5ELGA

The structure of dhar1 from arabidopsis thaliana
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
ALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase DHAR1, mitochondrial
publication title Arabidopsis thaliana DHAR1 apo structure
rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5elgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5elgA01
4TN8A 2R6KA 4I2UA 4TR4A 1XW6A 4ZB6A 4L8EA 1A8LA 2R4VA 5E59A 4IBPA 4IELA 4E8EA 2CAQA 4RQRA 1M2AA 1UA5A 2M46A 4K0GA 2HYXA 1A8YA 1SU9A 1VF4A 2G0FA 3GH9A 2PVOC 1KTEA 1GSYA 2LQQA 1K3YA 1GH2A 3ZLPA 3W8SA 3UBLA 3ZVJA 1PD21 3BOAA 1YQ1A 4G0IA 2FY6A 1T7PB 2BMXA 1F2EA 19GSA 4P3YB 3H79A 1TU8A 1SKRB 2CZ3A 1M0UA 1B4PA 2H19A 1AW9A 2EC4A 1WMJA 3H8QA 2RLIA 2CX4A 5IOWA 4J2FA 4HEA2 3GX0A 2C3TA 5ECSA 4KX4A 3KP9A 1G6YA 2WDUA 4K7IA 4HJ2A 2VO4A 3TOUA 4NHWA 2JL4A 1GLPA 3C73A 2N5FA 5J5NA 5A4VA 5IIZA 2VOCA 5L71A 2YOIA 1YEXA 1SL1B 2WB9A 1E6BA 2FWFA 2PERA 5D8IA 5DCHA 5G1LA 4FIWA 4Q5QA 2PPTA 1JZWA 3UIWA 3UMAA 2ZCTA 1AUCA 2XC2A 4IP1A 5DALB 3K8NA 3VWWA 4F2IA 4PTSA 2IMFA 2CVDA 3M9KA 1W4VA 10GSA 3I69A 2IMEA 2LEGA 5F06A 3DXBA 3BJ5A 2IWTA 1URMA 1UN2A 4ZB8A 1O81A 1PL1A 11GSA 2VM2A 4I5QA 3RAZA 1VGLA 3TKSE 5DALA 3HVVA 1NHOA 4KA0A 2L57A 3DGQA 4KDXA 3LGCA 2FNOA 3P7XA 2AHEA 3APOA 1CQHA 1EEMA 3ERWA 1GULA 3GSSA 1XWBA 2GT5A 4WBJA 1YJ6A 1DE2A 2VCVA 5ECKB 5JCWA 5D93A 5IOXA 1XW5A 16GSA 3LEFA 4AF2A 3M9JA 4EUYA 4AJ7A 3D5JA 2RM6A 4HQSA 3G7YA 1WJKA 4NAXA 1ZZYA 3OR5A 3HJMA 4POKA 2H8LA 3RHBA 2DC5A 2VD0A 5DDLA 3S9FA 1XIYA 2VIMA 2HLSA 1R5PA 2C3QA 2HSMB 1R4WA 1EOGA 2CA8A 3VLNA 1DSBA 1ERWA 3TKSC 1PQNA 1GTIA 4KB3A 1OVNA 2HZFA 3GRXA 3MSZA 1AQVA 3IK7A 4OWYA 3LQ7A 2I1UA 4IQAA 1ZGNA 3PH9A 4I97A 4XS1A 4ZBAA 3F3RA 3G7IA 5HR0A 1W89A 5EL8A 2HSMA 4WR4A 4MPGA 3EU3A 3GUSA 3JCML 3ZYWA 3HJOA 2GT6A 5D73A 1XWCA 1NSWA 3QAGA 3D4TA 2RIIA 5KEJA 4GSNA 5CNWA 1NW2A 1A2JA 2OACA 1EGOA 5H5SA 5J4UA 1ZMAA 4KSOA 1GTAA 3TJBA 4ACSA 1TU7A 3GTUB 5H5RA 4PGTA 2P31A 3O6TA 4XS4B 1A0FA 1PGTA 5JCUA 3LORA 2GGTA 1OKTA 3MDKA 2VCTA 2PMTA 3FW2A 2B5EA 1I9DA 5ECNB 4L0WA 1OC9B 2B7JA 3GMFA 3GTUA 4KAEA 1SD9A 1YDKA 4CHSA 5J3RA 1UVZA 3E0UA 4XS4A 1T1VA 1BJXA 2HRAA 2J23A 3DIEA 1ERVA 4POLA 1MDKA 4BWQA 1Y6EA 4O7HA 1MDJA 2HRFA 2H0HA 1ML6A 3CMIA 3KM6A 1KNGA 2LTKA 3EC3A 2MMOA 