A;  3E9J B;  1A0R P;  4XRA A;  1EV4 A;  2LRT A;  4XHM A;  2TIR A;  3EMX A;  1S3C A;  5H5Q A;  2LJA A;  1CQH A;  2GTU A;  3TKS A;  2CAI A;  2FA4 A;  2H01 A;  2N5A A;  1GNW A;  4WXT A;  1I9D A;  2A2R A;  1GL8 A;  3U6V A;  2V6K A;  3PIN A;  2H72 A;  4XRD A;  3GMF A;  5GSS A;  3CRU A;  2C0F A;  4WF4 A;  1B9Y C;  2YAN A;  3ERF A;  2IIY A;  2FWH A;  4I2U A;  4XIH A;  3FEU A;  4G01 A;  4PI2 C;  2VCQ A;  2XHF A;  2VKZ G;  2NBS A;  3KP8 A;  3EU4 A;  1N25 A;  4MP4 A;  4Q5F A;  3TJG A;  3E3E A;  4FQU A;  1BG1 A;  5E4W A;  1BX9 A;  4CHS A;  5F8B A;  4PNG A;  2PWJ A;  4D73 A;  4DSQ A;  2VL2 A;  4PX1 A;  3HHV A;  1TXX A;  5ENU A;  4OFM A;  2ZNM A;  2EC4 A;  3GN3 A;  4BWS A;  1FB0 A;  2DJ2 A;  1OC3 A;  3MNG A;  2YV7 A;  4EIP A;  3KP9 A;  5JWR B;  3QPM A;  6GST A;  4HOJ A;  3HVV A;  4NPB A;  3BOA A;  3D5J A;  4F0B A;  1XWC A;  1TW9 A;  5J41 A;  2L59 A;  5GAN D;  4IP1 A;  1GRX A;  1KEB A;  4Z2R A;  1ZCP A;  1SK2 A;  3DRN A;  1AUC A;  1THX A;  4Z2T A;  5A4W A;  1TOF A;  4KDX A;  4OCE A;  3I69 A;  3EYT A;  3HVN A;  4K9Z A;  3QOU A;  4DVC A;  1DUG A;  5IMV A;  1TRS A;  4RUV A;  1K0B A;  19GS A;  1FVK A;  2YWI A;  1E2Y A;  4F03 A;  1A0F A;  5LNK e;  3EMP A;  3D21 A;  4GXZ A;  1ILO A;  3U5R E;  2AB6 A;  2F3M A;  1MD4 A;  2OBI A;  5H5S A;  3HJM A;  2A2P A;  1HNA A;  2FLS A;  4YKG A;  3SBC A;  4AI6 A;  2MMZ A;  1BJX A;  2FHE A;  1EEM A;  2E7P A;  2FUG 2;  1XIY A;  4USS A;  3GIX A;  3LQ7 A;  2I81 A;  2CZ3 A;  3QFB C;  3I6A A;  2WUL A;  4XS1 A;  2H1D A;  2HQT A;  3WGE A;  4ECI A;  2R4V A;  5AIS A;  1VF1 A;  4ML1 A;  5DDL A;  2PU9 C;  1FW1 A;  4GRF A;  3UEM A;  1BAY A;  2LTK A;  1TRU A;  5H5R A;  3G9B A;  4GTU A;  3D0Z A;  1R5A A;  3LW9 A;  4JR6 A;  1QFN A;  2RM5 A;  2R6K A;  4NV2 A;  4ZXG A;  2MYG A;  3CXG A;  5G2Z A;  4IJI A;  1GLQ A;  5CAX A;  3F3Q A;  2GS3 A;  1FHE A;  4K6X A;  2L4C A;  1TXU A;  4D73 B;  5HR3 A;  2HT9 A;  3KZQ A;  5J4V A;  1XWB A;  4O5U A;  3RHB A;  5B6M A;  5C00 A;  4GST A;  2GSS A;  3US3 A;  5JCG A;  5J5N A;  2IJY A;  3ZL5 A;  3BBY A;  4MZB A;  1FB6 A;  5ELA A;  4POM A;  3ZZX A;  4JU5 A;  2H6X A;  5HR1 A;  5KOW A;  4ID0 A;  1J08 A;  5KN3 A;  3EE2 A;  1R26 A;  3BCI A;  3PGT A;  1KTE A;  2IME A;  2YJH A;  4P3Y B;  3TJF A;  3DGQ A;  4A5P A;  3IRA A;  3IK9 A;  2UZ8 A;  2WFC A;  1OE8 A;  3HCZ A;  3O6T A;  1DE1 A;  3CRT A;  5ECQ B;  4ICY A;  4QQ7 A;  1UC7 A;  3VWV A;  3GSS A;  5ECO B;  3VWX A;  1XW9 A;  1C72 A;  1I1I P;  3IE3 A;  1T4Z A;  5J4U A;  1K0M A;  3TOU A;  4ECC A;  5J9B A;  3GTU A;  2H6Z A;  1Z6N A;  1GNE A;  3L78 A;  1TU7 A;  2B5Y A;  3PH9 A;  2IMD A;  4N10 A;  2R2J A;  4Q5N A;  2PN8 A;  1V58 A;  4KSO A;  1KNG A;  2ES7 A;  1SEN A;  1Z6M A;  2YWO A;  3CQF A;  2C80 A;  4MH3 A;  4PGT A;  3D22 A;  3DVX A;  1ZOF A;  1XW6 A;  1DE2 A;  5AN1 A;  2B7K A;  2KHP A;  1QXH A;  3CYN A;  4DEJ A;  4ACS A;  3EWL A;  2M80 A;  4EDY A;  3EUR A;  2AHE A;  2ZUP A;  3M9J A;  4POL A;  2VM1 A;  3MAK A;  1GSS A;  3UAR A;  4NWY A;  14GS A;  1YZX A;  3QR6 A;  2IMI A;  4EXJ A;  2PVQ A;  2YOI A;  1V2A A;  2H76 A;  3IDV A;  4ZB7 A;  2DMM A;  4X1U A;  2CX3 A;  4NV5 A;  5G30 A;  5DBQ A;  1SD9 A;  5EY6 A;  3HDC A;  1A8L A;  2GVP A;  2CVK A;  5HR0 A;  2VO4 A;  4F82 A;  3H93 A;  3C1S A;  3UOM A;  1XZO A;  2PUK C;  1G6W A;  2L57 A;  3C7M A;  3Q18 A;  1Y1U A;  1A2J A;  3GST A;  4JED A;  7GSS A;  3GX8 A;  4CW9 A;  4E8E A;  3ZIV A;  3GKX A;  1JZW A;  3TGZ A;  4MZW A;  3GYK A;  1O6J A;  1YKA A;  2H0H A;  4WKW A;  1NSW A;  1W4V A;  3A3T A;  1NHO A;  5ECS A;  5IIZ A;  2WW2 A;  3F4R A;  1XPV A;  2DJK A;  3PPU A;  3GFK A;  1Y25 A;  1F6M C;  3CSJ A;  1UN2 A;  4MF7 A;  3LGC A;  1BG5 A;  1H75 A;  4EF0 A;  2RII A;  2X99 A;  3HXS A;  3FK8 A;  3GTU B;  1YDK A;  4FYC A;  5CP1 A;  3VWW A;  4MA9 A;  5DQY A;  5DVB A;  2LQQ A;  4MJE A;  5IQY A;  4IJ3 A;  1YEP A;  2CZ2 A;  5KN2 A;  2H74 A;  5F06 A;  1ML6 A;  4AKG A;  4PQI A;  1GTB A;  2KUC A;  1OC9 A;  1YKC A;  2WZS A;  1A2M A;  1TK8 B;  2VD1 A;  2GLR A;  5ECK B;  5G5E A;  4WET A;  3VPT A;  1AQX A;  4ILF A;  3IC8 A;  4ULX A;  4EC0 A;  5DJL A;  5B8A A;  2FGX A;  3KH7 A;  5HFG A;  2WDU A;  1B9X C;  2H6Y A;  4O92 A;  3FR9 A;  4EE0 A;  4GF0 A;  1R4W A;  5GST A;  2O85 A;  1ZYQ B;  5IMA A;  1PX7 A;  1ABA A;  2Z9S A;  3ZIT A;  3L0H A;  5B7C A;  3WGD A;  2GQL A;  1RK4 A;  2VOC A;  2HSN A;  3J7Y k;  1IYH A;  3IR4 A;  2P5R A;  4ZB9 A;  1YF1 A;  1O85 A;  3VWU A;  4HZ2 A;  2B1K A;  2X4A A;  4TR1 A;  2GST A;  2GSQ A;  3M8N A;  5DAL A;  2YNX A;  1NHY A;  1XG8 A;  4JZQ A;  1E6B A;  6GSW A;  4NAX A;  3NZN A;  3F6D A;  2I1U A;  1MEK A;  1TK5 B;  2J23 A;  4K2D A;  4F9Z A;  2HRK A;  3HZ4 A;  3W8J A;  4J57 E;  2VLU A;  3F9U A;  4XS6 A;  3RAZ A;  5EL8 A;  1S4B P;  3TOT A;  4OO4 A;  1Y6E A;  4IS0 A;  4MPG A;  1JZD A;  3TU3 B;  3HVX A;  2DJ0 A;  2RM6 A;  2B5X A;  3TKQ A;  4PHZ C;  2XC2 A;  2XPD A;  5GAP D;  4IHU A;  1B4P A;  4QL7 A;  4W66 A;  1O7U A;  2VUP A;  1G0T A;  2MMA A;  1SJI A;  3H79 A;  2ON5 A;  2EIO A;  2R37 A;  3G7Y A;  1OC9 B;  4GQC A;  5IOW A;  2DKI A;  1HQO A;  2FWG A;  3FHK A;  1WE0 A;  4H86 A;  3WD6 A;  3RBT A;  2O87 A;  1SVO A;  1QMV A;  1QGV A;  1PGT A;  2WCI A;  4O7H A;  4TN8 A;  3GL3 A;  3F63 A;  1TKD B;  4KND A;  3WYW A;  5AGY A;  2X8H A;  3TKP A;  3LEF A;  1JHB A;  4OFN A;  1YEW C;  4L0U A;  3HJP A;  2XPE A;  3IBH A;  3E0U A;  3LSZ A;  1XWK A;  2YV9 A;  2JZT A;  1XFL A;  3IAM 2;  3M1G A;  2HSN B;  2VIM A;  1FO5 A;  1BQ7 A;  1YEX A;  3HA9 A;  1F37 A;  1TJD A;  5ECL B;  4TR1 B;  5CRW A;  5KN0 A;  5INY A;  4V2L A;  5DAL B;  2H66 A;  2REM A;  2WRT A;  1M2A A;  2MMN A;  5AIX A;  4HS1 A;  2VCX A;  3GKN A;  1M0U A;  3HKR A;  1UVZ A;  20GS A;  2WB9 A;  2MBT A;  4TR4 A;  1GTA A;  4RI7 A;  1F3B A;  3F4T A;  1YY7 A;  1N2A A;  4PUA A;  2FCH A;  3UL3 A;  2L6C A;  2HRK B;  1GP1 A;  1K0A A;  5EVO A;  2I9H A;  3MIX A;  1B8X A;  2HNL A;  5HFI A;  5G1L A;  5BRT A;  4KDU A;  2WW0 A;  3EVI A;  4TW5 A;  3VUR A;  1T1V A;  4ML6 A;  3L4N A;  3TDG A;  2K8V A;  4ZB8 A;  3RDW A;  1GSU A;  2L6D A;  5J3R A;  4V2M A;  1VRS D;  2OBK A;  2A4H A;  3Q19 A;  4ZB6 A;  3L9S A;  1MTC A;  2H19 A;  4KE3 A;  2RUF A;  5J47 A;  3F6F A;  4E68 A;  1SYR A;  1HNC A;  1M7T A;  17GS A;  2VCT A;  3QAG A;  1K3O A;  2PER A;  4G0I A;  2KLX A;  4KB3 A;  1ZL9 A;  2HSY A;  3QAW A;  1FG4 A;  2CT6 A;  3P8W A;  3C71 A;  5CO3 A;  3D6I A;  3CWG A;  4N11 A;  4LMV A;  5CRH A;  3HJO A;  6GSY A;  1N8J A;  1PKW A;  5ECI B;  2CAQ A;  3KH9 A;  2RUE A;  1AW9 A;  3DML A;  2EFE A;  2IFQ A;  4MK3 A;  3FKF A;  4PTS A;  1FOH A;  2M46 A;  2V32 A;  5FHI A;  3VI5 A;  3TRX A;  1M2B A;  4KH7 A;  1GH2 A;  2GQK A;  1G6Y A;  3UIW A;  2E2M A;  4KUN A;  1K0O A;  1SYX A;  3QDN A;  5CRD A;  4KDY A;  4ZIJ A;  3GV1 A;  13GS A;  5J9C A;  3H8Q A;  4K7I A;  1LJR A;  3KGK A;  3FZ4 A;  1U6T A;  4FH8 A;  4G0K A;  2H1L A;  5G5F A;  4AJ8 A;  2WVX A;  1ZYN A;  1EWX A;  5IMZ A;  1YQ1 A;  4IEL A;  4IQA A;  1A23 A;  2IPA A;  4I5Q A;  2EFC A;  4V2N A;  2CA8 A;  4LL1 B;  3HD5 A;  3IV4 A;  4J2F A;  2A2S A;  1A2L A;  4OMV A;  4K2X A;  1BYE A;  4HU7 A;  4LLR A;  3KIJ A;  2F9S A;  3VK9 A;  3KM6 A;  1SD8 A;  2HLS A;  1WOU A;  3SWL A;  5B8B A;  6GSU A;  4F0C A;  6GSS A;  5J4Y A;  1AC1 A;  4MJB A;  3I43 A;  2OAD A;  4OWY A;  2E0Q A;  4OO5 A;  4X43 A;  4E8H A;  1T7P B;  5GZZ B;  1SKW B;  1FVJ A;  3GRX A;  