1G6WA 1OC9A 4PURA 5DQSA 1XCCA 2FHEA 3KEBA 3GFKA 2RUEA 2EIOA 2MBTA 2H30A 2NVLA 1EEJA 1Z6NA 2CQ9A 2NBSA 4QQ7A 2F51A 3LXZA 3Q6OA 4GQFA 1IYIA 5HR1A 4NV5A 2H1AA 3A2VA 2FWEA 3IK9A 1Z7RA 3IXRA 3PINA 2R5GA 3QMXA 4F9ZA 1PL2A 1F37A 5DVBA 4V2MA 1FOVA 4ZL8A 2H66A 1EV9A 3A2XA 4JE1A 4FH8A 3TUEA 4TR1B 5E4WA 4X43A 4N11A 1O6JA 1TJDA 1ZCPA 2JACA 2K6VA 2O7KA 2N5BA 3LJRA 4RUVA 2YWMA 3KJYA 3PR8A 2LRTA 1TP9A 3IC4A 4H86A 3EVIA 1BEDA 3FRCA 5A4WA 2O87A 5F07A 5CREA 5H5QA 4TR1A 1TK5B 2GDRA 2DJ1A 5JWOB 13GSA 1FHEA 3Q74A 4BVYB 2HFDA 4OMVA 1OAZA 2K9FA 2LV3A 2AV4A 3EU4A 1A2LA 1WE0A 3G7JA 2XPEA 4WR5A 5F0GA 4G10A 5AN1A 1OC8A 2A2SA 2JADA 1ILOA 2NPBA 3VWXA 1K0CA 5HR2A 4EXJA 2CT6A 3F6DA 4D73B 2LJRA 4ECIA 4TVEA 5CRHA 4I2TA 4YQUA 1GUKA 1KEBA 6GSTA 5AISA 3DWVA 1F9MA 3NOFA 1KBNA 3ME7A 5J9CA 4D73A 3GKXA 5B8BA 2M72A 1OE8A 4YAVA 3R2QA 1VF1A 4L5LA 4K8MA 2N5AA 4JR4A 2F8AA 3M1GA 4ZXGA 2FA8A 3RPPA 4O92A 3GNJA 5IMZA 4KF9A 3KTLA 1DBYA 4KW6A 3QAVA 3TJGA 3P8WA 3F3QA 1UC7A 1WP0A 3KIJA 4TKYA 5KN1A 3ZRDA 3C8EA 4EC0A 4ECBA 2OKAA 1T8EB 1GTBA 2O89A 4O5RA 5B6MA 3IHQA 2FA4A 1AC1A 5ABRA 1O7UA 2EIRA 3LXTA 1S3CA 2B5XA 2GTUA 2X99A 4EDZA 3FZAA 2JU5A 1G7EA 4EO3A 3C71A 3FYGA 4JEDA 2YWIA 6GSYA 3GURA 4G19A 1ERTA 2YJ7A 4TXVA 2V6OA 2LSTA 1AQXA 3KCMA 1WPIA 2HXKA 4FYCA 5D9TA 2HT9A 2HNLA 4MH3A 2K8VA 4QL9A 3HKRA 1AIUA 2HRKB 3TJFA 2ON5A 3HVXA 2VL2A 1THXA 3CTFA 5HQPA 3L78A 2OADA 1YKCA 5AIXA 2YP6A 2LJKA 1DE1A 1MTCA 5KN3A 5CAXA 4IVFA 1A24A 4MZBA 5GAND 1A0RP 2HRKA 1G7OA 2YWOA 1TDIA 3DRNA 4XIHA 4HU9A 5F8BA 2OA7A 1EP8A 3HHVA 3O76A 3QOUA 1PX6A 5KN2A 4Q5FA 4RI7A 4JBBA 2IFQB 1XFLA 4POMA 4JU5A 1OE7A 4KCEA 3IRAA 2CX3A 2H0IA 1HNCA 4K7NA 4PQ1A 2JZTA 2GQLA 1TKDB 2B6MA 2L4CA 3KD0A 2HE3A 3HYPA 3L0HA 3L9SA 4DEJA 1M99A 3HXSA 3QR6A 1SK0A 2IFQA 1SJ6A 2A4VA 2VAFA 3WT1A 4IS0A 1XWGA 2I4AA 1WIKA 3TCOA 1FO5A 3HVSA 2PVQA 4XTSA 4ML1A 3SWLA 1O85A 5IPGA 3E9JB 3UARA 4JRRA 3F4SA 3WD6A 3MAKA 2GZPA 4HS1A 4WF5A 3FK8A 1LJRA 4DVCA 2V2GA 3KH7A 4KGIA 4NPBA 3WT2A 2YV9A 3H93A 1YKAA 4MA9A 4L5OA 2O85A 1M2DA 3PPUA 1X9SB 1O8WA 1SENA 3FR9A 5G5EA 3GX8A 2QC7A 5IMCA 2KP2A 5IMFA 2H72A 1YF1A 2LRCA 1N2AA 4K7OA 1XPVA 2QKEA 4V2NA 5GZZB 5IMDA 1GRXA 2C3NA 4IJIA 4IP6A 4EVMA 3CRUA 3LYPA 3MNGA 2WFCA 2PN8A 1EWXA 3UOMA 3EURA 2C1YA 3EINA 5IPHA 3PGTA 4LL4B 5ECRB 