3DVW A;  3EPT A;  4YKF A;  4PUR A;  4XCS A;  4KX4 A;  5ECM B;  5KN1 A;  4J56 E;  2OA7 A;  5D73 A;  1EGO A;  2C8U A;  1EGR A;  3FW2 A;  5COH A;  4YH2 A;  2F8A A;  1A8Y A;  2V6O A;  3D4T A;  4DSR A;  1Z3E A;  2HRF A;  1X5E A;  4KA0 A;  3KTB A;  3KD0 A;  1GSE A;  2IFQ B;  1M3J A;  1SK1 A;  1O81 A;  3Q6O A;  4L0W A;  3ZLP A;  2HFD A;  2GSR A;  1Z5Y E;  2GZP A;  4AKI A;  4AKX B;  2X8C A;  3EU3 A;  3WGX A;  2FD3 A;  2PBJ A;  3AY8 A;  4HJM A;  2DBC A;  4K7N A;  2ALB A;  2AV4 A;  2B5E A;  4LA1 A;  1S3A A;  3OR5 A;  5J40 A;  3L9U A;  2HRA A;  2K6V A;  4DSS A;  5HFK A;  5HQP A;  2L4Q A;  1WWJ A;  1T00 A;  1VF4 A;  4TXV A;  4Z7X A;  3QMX A;  3Q74 A;  2DKH A;  3GL5 A;  4EIQ A;  4MDC A;  2CVD A;  3A2W A;  4EDZ A;  2WVX B;  3UJ1 A;  3KXO A;  3QD9 A;  3CSH A;  2C3T A;  1V9W A;  4PNF A;  3FZ9 A;  2HRN A;  3KEB A;  3TKR A;  1Z9H A;  2H73 A;  3QCP A;  4K0N A;  1DBY A;  4N0Z A;  2L5L A;  4ECB A;  16GS A;  2JZS A;  3CMI A;  1M3I A;  4WR4 A;  5A4V A;  1MDK A;  3QFA C;  2DML A;  1SVM A;  4O5R A;  1PKZ A;  2LST A;  1HNB A;  1SKR B;  2MMO A;  5CYY A;  1ON4 A;  4I8B A;  3TKS C;  1GTU A;  1GUH A;  2IN3 A;  4KGI A;  5G1K A;  1OE7 A;  2K8S A;  1GUL A;  4YQV A;  1YVL A;  2WGR A;  4WBJ A;  2YP6 A;  2C3Q A;  1U87 A;  2C4J A;  5AIV A;  3ZVJ A;  3F8U A;  4MAB A;  4BVY A;  4BL7 A;  6GSV A;  5D9W A;  4LL4 B;  3ZRD A;  1XXU A;  2HZE A;  4I97 A;  4F2I A;  2GZY A;  5IMC A;  4JBB A;  3S9F A;  2VM2 A;  2EFD A;  3RFR C;  5E59 A;  1EOG A;  2OE0 A;  4HDE A;  3ZVJ D;  4G2E A;  3P7X A;  4GCI A;  2NPB A;  3UBL A;  5IPH A;  1THO A;  3P90 A;  3HYP A;  2L5O A;  2IMK A;  2VL2 C;  4JE1 A;  4KW6 A;  2X8G A;  4YQU A;  1O73 A;  1EZK A;  10GS A;  2JZR A;  1K3L A;  3LFL A;  4DSS B;  4MPF A;  4IKH A;  5IO0 A;  1URM A;  2TRC P;  2JU5 A;  3K8N A;  2JSZ A;  4YAP A;  4QL9 A;  2LS5 A;  1ERV A;  2H75 A;  3J7Y b;  2JL4 A;  5DCH A;  4WBR D;  2VCV A;  4PXO A;  3TUE A;  2CX4 A;  4N30 A;  1T4Y A;  3IA1 A;  2O3E A;  1F3A A;  3LYK A;  4Z2U A;  2QKE A;  4G9H A;  1RW1 A;  2QC7 A;  2EFH A;  2LRN A;  4KF9 A;  2LNT A;  3DKS A;  5CRE A;  1NM3 A;  2R0C A;  3CTG A;  1GTI A;  2GQM A;  4AF2 A;  2C0D A;  2P31 A;  4ZL9 A;  3IK7 A;  1IYI A;  2YWN A;  2O5V A;  2PPT A;  2GT6 A;  2C0G A;  1TDI A;  1S3D A;  2O36 A;  1PQN A;  1MDI A;  3LG6 A;  5BMU A;  3GKK A;  2H0I A;  3A5W A;  5HR2 A;  1PN0 A;  1SJZ A;  1M9A A;  1PL1 A;  2FA8 A;  5JCW A;  1K3Y A;  1UA5 A;  1TI3 A;  3ZML A;  3HZ8 A;  1GWC A;  4XTS A;  5D9X A;  2IWT A;  1QQ2 A;  3GHA A;  5JWO B;  4BVY B;  4BL7 B;  1FAA A;  2NTO A;  2HZE B;  2YJ7 A;  3IOS A;  1YJ6 A;  4L5L A;  1AQV A;  3TB2 A;  2OKA A;  3APO A;  1EP7 A;  4WF5 A;  4AGS A;  4MNN A;  2HYX A;  2H30 A;  3V1W A;  2PVO C;  3MDK A;  4JRR A;  5IO2 A;  5D96 A;  1H4O A;  5D8I A;  22GS A;  4GDF A;  4ECJ A;  1ERT A;  2O89 A;  2HE3 A;  1RQM A;  1PD2 1;  2G2Q A;  4CDO A;  3RHC A;  1V98 A;  1K0N A;  4K0G A;  3VI7 A;  3M0F A;  2GGT A;  3G7J A;  2O7K A;  1W89 A;  4NHW A;  2F51 A;  1SK0 A;  3PR8 A;  4Q5R A;  4EUY A;  1EV9 A;  3DWV A;  2VLV A;  1LBK A;  3IXR A;  4MH2 A;  1WRY A;  2EIR A;  2GZZ A;  1A24 A;  1EP8 A;  2LEG A;  3FZA A;  4JR4 A;  2J9H A;  2R5G A;  4OCF A;  4GQF A;  1SL2 B;  2UV8 G;  2DIY A;  1WIK A;  1SVL A;  4FYB A;  3KCM A;  1EEJ A;  2HSM A;  5F05 A;  5ECH B;  5JCU A;  4BPY A;  3KMN A;  2P5Q A;  4XS4 A;  1TRV A;  5BMU B;  1B48 A;  5ABR A;  3FR3 A;  2R0P A;  5A1N A;  1OKT A;  2DJJ A;  4EKZ A;  2DLX A;  2VL9 A;  1AIU A;  1K0D A;  3IHG A;  3ME8 A;  2QGV A;  3RPN A;  2CV4 A;  1XCC A;  3TRQ A;  4KAE A;  1MDJ A;  4NMU A;  2AJQ B;  2LUS A;  4G10 A;  2R0G A;  4PI0 C;  1O8X A;  2WW1 A;  4GSS A;  1XOA A;  4MMM A;  6GSX A;  1Q98 A;  