4YAPA 1QUWA 3QCPA 3HZ8A 1FG4A 2OBIA 3GIXA 2BTOT 3TDGA 3M8NA 2VL3A 2LKUA 5LD0A 3W8JA 2JSYA 4MDCA 1NM3A 1FAAA 1PMTA 3U5RE 20GSA 2QGVA 2YWNA 4MF5A 1K3OA 5CRWA 1S3AA 2IN3A 2IMKA 2H71A 3GYKA 3DMLA 2ZUPA 5G1KA 3DYRA 5IQYA 5A5KA 3FKFA 1U88A 4ID0A 2E2MA 2IPAA 5CO3A 1GSDA 4GSSA 4PUAA 4OO5A 2B5YA 4E8HA 2LQOA 5ELAA 1XOAA 1X9MB 5ECPB 3ZMLA 12GSA 4GWRA 2C8UA 1FB0A 4GQCA 2YJHA 4FQUA 5FWGA 1YF0A 2OBKA 4POBA 1EP7A 2C4JA 3VI7A 5BMUA 3CTGA 4GRFA 2CVKA 4HZ4A 1OC3A 1K0DA 1TI3A 4WF4A 2EIQA 1V58A 2IIYA 3ZREA 2H74A 3F4RA 6GSVA 5FHIA 4MMMA 1CQGA 5ECQB 1ON4A 4MF6A 2WRTA 2K18A 2WCIA 3CYNA 1NHYA 3ZL5A 1V40A 3HA9A 4RQXA 3AY8A 4NV2A 2YN1A 4KUNA 3H4KA 3C7MA 2VCWA 2LNSA 3DVXA 3WGXA 2H6YA 1X5CA 2REMA 4JR6A 2VCQA 3DD3A 2GLRA 3LYKA 2VL2C 5ECHB 4ILFA 4DSSB 4LMWA 2TRXA 5DAKB 1BQ7A 5ENUA 2FGXA 1JFUA 1ZL9A 2KUCA 4GSTA 1U87A 5DQYA 2HSHA 1GNWA 2AYTA 1T4YA 1Y25A 6GSSA 3I43A 3L9VA 1A23A 4IW9A 4DSSA 4BA7A 1U3AA 2F3MA 5DAKA 1F6MC 3BCKA 5JWRB 3D4MA 2CVBA 1J08A 2L5LA 3F4TA 2OE0A 1LBKA 2HZEB 2WULA 4ULXA 1SYRA 1SK2A 1R5AA 5DCGA 4KNDA 3UBKA 1WWJA 1Q98A 2KP1A 1XBSA 2H01A 4Q5NA 1HYUA 2E2GA 2FWHA 1SL2B 2X8GA 5JWQB 4WBRD 1TK0B 5IMVA 4J57E 1PN9A 1X5DA 3IE3A 2HZEA 4Z7XA 2H1GA 18GSA 4KH7A 3TOTA 3ME8A 3KMOA 2LNTA 5FT3A 4IN0A 2GSQA 1K0OA 1U6TA 2HQTA 1Z6MA 5ELGA 4NHZA 4HUAA 4YQMA 1XWAA 1SYXA 4MJBA 4ZB9A 4BVYA 2MMAA 1MEKA 4OFNA 3D21A 2PU9C 3U6VA 1O73A 3VWVA 2GSRA 1WRYA 4EL1A 1USBA 1J9BA 5C04A 1V57A 3GA4A 3GL3A 4X0XA 1AXDA 4HI7A 4EDYA 3NIVA 1R26A 2L4QA 1S3DA 1U3IA 2GQKA 1RK4A 3ZIVA 4YH2A 3TRQA 4O32A 2D2ZA 4ECCA 5LNKe 2NTOA 1VRSD 4RI6A 3KZQA 2WS2A 2G2QA 5F05A 2R37A 2H70A 4TRXA 1QMVA 2GZYA 5C00A 2RUFA 3TKSA 3ZZXA 5D9VA 2DMMA 2VD1A 1SJZA 4N30A 1EZKA 1K0AA 2IL3A 1EOHA 3IC8A 2R3XA 1XVWA 3Q19A 3FZ5A 1PKWA 5G5FA 3VI5A 2DJKA 1GLQA 4BVXB 1Z7PA 3E3EA 4MP4A 2IMIA 2BJXA 1X9WB 3EMXA 1V9WA 4ZIJA 1O8XA 5COHA 3NZNA 2AJQB 1M9BA 1YY7A 4OO4A 4G2EA 1GNEA 1B4QA 4GLTA 3W6GA 5B8AA 3TRXA 4F82A 1SKSB 3ZMKA 1Z3EA 3TB2A 5HFGA 1RQMA 4IHUA 4CDOA 1X5EA 4AGSA 1HNAA 1XWKA 4KSMA 1EGRA 1K3LA 3UAPA 1B9YC 1T00A 4V1Ap 4ZILA 3ZFBA 3GHAA 5DBQA 1TTZA 2V41A 3FR3A 4F0BA 4MZWA 3QFBC 4DSQA 4PQIA 1AAZA 3QAWA 1TXXA 4GXZA 2LS5A 5AIVA 1JLVA 2JZSA 3IOSA 2GSTA 2H1DA 3ERGA 4XRAA 5ECIB 2ALBA 3CRTA 2O8VB 1J0FA 2P0GA 2GQMA 4YQVA 5A4UA 1IYHA 4GF0A 3UL3A 6GSXA 4PXOA 1PA3A 8GSSA 2XBQA 3GKNA 5B7CA 2LUSA 1MDIA 3EYTA 4LA1A 4MJAA 3LWAA 2DBCA 2ES7A 1BYEA 4IQ1A 3ERFA 2TRCP 4LL1B 2VLTA 3KXOA 2DJ2A 2MBSA 4V1Ag 2CV4A 4KCAA 4K0NA 3HD5A 2B1KA 4XCSA 4MABA 1HD2A 1X0RA 14GSA 1E2YA 3H1NA 1K0MA 3Q18A 1F3BA 4WKWA 2RM5A 3CSHA 3GSTA 4J56E 1M2BA 1HQOA 2X8CA 4HZ2A 2P5QA 4I8BA 1ZYEA 2CAIA 4KDUA 3GV1A 1XZOA 2FCHA 3RHCA 4JZQA 3D0ZA 2C0FA 2IJYA 6GSUA 4L0UA 2PGTA 2PUKC 2NDOA 1YZXA 2UZ8A 2VM1A 1QFNA 4MJEA 3HY2A 2V6KA 1XOBA 3UEMA 1TRSA 4OFMA 3KP8A 1BAYA 5GAPD 3V1WA 4N0ZA 1THOA 2DIZA 2H6ZA 4N0VA 1QQ2A 1TOFA 1TRWA 1GTUA 1SL0B 3DKSA 4TXOB 3TKRA 2OE3A 2Z9SA 5HR3A 3TRPA 4OCEA 2C0EA 3BCIA 5DJLA 1N8JA 4ZBBA 3UVHA 5CP1A 3QD9A 3GH6A 3RBTA 2A2RA 5IO2A 4K6XA 4WXTA 2XHFA 2GSSA 2YV7A 2CZ2A 3BD2A 4TXOA 1XXUA 5IO0A 4ZL7A 4IGJA 2L6DA 3RDWA 3US3A 2TIRA 3VURA 4WETA 2WZ9A 2L5OA 2YANA 1SK1A 2E0QA 2FLSA 2V1MA 3LFLA 1FVKA 4FYBA 4MH2A 2MMNA 5AGYA 1PKZA 1MD3A 2FWGA 4F0CA 3ZVJD 2GS3A 3IAS2 2R2JA 1FW1A 3APQA 3ZIJA 1ZYQB 2DLXA 3ZTLA 4EE0A 4NWYA 1HNBA 1SJIA 3FR6A 2PBJA 1JHBA 1ERUA 3GKKA 4ZBDA 3J7Yk 3EE2A 3L9UA 4X1UA 3QFAC 1FB6A 4KDYA 2VCZA 1TK8B 1M9AA 3UVTA 3BBYA 2MYGA 3DEXA 4CW9A 2GZZA 3TKPA 2FD3A 3QDNA 2DSAA 3HJPA 2H0GA 1G0TA 4FYUA 2B7KA 1TW9A 1XW9A 2X8HA 1VF3A 2JSZA 3CBUA 4OCFA 2AAWA 4HQZA 4NXIA 2KLXA 3KGKA 3O3TA 1B9XC 1BX9A 1QXHA 3IA1A 3TJJA 3KH9A 5DJMA 2C0GA 5CRDA 2QSIA 4MK3A 3A5WA 4ECJA 2HSNB 3FY7A 4XS6A 2KOKA 2H6XA 2LRNA 22GSA 1LU4A 5IM9A 3LSZA 2B3SA 1ACVA 5ECMB 3WGEA 3ZFLA 4ZL9A 3P2AA 9GSSA 5CRGA 2P5RA 3DVWA 3FHKA 4PNFA 3EWLA 5EY6A 1GSUA 1DUGA 2YPMA 5GSSA 2XPDA 2YNXA 3EMPA 1QGVA 4BWSA 3FZ4A 5J41A 4AJ8A 2H73A 3VFIA 4HU7A 4USSA 4OD7A 1GL8A 1BG5A 3IAM2 1JZOA 4KE3A 4G0LA 4HDEA 4V2LA 3TKQA 3M0FA 1R7HA 1ST9A 3WGDA 1ABAA 2E7PA 2F9SA 5JCGA 3GL5A 4PX1A 5G31A 3I6AA 2L59A 4Q5RA 2VLVA 1V2AA 3VPQA 3ED3A 2YZUA 1GSEA 2WGRA 3VWUA 1GP1A 5EVOA 2X64A 3VPTA 4BL7B 4LMVA 3G9BA 2HI7A 2V32A 2K8SA 5D9XA 3RPNA 1Z9HA 1V98A 3KTBA 4GCIA 4EF0A 3C1RA 4MZCA 1TI1A 3HCZA 3F6FA 4ML6A 1PRXA 3GN3A 1H4OA 3WYWA 1PSQA 4BL7A 2VCXA 2OE1A 2H75A 5J9BA 3ZITA 4EKZA 1GUHA 4G0KA 2GVPA 1SKWB 2FUG2 1JZRA 1T4ZA 1PX7A 4N10A 3A3TA 2KHPA 4MLYA 1AQWA 1ZOFA 3SBCA 1B48A 1B8XA 5ID2B 2MZCA 4MCUA 5KN0A 3IDVA 2J9HA 4MJCA 3F8UA 2HSYA 2LJAA 1WOUA 5D96A 3F0IA 3FEUA 4DSRA 4F03A 