4NXI A;  4NHZ A;  3ZIJ A;  4TR3 A;  3GKM A;  2IMF A;  3TCO A;  1WP0 A;  2KOK A;  4K7O A;  2FNO A;  3RGB C;  1V57 A;  3APS A;  3O76 A;  4ISD A;  4MF5 A;  2HZF A;  5A5H A;  2KP2 A;  2OE1 A;  3D4M A;  3UVT A;  1GSF A;  1X9M B;  4TR0 A;  4TKY A;  1V40 A;  3ERG A;  1QUW A;  5IMD A;  2TRX A;  3P2A A;  1J0F A;  1J9B A;  4IVF A;  4PQ1 A;  3TJK A;  1VGL A;  2NDO A;  4KCA A;  1X9W B;  3IHQ A;  11GS A;  4MJC A;  1G7O A;  3C8E A;  5ELG A;  3DD3 A;  3ISO A;  3WT2 A;  2LKU A;  5JWQ B;  4GSN A;  4ZBA A;  4HEA 2;  4ZBB A;  2A4V A;  5D9V A;  2QA1 A;  4MZC A;  1TI1 A;  1ZYE A;  4AJ6 A;  1DSB A;  1PMT A;  1TTZ A;  2I3Y A;  1I5G A;  3I9V 2;  5DAK A;  2HSM B;  2GT5 A;  2M72 A;  4PQH A;  1T3B A;  3BCK A;  4K8M A;  1JFU A;  2YZU A;  1KBN A;  3L9V A;  5DCG A;  2KP1 A;  3ERW A;  4MCU A;  4XS4 B;  4GLT A;  1AXD A;  1WMJ A;  2H1G A;  5B6N A;  5A1N B;  2OAC A;  1MD3 A;  3F0I A;  3GNJ A;  3FZ5 A;  3BD2 A;  1ZZY A;  3HY2 A;  4AKH A;  1GLP A;  1U88 A;  4TXO A;  4Q5Q A;  5KEJ A;  2WVY A;  4G0L A;  4POK A;  3QAV A;  5DJM A;  2WW3 A;  1OAZ A;  1JLV A;  2N5B A;  3GUR A;  4TOP A;  4POB A;  1F2E A;  2X49 A;  3F4S A;  5ECP B;  1ZYP A;  2JAD A;  4BA7 A;  2C0E A;  2F8F A;  3MSZ A;  4GWR A;  2CVB A;  4IGJ A;  3UBK A;  2VCW A;  3N5O A;  5A5H B;  1NW2 A;  3FY7 A;  5LD0 A;  5A5K A;  3DYR A;  3VFI A;  2YPM A;  1G7E A;  2C3N A;  1YF0 A;  1X9S B;  3LJR A;  2H0G A;  2WZ9 A;  3IC4 A;  3ED3 A;  5CNW A;  1ZGN A;  4MF6 A;  2VAF A;  3WT1 A;  1OYJ A;  4IBP A;  2V41 A;  5A4U A;  1SL1 B;  1XVQ A;  2DC5 A;  2AYT A;  3CSI A;  1HD2 A;  1ZMA A;  2OT3 A;  2H1A A;  4BVX A;  1SU9 A;  4WR5 A;  2VCZ A;  2E2G A;  4IN0 A;  4O5Q A;  3KJY A;  4IQ1 A;  2LNS A;  2K18 A;  3DEX A;  4EVM A;  1R7H A;  3ME7 A;  2VD0 A;  5C04 A;  18GS A;  4RI6 A;  2R3X A;  4TVE A;  1EOH A;  2I4A A;  1M2D A;  1PSQ A;  1XVW A;  1USB A;  4X4J A;  4L8E A;  1HYU A;  2C1Y A;  1PA3 A;  4PUF C;  1XW5 A;  4MLY A;  2OJL A;  5FT3 A;  5DAK B;  2AAW A;  3R2Q A;  4FIW A;  4CY8 A;  5G31 A;  1X5C A;  2NVL A;  4ZBD A;  4HSC X;  2PGT A;  4ZIL A;  3LXZ A;  3LWA A;  4HQS A;  1R5P A;  3DIE A;  1ERW A;  3FMW A;  1PL2 A;  3UVH A;  4V1A g;  1WPI A;  1Z7R A;  3TRP A;  4TXO B;  5ECN B;  3H4K A;  1AAZ A;  2K9F A;  4LMW A;  3GA4 A;  5IM9 A;  2IL3 A;  1M99 A;  3CBU A;  1GSQ A;  1F9M A;  3KTL A;  4YQM A;  1BF5 A;  3GH9 A;  1PX6 A;  4MJA A;  2LQO A;  2H71 A;  4I6X A;  4YAV A;  2YWM A;  3TJB A;  1X5D A;  4WEY A;  5ID2 A;  3UAP A;  3A2X A;  3EC3 A;  1VF2 A;  3IAS 2;  2PMT A;  4HUA A;  2G0F A;  1FOV A;  5DQS A;  2QSI A;  1JLW A;  4QMK A;  3W8S A;  1TRW A;  5IPG A;  1B4Q A;  3KMO A;  4CY6 A;  4K5S A;  4O32 A;  2LV3 A;  2YCD A;  1AQW A;  3CTF A;  2VL3 A;  1JZR A;  3CHX C;  1TU8 A;  3N9J A;  2YZH A;  5D9T A;  3C1R A;  4BVX B;  1TK0 B;  3LOR A;  2MBS A;  3HMJ G;  3ZFB A;  2B3S A;  1GUM A;  4FYU A;  5FWG A;  4IW9 A;  3HVS A;  3W6G A;  3FR6 A;  4KSM A;  2BTO T;  4IP6 A;  1ST9 A;  1SKS B;  4RQR A;  4FO5 A;  4L5O A;  2XBQ A;  12GS A;  4V1A p;  1K0C A;  2D2Z A;  1XBS A; 
#chains in the Genus database with same CATH homology
 4KCE A;  3F3R A;  4K5R A;  5IOX A;  3ZRE A;  1OC8 A;  2B1L A;  2CQ9 A;  1GUK A;  2XBI A;  3ZTL A;  2H1B A;  2HSH A;  3FRC A;  5IMF A;  2WS2 A;  4OFT A;  5ECR B;  3O3T A;  2FWF A;  2P0G A;  5F0G A;  1O8W A;  2B6M A;  1U3I A;  4HQZ A;  5A34 A;  1WJK A;  4TRX A;  3GH6 A;  1XOB A;  1BED A;  2BMX A;  1Z7P A;  1OVN A;  3LXT A;  3ZMK A;  1Q4J A;  3MWH A;  2DIZ A;  4HU9 A;  1TP9 A;  1SL0 B;  3M9K A;  2BJX A;  5D93 A;  3TKS E;  4I2T A;  9GSS A;  4AJ7 A;  4X0X A;  3LYP A;  2ON7 A;  1ERU A;  2EIQ A;  2N5F A;  2O8V B;  1PRX A;  2HXK A;  2MZC A;  4EO3 A;  5ID2 B;  3H1N A;  