4IJ3A 3GKMA 3KMNA 2VUPA 3J7Yb 4PUFC 3D6IA 3P90A 5ID2A 3F63A 5G2ZA 3IPZA 1C72A 3TGZA 2H76A 1QK8A 2F8FA 3R3EA 3UJ1A 1VF2A 4TOPA 3CXGA 17GSA 4K1FA 3HDCA 4OFTA 1GSSA 2OJLA 3TJKA 1YEPA 4G9HA 1FVJA 3A2WA 1MD4A 1GUMA 2H1BA 2M80A 4NMUA 1A2MA 5D9WA 7GSSA 1M7TA 1RW1A 3MWHA 1F3AA 1EV4A 1XVQA 4TW5A 1OKDA 4AJ6A 2DJ3A 4MF7A 5ECOB 4I6XA 5LCZA 3HZ4A 5G30A 2PWJA 1GSQA 3IR4A 5CYYA 3D22A 1OYJA 1Q4JA 3CSIA 3C1SA 5INYA 3CSJA 4LLRA 2I3YA 4GTUA 2VL9A 4TR3A 2DIYA 2YZHA 1T3BA 4K9ZA 4IKHA 4PQHA 4MPFA 2DMLA 1GWCA 1GSFA 1TRVA 2ZNMA 4XRDA 4K2DA 2HRNA 1JLWA 2L6CA 1K0NA 5HFIA 4FO5A 6GSWA 5B6NA 5GSTA 5EPFA 2B1LA 2DJJA 3QPMA 3IBHA 4XHMA 2ON7A 4BVXA 2JZRA 1Z5YE 2YCDA 2I9HA 2IMDA 2AB6A 3FZ9A 1TRUA 5HFKA 2XBIA 2VLUA 4QL7A 1SD8A 3M3MA 3I9V2 1JZDA 2AUVA 2C0DA 4BPYA 4WEYA 2I81A 3VK9A 2WJUA 3LG6A 4PNGA 3F9UA 4ISDA 1H75A 3APSA 3L4NA 3N5OA 4HJMA 4TR0A 1I5GA 5IMAA 5ECLB 3ISOA 3IV4A 2C80A 1K0BA 2MMZA 3N9JA 4HOJA 2DJ0A
chains in the Genus database with same CATH superfamily
4TN8A 2R6KA 4I2UA 4TR4A 2OT3A 1XW6A 4ZB6A 4L8EA 1A8LA 2R4VA 5E59A 4IBPA 4IELA 4E8EA 2CAQA 4RQRA 1M2AA 1UA5A 2M46A 2O3EA 4K0GA 2HYXA 1A8YA 1SU9A 1VF4A 2G0FA 3GH9A 2PVOC 1KTEA 1GSYA 2LQQA 1K3YA 1GH2A 3ZLPA 3W8SA 3UBLA 3ZVJA 1PD21 3BOAA 1YQ1A 4G0IA 2FY6A 1T7PB 2BMXA 1F2EA 4PHZC 19GSA 4P3YB 3H79A 1TU8A 1SKRB 2CZ3A 1M0UA 1B4PA 2H19A 1AW9A 2EC4A 1WMJA 3H8QA 2RLIA 2CX4A 5IOWA 4J2FA 4HEA2 3GX0A 2C3TA 5ECSA 2VKZG 4KX4A 2X49A 3KP9A 1G6YA 1ZYPA 2WDUA 4K7IA 4HJ2A 2VO4A 4W66A 3TOUA 4NHWA 2JL4A 1GLPA 3C73A 4K5RA 2N5FA 5J5NA 2EFCA 4Z2RA 5A4VA 3A5IA 5IIZA 1XG8A 2VOCA 5L71A 2YOIA 1YEXA 1SL1B 2WB9A 3RGBC 1E6BA 2FWFA 2PERA 5D8IA 5DCHA 5G1LA 4FIWA 4Q5QA 2PPTA 2WVYA 1JZWA 3UIWA 3UMAA 2ZCTA 1AUCA 2XC2A 4IP1A 5DALB 3K8NA 3VWWA 4F2IA 4PTSA 2IMFA 2CVDA 3M9KA 3CHXC 1W4VA 4FXYP 10GSA 3I69A 2IMEA 2LEGA 5F06A 3DXBA 3BJ5A 2IWTA 1URMA 1UN2A 4ZB8A 1O81A 1PL1A 11GSA 2VM2A 4I5QA 3RAZA 1VGLA 3TKSE 5DALA 3HVVA 1NHOA 4KA0A 2L57A 3DGQA 4KDXA 3LGCA 2FNOA 3P7XA 2AHEA 3APOA 1CQHA 1EEMA 3ERWA 1GULA 3GSSA 1XWBA 2GT5A 4WBJA 1YJ6A 1DE2A 2VCVA 5ECKB 5JCWA 5D93A 5IOXA 1XW5A 16GSA 3LEFA 4AF2A 3M9JA 4EUYA 4AJ7A 3D5JA 2RM6A 4HQSA 3G7YA 1WJKA 4NAXA 1ZZYA 3OR5A 3HJMA 4POKA 2H8LA 3RHBA 2DC5A 2VD0A 5DDLA 3S9FA 1XIYA 2VIMA 2HLSA 1R5PA 2C3QA 2HSMB 1R4WA 