3GX0 A;  1JZO A;  3A5I A;  2DSA A;  2LJR A;  4N3Z A;  2V1M A;  3DXB A;  4N0V A;  5F07 A;  3M3M A;  2RLI A;  3R3E A;  2JAC A;  2B7J A;  1M9B A;  2QA2 A;  4OD7 A;  3APQ A;  3C73 A;  2GDR A;  2WJU A;  2V2G A;  3VPQ A;  2VLT A;  2H70 A;  2X64 A;  2ZCT A;  3JCM L;  1GSY A;  1VF3 A;  3ZFL A;  3TJJ A;  4HI7 A;  3ZYW A;  2OE3 A;  1LU4 A;  3FYG A;  1XWG A;  1SJ6 A;  5KOX A;  3VLN A;  4HJ2 A;  5CRG A;  3RPP A;  5LCZ A;  2JSY A;  1GSD A;  4RQX A;  4K1F A;  5L71 A;  1CQG A;  3UMA A;  4ZL8 A;  2LRC A;  2AUV A;  3MYD A;  2FY6 A;  3NIV A;  1XWA A;  1PN9 A;  3EIN A;  4BWQ A;  4HZ4 A;  2HI7 A;  1OKD A;  2DJ1 A;  1ACV A;  3GUS A;  1U3A A;  2H8L A;  5EPF A;  3A2V A;  2LJK A;  3G7I A;  4G19 A;  2YN1 A;  1QK8 A;  3NOF A;  5A34 B;  3BJ5 A;  4EL1 A;  4ZL7 A;  1T8E B;  2FWE A;  1X0R A;  8GSS A;  3IPZ A;  2DJ3 A;  3E9J B;  1A0R P;  4XRA A;  1EV4 A;  2LRT A;  4XHM A;  2TIR A;  3EMX A;  1S3C A;  5H5Q A;  2LJA A;  1CQH A;  2GTU A;  3TKS A;  2CAI A;  2FA4 A;  2H01 A;  2N5A A;  1GNW A;  4WXT A;  1I9D A;  2A2R A;  1GL8 A;  3U6V A;  2V6K A;  3PIN A;  2H72 A;  4XRD A;  3GMF A;  5GSS A;  3CRU A;  2C0F A;  4WF4 A;  1B9Y C;  2YAN A;  3ERF A;  2IIY A;  2FWH A;  4I2U A;  4XIH A;  3FEU A;  4G01 A;  2VCQ A;  2XHF A;  2VKZ G;  2NBS A;  3KP8 A;  3EU4 A;  1N25 A;  4MP4 A;  4Q5F A;  3TJG A;  3E3E A;  4FQU A;  1BG1 A;  5E4W A;  1BX9 A;  4CHS A;  5F8B A;  4PNG A;  2PWJ A;  4D73 A;  4DSQ A;  2VL2 A;  4PX1 A;  3HHV A;  1TXX A;  5ENU A;  4OFM A;  2ZNM A;  2EC4 A;  3GN3 A;  4BWS A;  1FB0 A;  2DJ2 A;  1OC3 A;  3MNG A;  2YV7 A;  4EIP A;  3KP9 A;  5JWR B;  3QPM A;  6GST A;  4HOJ A;  3HVV A;  4NPB A;  3BOA A;  3D5J A;  4F0B A;  1XWC A;  1TW9 A;  5J41 A;  2L59 A;  5GAN D;  4IP1 A;  1GRX A;  1KEB A;  4Z2R A;  1ZCP A;  1SK2 A;  3DRN A;  1AUC A;  1THX A;  4Z2T A;  5A4W A;  1TOF A;  4KDX A;  4OCE A;  3I69 A;  3EYT A;  4K9Z A;  3QOU A;  4DVC A;  1DUG A;  5IMV A;  1TRS A;  4RUV A;  1K0B A;  19GS A;  1FVK A;  2YWI A;  1E2Y A;  4F03 A;  1A0F A;  5LNK e;  3EMP A;  3D21 A;  4GXZ A;  1ILO A;  3U5R E;  2AB6 A;  2F3M A;  1MD4 A;  2OBI A;  5H5S A;  3HJM A;  2A2P A;  1HNA A;  2FLS A;  4YKG A;  3SBC A;  4AI6 A;  2MMZ A;  1BJX A;  2FHE A;  1EEM A;  2E7P A;  2FUG 2;  1XIY A;  4USS A;  3GIX A;  3LQ7 A;  2I81 A;  2CZ3 A;  3QFB C;  3I6A A;  2WUL A;  4XS1 A;  2H1D A;  2HQT A;  3WGE A;  4ECI A;  2R4V A;  5AIS A;  1VF1 A;  4ML1 A;  5DDL A;  2PU9 C;  1FW1 A;  4GRF A;  3UEM A;  1BAY A;  2LTK A;  1TRU A;  5H5R A;  3G9B A;  4GTU A;  3D0Z A;  1R5A A;  3LW9 A;  4JR6 A;  1QFN A;  2RM5 A;  2R6K A;  4NV2 A;  4ZXG A;  2MYG A;  3CXG A;  5G2Z A;  4IJI A;  1GLQ A;  5CAX A;  3F3Q A;  2GS3 A;  1FHE A;  4K6X A;  2L4C A;  1TXU A;  4D73 B;  5HR3 A;  2HT9 A;  3KZQ A;  5J4V A;  1XWB A;  4O5U A;  3RHB A;  5B6M A;  5C00 A;  4GST A;  2GSS A;  3US3 A;  5JCG A;  5J5N A;  2IJY A;  3ZL5 A;  3BBY A;  4MZB A;  1FB6 A;  5ELA A;  4POM A;  3ZZX A;  4JU5 A;  2H6X A;  5HR1 A;  5KOW A;  4ID0 A;  1J08 A;  5KN3 A;  3EE2 A;  1R26 A;  3BCI A;  3PGT A;  1KTE A;  2IME A;  2YJH A;  4P3Y B;  3TJF A;  3DGQ A;  4A5P A;  3IRA A;  3IK9 A;  2UZ8 A;  2WFC A;  1OE8 A;  3HCZ A;  3O6T A;  1DE1 A;  3CRT A;  5ECQ B;  4ICY A;  4QQ7 A;  1UC7 A;  3VWV A;  3GSS A;  5ECO B;  3VWX A;  1XW9 A;  1C72 A;  3IE3 A;  1T4Z A;  5J4U A;  1K0M A;  3TOU A;  4ECC A;  5J9B A;  3GTU A;  2H6Z A;  1Z6N A;  1GNE A;  3L78 A;  1TU7 A;  2B5Y A;  3PH9 A;  2IMD A;  4N10 A;  2R2J A;  4Q5N A;  2PN8 A;  1V58 A;  4KSO A;  1KNG A;  2ES7 A;  1SEN A;  1Z6M A;  2YWO A;  2C80 A;  4MH3 A;  4PGT A;  3D22 A;  3DVX A;  1ZOF A;  1XW6 A;  1DE2 A;  5AN1 A;  2B7K A;  2KHP A;  1QXH A;  3CYN A;  4DEJ A;  4ACS A;  3EWL A;  