1EOGA 2CA8A 3VLNA 1DSBA 1ERWA 3TKSC 1PQNA 1GTIA 4KB3A 1OVNA 2HZFA 3GRXA 3MSZA 1AQVA 3IK7A 4OWYA 3LQ7A 2I1UA 4IQAA 1ZGNA 3PH9A 4I97A 4XS1A 4ZBAA 3F3RA 3G7IA 5HR0A 1W89A 5EL8A 2HSMA 4WR4A 4MPGA 3EU3A 3GUSA 3JCML 5J4VA 3ZYWA 3HJOA 2GT6A 5D73A 1XWCA 1NSWA 3QAGA 4A5PA 3D4TA 2RIIA 5KEJA 4GSNA 2QA1A 5CNWA 1NW2A 1A2JA 2OACA 1EGOA 5H5SA 5J4UA 1ZMAA 4KSOA 1GTAA 3TJBA 4ACSA 1TU7A 3GTUB 5H5RA 4PGTA 2P31A 2X4AA 3O6TA 4XS4B 1A0FA 1PGTA 5JCUA 3LORA 2GGTA 1OKTA 3MDKA 2VCTA 2PMTA 3EPTA 3FW2A 2B5EA 1I9DA 5ECNB 4L0WA 1OC9B 4HSCX 2B7JA 3GMFA 3GTUA 4KAEA 1SD9A 1YDKA 4CHSA 5J3RA 1UVZA 3E0UA 4XS4A 1T1VA 1BJXA 2HRAA 2J23A 3DIEA 1ERVA 4POLA 1MDKA 4BWQA 1Y6EA 4O7HA 1MDJA 2HRFA 2H0HA 1ML6A 3CMIA 3KM6A 1KNGA 2LTKA 4G01A 3EC3A 2MMOA 1G6WA 1OC9A 4PURA 5DQSA 1XCCA 4CY6A 2FHEA 3KEBA 3GFKA 2RUEA 2EIOA 2MBTA 2H30A 2NVLA 1EEJA 1Z6NA 2CQ9A 3CWGA 2NBSA 4QQ7A 2F51A 3LXZA 3Q6OA 4GQFA 1IYIA 5HR1A 3RFRC 4NV5A 2H1AA 3A2VA 2FWEA 3IK9A 1Z7RA 3IXRA 3PINA 2R5GA 3QMXA 4F9ZA 1PL2A 5A1NB 1F37A 4AI6A 5DVBA 4V2MA 1FOVA 4ZL8A 2H66A 1EV9A 3A2XA 4JE1A 4FH8A 3TUEA 4TR1B 5E4WA 4X43A 4N11A 1O6JA 1TJDA 1ZCPA 2JACA 2K6VA 2O7KA 2N5BA 3LJRA 4RUVA 2YWMA 3KJYA 3PR8A 2LRTA 1TP9A 3IC4A 5A1NA 4H86A 3EVIA 5A34B 1BEDA 3FRCA 5A4WA 2O87A 5F07A 5CREA 5H5QA 4TR1A 1TK5B 2GDRA 2DJ1A 5JWOB 13GSA 1FHEA 3Q74A 4BVYB 2HFDA 2O5VA 4OMVA 1OAZA 2K9FA 2LV3A 2AV4A 3EU4A 1A2LA 1WE0A 3G7JA 5A34A 2XPEA 4WR5A 5F0GA 4G10A 5AN1A 1OC8A 2A2SA 2JADA 1ILOA 2NPBA 3VWXA 1K0CA 5HR2A 2R0CA 4EXJA 2CT6A 3F6DA 4D73B 2LJRA 4ECIA 4TVEA 2R0GA 5CRHA 4I2TA 4YQUA 4ICYA 1GUKA 1KEBA 6GSTA 5AISA 2QA2A 3DWVA 4O5QA 1F9MA 3NOFA 1KBNA 3ME7A 5J9CA 4D73A 3GKXA 5B8BA 2M72A 1OE8A 4YAVA 3R2QA 1VF1A 4L5LA 4K8MA 2N5AA 4JR4A 2F8AA 3M1GA 4ZXGA 2FA8A 3RPPA 4O92A 3GNJA 5IMZA 4KF9A 3KTLA 1DBYA 4KW6A 3QAVA 3TJGA 3P8WA 3F3QA 1UC7A 1WP0A 3KIJA 4TKYA 5KN1A 3ZRDA 3C8EA 4EC0A 4ECBA 2OKAA 1T8EB 1GTBA 2O89A 4O5RA 5B6MA 3IHQA 2FA4A 1AC1A 5ABRA 1O7UA 2EIRA 3LXTA 1S3CA 2B5XA 2EFHA 2GTUA 2X99A 4EDZA 3FZAA 2JU5A 1G7EA 4EO3A 3C71A 3FYGA 4JEDA 2YWIA 6GSYA 1SVOA 3GURA 4G19A 1ERTA 2YJ7A 4TXVA 2V6OA 2LSTA 2WVZA 3HMJG 2DKIA 1AQXA 3KCMA 1WPIA 2HXKA 4FYCA 5D9TA 2HT9A 2HNLA 4MH3A 2K8VA 4QL9A 3HKRA 5J47A 1AIUA 2HRKB 3TJFA 2ON5A 3CQFA 3HVXA 2VL2A 1THXA 3CTFA 5HQPA 3L78A 2A2PA 