2M80 A;  4EDY A;  3EUR A;  2AHE A;  2ZUP A;  3M9J A;  4POL A;  2VM1 A;  3MAK A;  1GSS A;  3UAR A;  4NWY A;  14GS A;  1YZX A;  3QR6 A;  2IMI A;  4EXJ A;  2PVQ A;  2YOI A;  1V2A A;  2H76 A;  3IDV A;  4ZB7 A;  2DMM A;  4X1U A;  2CX3 A;  4NV5 A;  5G30 A;  5DBQ A;  1SD9 A;  5EY6 A;  3HDC A;  1A8L A;  2GVP A;  2CVK A;  5HR0 A;  2VO4 A;  4F82 A;  3H93 A;  3C1S A;  3UOM A;  1XZO A;  2PUK C;  1G6W A;  2L57 A;  3C7M A;  3Q18 A;  1Y1U A;  1A2J A;  3GST A;  4JED A;  7GSS A;  3GX8 A;  4CW9 A;  4E8E A;  3ZIV A;  3GKX A;  1JZW A;  3TGZ A;  4MZW A;  3GYK A;  1O6J A;  1YKA A;  2H0H A;  4WKW A;  1NSW A;  1W4V A;  3A3T A;  1NHO A;  5ECS A;  5IIZ A;  3F4R A;  1XPV A;  2DJK A;  3PPU A;  3GFK A;  1Y25 A;  1F6M C;  3CSJ A;  1UN2 A;  4MF7 A;  3LGC A;  1BG5 A;  1H75 A;  4EF0 A;  2RII A;  2X99 A;  3HXS A;  3FK8 A;  3GTU B;  1YDK A;  4FYC A;  5CP1 A;  3VWW A;  4MA9 A;  5DQY A;  5DVB A;  2LQQ A;  4MJE A;  5IQY A;  4IJ3 A;  1YEP A;  2CZ2 A;  5KN2 A;  2H74 A;  5F06 A;  1ML6 A;  4AKG A;  4PQI A;  1GTB A;  2KUC A;  1OC9 A;  1YKC A;  1A2M A;  1TK8 B;  2VD1 A;  2GLR A;  5ECK B;  5G5E A;  4WET A;  3VPT A;  1AQX A;  4ILF A;  3IC8 A;  4ULX A;  4EC0 A;  5DJL A;  5B8A A;  2FGX A;  3KH7 A;  5HFG A;  2WDU A;  1B9X C;  2H6Y A;  4O92 A;  3FR9 A;  4EE0 A;  4GF0 A;  1R4W A;  5GST A;  2O85 A;  1ZYQ B;  5IMA A;  1PX7 A;  1ABA A;  2Z9S A;  3ZIT A;  3L0H A;  5B7C A;  3WGD A;  2GQL A;  1RK4 A;  2VOC A;  2HSN A;  3J7Y k;  1IYH A;  3IR4 A;  2P5R A;  4ZB9 A;  1YF1 A;  1O85 A;  3VWU A;  4HZ2 A;  2B1K A;  2X4A A;  4TR1 A;  2GST A;  2GSQ A;  3M8N A;  5DAL A;  2YNX A;  1NHY A;  4JZQ A;  1E6B A;  6GSW A;  4NAX A;  3NZN A;  3F6D A;  2I1U A;  1MEK A;  1TK5 B;  2J23 A;  4K2D A;  4F9Z A;  2HRK A;  3HZ4 A;  3W8J A;  4J57 E;  2VLU A;  3F9U A;  4XS6 A;  3RAZ A;  5EL8 A;  3TOT A;  4OO4 A;  1Y6E A;  4IS0 A;  4MPG A;  1JZD A;  3TU3 B;  3HVX A;  2DJ0 A;  2RM6 A;  2B5X A;  3TKQ A;  2XC2 A;  2XPD A;  5GAP D;  4IHU A;  1B4P A;  4QL7 A;  4W66 A;  1O7U A;  2VUP A;  1G0T A;  2MMA A;  1SJI A;  3H79 A;  2ON5 A;  2EIO A;  2R37 A;  3G7Y A;  1OC9 B;  4GQC A;  5IOW A;  2DKI A;  1HQO A;  2FWG A;  3FHK A;  1WE0 A;  4H86 A;  3WD6 A;  3RBT A;  2O87 A;  1SVO A;  1QMV A;  1QGV A;  1PGT A;  2WCI A;  4O7H A;  4TN8 A;  3GL3 A;  3F63 A;  1TKD B;  4KND A;  3WYW A;  5AGY A;  2X8H A;  3TKP A;  3LEF A;  1JHB A;  4OFN A;  4L0U A;  3HJP A;  2XPE A;  3IBH A;  3E0U A;  3LSZ A;  1XWK A;  2YV9 A;  2JZT A;  1XFL A;  3IAM 2;  3M1G A;  2HSN B;  2VIM A;  1FO5 A;  1BQ7 A;  1YEX A;  3HA9 A;  1F37 A;  1TJD A;  5ECL B;  4TR1 B;  5CRW A;  5KN0 A;  5INY A;  4V2L A;  5DAL B;  2H66 A;  2REM A;  2WRT A;  1M2A A;  2MMN A;  5AIX A;  4HS1 A;  2VCX A;  3GKN A;  1M0U A;  3HKR A;  1UVZ A;  20GS A;  2WB9 A;  2MBT A;  4TR4 A;  1GTA A;  4RI7 A;  1F3B A;  3F4T A;  1YY7 A;  1N2A A;  4PUA A;  2FCH A;  3UL3 A;  2L6C A;  2HRK B;  1GP1 A;  1K0A A;  5EVO A;  2I9H A;  3MIX A;  1B8X A;  2HNL A;  5HFI A;  5G1L A;  5BRT A;  4KDU A;  3EVI A;  4TW5 A;  3VUR A;  1T1V A;  4ML6 A;  3L4N A;  3TDG A;  2K8V A;  4ZB8 A;  3RDW A;  1GSU A;  2L6D A;  5J3R A;  4V2M A;  1VRS D;  2OBK A;  2A4H A;  3Q19 A;  4ZB6 A;  3L9S A;  1MTC A;  2H19 A;  4KE3 A;  2RUF A;  5J47 A;  3F6F A;  4E68 A;  1SYR A;  1HNC A;  1M7T A;  17GS A;  2VCT A;  3QAG A;  1K3O A;  2PER A;  4G0I A;  2KLX A;  4KB3 A;  1ZL9 A;  2HSY A;  3QAW A;  1FG4 A;  2CT6 A;  3P8W A;  3C71 A;  5CO3 A;  3D6I A;  3CWG A;  4N11 A;  4LMV A;  5CRH A;  3HJO A;  6GSY A;  1N8J A;  1PKW A;  5ECI B;  2CAQ A;  3KH9 A;  2RUE A;  1AW9 A;  3DML A;  2EFE A;  2IFQ A;  4MK3 A;  3FKF A;  4PTS A;  1FOH A;  2M46 A;  2V32 A;  5FHI A;  3VI5 A;  3TRX A;  1M2B A;  