2OADA 1YKCA 4AKXB 5AIXA 2YP6A 2LJKA 1DE1A 1MTCA 5KN3A 5CAXA 4IVFA 1A24A 4MZBA 5GAND 1A0RP 2HRKA 1G7OA 2YWOA 1TDIA 3DRNA 4XIHA 4HU9A 5F8BA 2OA7A 1EP8A 3HHVA 2R0PA 3O76A 3QOUA 1PX6A 5KN2A 2EFEA 4Q5FA 4RI7A 4JBBA 2IFQB 1XFLA 4POMA 4JU5A 1OE7A 4KCEA 2WVXB 3IRAA 2CX3A 2H0IA 1HNCA 4K7NA 4PQ1A 2JZTA 2GQLA 1TKDB 2B6MA 2L4CA 3KD0A 2HE3A 3HYPA 3L0HA 3L9SA 1BF5A 4CY8A 4DEJA 1M99A 3HXSA 1FOHA 3QR6A 1SK0A 2IFQA 2VAFA 1SJ6A 2A4VA 2A4HA 3WT1A 4IS0A 2WVXA 1XWGA 2I4AA 1WIKA 3TCOA 1FO5A 3HVSA 2PVQA 4XTSA 4ML1A 3SWLA 1O85A 5IPGA 1TXUA 3E9JB 3UARA 4JRRA 3F4SA 3WD6A 3MAKA 2GZPA 4HS1A 4YKGA 4WF5A 3FK8A 1LJRA 4DVCA 2V2GA 3KH7A 4KGIA 4NPBA 4AKGA 3WT2A 2WW0A 2YV9A 3H93A 4K5SA 1YKAA 4MA9A 4L5OA 2O85A 1M2DA 3PPUA 1X9SB 1O8WA 1SENA 3FR9A 5G5EA 3GX8A 2QC7A 5IMCA 2KP2A 5IMFA 2H72A 1YF1A 2LRCA 1N2AA 4K7OA 1XPVA 2QKEA 4V2NA 5GZZB 5IMDA 1GRXA 2C3NA 4IJIA 4IP6A 4EVMA 3CRUA 2O36A 3LYPA 3MNGA 2WFCA 2PN8A 1EWXA 3UOMA 3EURA 2C1YA 3EINA 5IPHA 3PGTA 4LL4B 5ECRB 4YAPA 1QUWA 3QCPA 3HZ8A 3MIXA 1FG4A 2OBIA 3GIXA 2BTOT 3TDGA 3M8NA 2VL3A 2LKUA 5LD0A 3W8JA 2JSYA 4MDCA 1NM3A 1FAAA 1PMTA 3U5RE 20GSA 2QGVA 2YWNA 4MF5A 1K3OA 5CRWA 1S3AA 2IN3A 2IMKA 2H71A 3MYDA 3GYKA 3DMLA 2ZUPA 5G1KA 3DYRA 5IQYA 5A5KA 3LW9A 3FKFA 1U88A 4ID0A 2E2MA 2IPAA 5CO3A 1GSDA 4GSSA 4PUAA 5BMUB 4OO5A 2B5YA 4E8HA 2LQOA 5ELAA 1XOAA 1X9MB 5ECPB 3ZMLA 12GSA 4GWRA 2C8UA 1FB0A 4GQCA 1M3IA 2YJHA 4FQUA 5FWGA 1YF0A 2OBKA 4POBA 1EP7A 2C4JA 3VI7A 5BMUA 3CTGA 4GRFA 2CVKA 4HZ4A 1OC3A 1K0DA 1TI3A 4WF4A 2EIQA 1V58A 2IIYA 3ZREA 2H74A 5J4YA 3F4RA 6GSVA 5FHIA 4MMMA 1CQGA 3FMWA 5ECQB 1ON4A 4MF6A 2WRTA 2K18A 2WCIA 3CYNA 1NHYA 3ZL5A 1V40A 3HA9A 4RQXA 3AY8A 4NV2A 2YN1A 4KUNA 3H4KA 3C7MA 2VCWA 2LNSA 3DVXA 3WGXA 2H6YA 1X5CA 2REMA 4JR6A 2UV8G 2VCQA 3DD3A 2GLRA 3LYKA 2VL2C 1N25A 5ECHB 4ILFA 4DSSB 4LMWA 2TRXA 5DAKB 1BQ7A 2WW1A 5ENUA 2FGXA 1JFUA 1ZL9A 2KUCA 4GSTA 1U87A 1PN0A 5DQYA 2HSHA 1GNWA 2AYTA 1T4YA 1Y25A 6GSSA 3I43A 3L9VA 1A23A 4IW9A 4DSSA 4BA7A 1U3AA 2F3MA 5DAKA 1F6MC 3BCKA 5JWRB 3D4MA 2CVBA 1J08A 2L5LA 3F4TA 2OE0A 1LBKA 2HZEB 2WULA 4ULXA 1SYRA 1SK2A 1R5AA 5DCGA 4KNDA 3UBKA 1WWJA 1Q98A 2KP1A 1XBSA 2H01A 4Q5NA 1HYUA 2E2GA 2FWHA 1SL2B 2X8GA 5JWQB 4WBRD 1TK0B 5IMVA 4J57E 1PN9A 1X5DA 3IE3A 2HZEA 4Z7XA 2H1GA 18GSA 4KH7A 3TOTA 3ME8A 