4KH7 A;  1GH2 A;  2GQK A;  1G6Y A;  3UIW A;  2E2M A;  4KUN A;  1K0O A;  1SYX A;  3QDN A;  5CRD A;  4KDY A;  4ZIJ A;  3GV1 A;  13GS A;  5J9C A;  3H8Q A;  4K7I A;  1LJR A;  3KGK A;  3FZ4 A;  1U6T A;  4FH8 A;  4G0K A;  2H1L A;  5G5F A;  4AJ8 A;  1ZYN A;  1EWX A;  5IMZ A;  1YQ1 A;  4IEL A;  4IQA A;  1A23 A;  2IPA A;  4I5Q A;  2EFC A;  4V2N A;  2CA8 A;  4LL1 B;  3HD5 A;  3IV4 A;  4J2F A;  2A2S A;  1A2L A;  4OMV A;  4K2X A;  1BYE A;  4HU7 A;  4LLR A;  3KIJ A;  2F9S A;  3VK9 A;  3KM6 A;  1SD8 A;  2HLS A;  1WOU A;  3SWL A;  5B8B A;  6GSU A;  4F0C A;  6GSS A;  5J4Y A;  1AC1 A;  4MJB A;  3I43 A;  2OAD A;  4OWY A;  2E0Q A;  4OO5 A;  4X43 A;  4E8H A;  1T7P B;  5GZZ B;  1SKW B;  1FVJ A;  3GRX A;  3DVW A;  3EPT A;  4YKF A;  4PUR A;  4XCS A;  4KX4 A;  5ECM B;  5KN1 A;  4J56 E;  2OA7 A;  5D73 A;  1EGO A;  2C8U A;  1EGR A;  3FW2 A;  5COH A;  4YH2 A;  2F8A A;  1A8Y A;  2V6O A;  3D4T A;  4DSR A;  1Z3E A;  2HRF A;  1X5E A;  4KA0 A;  3KTB A;  3KD0 A;  1GSE A;  2IFQ B;  1SK1 A;  1O81 A;  3Q6O A;  4L0W A;  3ZLP A;  2HFD A;  2GSR A;  1Z5Y E;  2GZP A;  4AKI A;  4AKX B;  2X8C A;  3EU3 A;  3WGX A;  2FD3 A;  2PBJ A;  3AY8 A;  4HJM A;  2DBC A;  4K7N A;  2ALB A;  2AV4 A;  2B5E A;  4LA1 A;  1S3A A;  3OR5 A;  5J40 A;  3L9U A;  2HRA A;  2K6V A;  4DSS A;  5HFK A;  5HQP A;  2L4Q A;  1WWJ A;  1T00 A;  1VF4 A;  4TXV A;  4Z7X A;  3QMX A;  3Q74 A;  2DKH A;  3GL5 A;  4EIQ A;  4MDC A;  2CVD A;  3A2W A;  4EDZ A;  3UJ1 A;  3KXO A;  3QD9 A;  3CSH A;  2C3T A;  1V9W A;  4PNF A;  3FZ9 A;  2HRN A;  3KEB A;  3TKR A;  1Z9H A;  2H73 A;  3QCP A;  4K0N A;  1DBY A;  4N0Z A;  2L5L A;  4ECB A;  16GS A;  2JZS A;  3CMI A;  4WR4 A;  5A4V A;  1MDK A;  3QFA C;  2DML A;  1SVM A;  4O5R A;  1PKZ A;  2LST A;  1HNB A;  1SKR B;  2MMO A;  5CYY A;  1ON4 A;  4I8B A;  3TKS C;  1GTU A;  1GUH A;  2IN3 A;  4KGI A;  5G1K A;  1OE7 A;  2K8S A;  1GUL A;  4YQV A;  1YVL A;  2WGR A;  4WBJ A;  2YP6 A;  2C3Q A;  1U87 A;  2C4J A;  5AIV A;  3ZVJ A;  3F8U A;  4MAB A;  4BVY A;  4BL7 A;  6GSV A;  5D9W A;  4LL4 B;  3ZRD A;  1XXU A;  2HZE A;  4I97 A;  4F2I A;  2GZY A;  5IMC A;  4JBB A;  3S9F A;  2VM2 A;  2EFD A;  5E59 A;  1EOG A;  2OE0 A;  4HDE A;  3ZVJ D;  4G2E A;  3P7X A;  4GCI A;  2NPB A;  3UBL A;  5IPH A;  1THO A;  3P90 A;  3HYP A;  2L5O A;  2IMK A;  2VL2 C;  4JE1 A;  4KW6 A;  2X8G A;  4YQU A;  1O73 A;  1EZK A;  10GS A;  2JZR A;  1K3L A;  3LFL A;  4DSS B;  4MPF A;  4IKH A;  5IO0 A;  1URM A;  2TRC P;  2JU5 A;  3K8N A;  2JSZ A;  4YAP A;  4QL9 A;  2LS5 A;  1ERV A;  2H75 A;  3J7Y b;  2JL4 A;  5DCH A;  4WBR D;  2VCV A;  4PXO A;  3TUE A;  2CX4 A;  4N30 A;  1T4Y A;  3IA1 A;  1F3A A;  3LYK A;  4Z2U A;  2QKE A;  4G9H A;  1RW1 A;  2QC7 A;  2EFH A;  2LRN A;  4KF9 A;  2LNT A;  3DKS A;  5CRE A;  1NM3 A;  2R0C A;  3CTG A;  1GTI A;  2GQM A;  4AF2 A;  2C0D A;  2P31 A;  4ZL9 A;  3IK7 A;  1IYI A;  2YWN A;  2O5V A;  2PPT A;  2GT6 A;  2C0G A;  1TDI A;  1S3D A;  1PQN A;  1MDI A;  3LG6 A;  5BMU A;  3GKK A;  2H0I A;  3A5W A;  5HR2 A;  1PN0 A;  1SJZ A;  1M9A A;  1PL1 A;  2FA8 A;  5JCW A;  1K3Y A;  1UA5 A;  1TI3 A;  3ZML A;  3HZ8 A;  1GWC A;  4XTS A;  5D9X A;  2IWT A;  1QQ2 A;  3GHA A;  5JWO B;  4BVY B;  4BL7 B;  1FAA A;  2NTO A;  2HZE B;  2YJ7 A;  3IOS A;  1YJ6 A;  4L5L A;  1AQV A;  3TB2 A;  2OKA A;  3APO A;  1EP7 A;  4WF5 A;  4AGS A;  4MNN A;  2HYX A;  2H30 A;  3V1W A;  2PVO C;  3MDK A;  4JRR A;  5IO2 A;  5D96 A;  1H4O A;  5D8I A;  22GS A;  4GDF A;  4ECJ A;  1ERT A;  2O89 A;  2HE3 A;  1RQM A;  1PD2 1;  2G2Q A;  4CDO A;  3RHC A;  1V98 A;  1K0N A;  4K0G A;  3VI7 A;  3M0F A;  2GGT A;  3G7J A;  2O7K A;  1W89 A;  4NHW A;  2F51 A;  1SK0 A;  3PR8 A;  4Q5R A;  4EUY A;  1EV9 A;  3DWV A;  2VLV A;  1LBK A;  3IXR A;  4MH2 A;  1WRY A;  2EIR A;  2GZZ A;  1A24 A;  1EP8 A;  2LEG A;  3FZA A;  4JR4 A;  2J9H A;  2R5G A;  4OCF A;  4GQF A;  1SL2 B;  2UV8 G;  2DIY A;  1WIK A;  1SVL A;  4FYB A;  3KCM A;  1EEJ A;  2HSM A;  5F05 A;  5ECH B;  5JCU A;  4BPY A;  3KMN A;  2P5Q A;  4XS4 A;  1TRV A;  5BMU B;  1B48 A;  5ABR A;  3FR3 A;  2R0P A;  5A1N A;  1OKT A;  2DJJ A;  4EKZ A;  2DLX A;  2VL9 A;  1AIU A;  1K0D A;  3IHG A;  3ME8 A;  2QGV A;  3RPN A;  2CV4 A;  1XCC A;  3TRQ A;  4KAE A;  1MDJ A;  4NMU A;  2AJQ B;  2LUS A;  4G10 A;  2R0G A;  1O8X A;  4GSS A;  1XOA A;  4MMM A;  6GSX A;  1Q98 A;  4NXI A;  4NHZ A;  3ZIJ A;  4TR3 A;  3GKM A;  2IMF A;  3TCO A;  1WP0 A;  2KOK A;  4K7O A;  2FNO A;  1V57 A;  3APS A;  3O76 A;  4ISD A;  4MF5 A;  2HZF A;  5A5H A;  2KP2 A;  2OE1 A;  3D4M A;  3UVT A;  1GSF A;  1X9M B;  4TR0 A;  4TKY A;  1V40 A;  3ERG A;  1QUW A;  5IMD A;  2TRX A;  3P2A A;  1J0F A;  1J9B A;  4IVF A;  4PQ1 A;  3TJK A;  1VGL A;  2NDO A;  4KCA A;  1X9W B;  3IHQ A;  11GS A;  4MJC A;  1G7O A;  3C8E A;  5ELG A;  3DD3 A;  3ISO A;  3WT2 A;  2LKU A;  5JWQ B;  4GSN A;  4ZBA A;  4HEA 2;  4ZBB A;  2A4V A;  5D9V A;  2QA1 A;  4MZC A;  1TI1 A;  1ZYE A;  4AJ6 A;  1DSB A;  1PMT A;  1TTZ A;  2I3Y A;  1I5G A;  3I9V 2;  5DAK A;  2HSM B;  2GT5 A;  2M72 A;  4PQH A;  1T3B A;  3BCK A;  4K8M A;  1JFU A;  2YZU A;  1KBN A;  3L9V A;  5DCG A;  2KP1 A;  3ERW A;  4MCU A;  4XS4 B;  4GLT A;  1AXD A;  1WMJ A;  2H1G A;  5B6N A;  5A1N B;  2OAC A;  1MD3 A;  3F0I A;  3GNJ A;  3FZ5 A;  3BD2 A;  1ZZY A;  3HY2 A;  4AKH A;  1GLP A;  1U88 A;  4TXO A;  4Q5Q A;  5KEJ A;  4G0L A;  4POK A;  3QAV A;  5DJM A;  1OAZ A;  1JLV A;  2N5B A;  3GUR A;  4TOP A;  4POB A;  1F2E A;  2X49 A;  3F4S A;  5ECP B;  1ZYP A;  2JAD A;  4BA7 A;  2C0E A;  2F8F A;  3MSZ A;  4GWR A;  2CVB A;  4IGJ A;  3UBK A;  2VCW A;  3N5O A;  5A5H B;  1NW2 A;  3FY7 A;  5LD0 A;  5A5K A;  3DYR A;  3VFI A;  2YPM A;  1G7E A;  2C3N A;  1YF0 A;  1X9S B;  3LJR A;  2H0G A;  2WZ9 A;  3IC4 A;  3ED3 A;  5CNW A;  1ZGN A;  4MF6 A;  2VAF A;  3WT1 A;  1OYJ A;  4IBP A;  2V41 A;  5A4U A;  1SL1 B;  1XVQ A;  2DC5 A;  2AYT A;  3CSI A;  1HD2 A;  1ZMA A;  2OT3 A;  2H1A A;  4BVX A;  1SU9 A;  4WR5 A;  2VCZ A;  2E2G A;  4IN0 A;  4O5Q A;  3KJY A;  4IQ1 A;  2LNS A;  2K18 A;  3DEX A;  4EVM A;  1R7H A;  3ME7 A;  2VD0 A;  5C04 A;  18GS A;  4RI6 A;  2R3X A;  4TVE A;  1EOH A;  2I4A A;  1M2D A;  1PSQ A;  1XVW A;  1USB A;  4X4J A;  4L8E A;  1HYU A;  2C1Y A;  1PA3 A;  4PUF C;  1XW5 A;  4MLY A;  2OJL A;  5FT3 A;  5DAK B;  2AAW A;  3R2Q A;  4FIW A;  4CY8 A;  5G31 A;  1X5C A;  2NVL A;  4ZBD A;  2PGT A;  4ZIL A;  3LXZ A;  3LWA A;  4HQS A;  1R5P A;  3DIE A;  1ERW A;  3FMW A;  1PL2 A;  3UVH A;  4V1A g;  1WPI A;  1Z7R A;  3TRP A;  4TXO B;  5ECN B;  3H4K A;  1AAZ A;  2K9F A;  4LMW A;  3GA4 A;  5IM9 A;  2IL3 A;  1M99 A;  3CBU A;  1GSQ A;  1F9M A;  3KTL A;  4YQM A;  1BF5 A;  3GH9 A;  1PX6 A;  4MJA A;  2LQO A;  2H71 A;  4I6X A;  4YAV A;  2YWM A;  3TJB A;  1X5D A;  4WEY A;  5ID2 A;  3UAP A;  3A2X A;  3EC3 A;  1VF2 A;  3IAS 2;  2PMT A;  4HUA A;  2G0F A;  1FOV A;  5DQS A;  2QSI A;  1JLW A;  4QMK A;  3W8S A;  1TRW A;  5IPG A;  1B4Q A;  3KMO A;  4CY6 A;  4K5S A;  4O32 A;  2LV3 A;  2YCD A;  1AQW A;  3CTF A;  2VL3 A;  1JZR A;  1TU8 A;  3N9J A;  2YZH A;  5D9T A;  3C1R A;  4BVX B;  1TK0 B;  3LOR A;  2MBS A;  3HMJ G;  3ZFB A;  2B3S A;  1GUM A;  4FYU A;  5FWG A;  4IW9 A;  3HVS A;  3W6G A;  3FR6 A;  4KSM A;  2BTO T;  4IP6 A;  1ST9 A;  1SKS B;  4RQR A;  4FO5 A;  4L5O A;  2XBQ A;  12GS A;  4V1A p;  1K0C A;  2D2Z A;  1XBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...