3KMOA 2LNTA 5FT3A 4IN0A 2GSQA 1K0OA 1U6TA 2HQTA 1Z6MA 1S3RA 5ELGA 4NHZA 4HUAA 4YQMA 1XWAA 1SYXA 4MJBA 4ZB9A 4BVYA 2MMAA 1MEKA 4OFNA 3D21A 2PU9C 3U6VA 1O73A 3VWVA 2GSRA 1WRYA 4EL1A 1USBA 1J9BA 5C04A 1V57A 3GA4A 3GL3A 4X0XA 1AXDA 4HI7A 4EDYA 3NIVA 1R26A 2L4QA 1S3DA 1U3IA 2GQKA 1RK4A 3ZIVA 4YH2A 3TRQA 4O32A 2D2ZA 4ECCA 5LNKe 2NTOA 1VRSD 4RI6A 3KZQA 2EFDA 2WS2A 2G2QA 5F05A 2R37A 2H70A 4TRXA 1QMVA 2GZYA 5C00A 2RUFA 3TKSA 3ZZXA 5D9VA 2DMMA 2VD1A 1SJZA 4N30A 1EZKA 1K0AA 2IL3A 1EOHA 3IC8A 2R3XA 1XVWA 3Q19A 3FZ5A 1PKWA 5G5FA 3VI5A 2DJKA 1YVLA 1GLQA 4BVXB 1Z7PA 3E3EA 4MP4A 2IMIA 2BJXA 1X9WB 4MNNA 3EMXA 1V9WA 4ZIJA 1O8XA 5COHA 3NZNA 2AJQB 1M9BA 1YY7A 4OO4A 4G2EA 1GNEA 1B4QA 4GLTA 3W6GA 5B8AA 3TRXA 4F82A 1SKSB 3ZMKA 1Z3EA 3TB2A 4BIKA 5HFGA 1RQMA 4IHUA 4CDOA 1X5EA 4AGSA 1HNAA 3HVNA 1XWKA 4KSMA 1EGRA 1K3LA 3UAPA 1B9YC 4EIPA 1T00A 4V1Ap 4ZILA 3ZFBA 3GHAA 5DBQA 1TTZA 2V41A 3FR3A 4F0BA 4MZWA 3QFBC 4DSQA 4PQIA 1AAZA 3QAWA 1TXXA 4GXZA 2LS5A 5AIVA 1JLVA 2JZSA 3IOSA 2GSTA 2H1DA 3ERGA 4XRAA 5ECIB 2ALBA 3CRTA 2O8VB 1J0FA 4AKHA 4Z2TA 2P0GA 1ZYNA 2GQMA 4YQVA 5A4UA 1IYHA 4GF0A 3UL3A 6GSXA 4PXOA 1PA3A 8GSSA 2XBQA 3GKNA 5B7CA 2LUSA 1MDIA 3EYTA 4LA1A 4MJAA 3LWAA 2DBCA 2ES7A 1BYEA 4IQ1A 3ERFA 2TRCP 4LL1B 2VLTA 3KXOA 2DJ2A 2MBSA 5J40A 4V1Ag 2CV4A 4KCAA 4QMKA 4K0NA 3HD5A 2B1KA 4XCSA 4MABA 1HD2A 1X0RA 14GSA 1E2YA 3H1NA 1K0MA 3Q18A 1F3BA 4PI0C 4WKWA 2RM5A 3CSHA 3GSTA 4J56E 1M2BA 1HQOA 2X8CA 4HZ2A 2P5QA 4I8BA 1ZYEA 2CAIA 4KDUA 3GV1A 1XZOA 2FCHA 5KOWA 3RHCA 4JZQA 3D0ZA 2C0FA 4O5UA 2IJYA 6GSUA 4L0UA 2PGTA 2PUKC 2NDOA 1YZXA 2UZ8A 2VM1A 1S4BP 1QFNA 4MJEA 3HY2A 2V6KA 1XOBA 3UEMA 1TRSA 4OFMA 3KP8A 1BAYA 5GAPD 3V1WA 4N0ZA 1THOA 2DIZA 2H6ZA 4N0VA 1QQ2A 1TOFA 1TRWA 4K2XA 1GTUA 1SL0B 3DKSA 4TXOB 3TKRA 2OE3A 2Z9SA 5HR3A 3TRPA 4OCEA 2C0EA 3BCIA 5DJLA 1N8JA 4ZBBA 3UVHA 5CP1A 3QD9A 3GH6A 3RBTA 2A2RA 5IO2A 4K6XA 4WXTA 2XHFA 2GSSA 2YV7A 2CZ2A 3BD2A 4TXOA 1XXUA 5IO0A 4ZL7A 4IGJA 2L6DA 3RDWA 3US3A 2TIRA 3VURA 4WETA 2WZ9A 2L5OA 2YANA 1SK1A 2E0QA 2FLSA 2V1MA 3LFLA 1BG1A 1FVKA 4FYBA 4MH2A 2MMNA 5AGYA 1PKZA 1MD3A 2FWGA 4F0CA 3ZVJD 2GS3A 3IAS2 2R2JA 1FW1A 3APQA 3ZIJA 1ZYQB 2DLXA 3ZTLA 4EE0A 4NWYA 1HNBA 1SJIA 3FR6A 2PBJA 1JHBA 1ERUA 3GKKA 4ZBDA 3J7Yk 3EE2A 3L9UA 4X1UA 3QFAC 1FB6A 4KDYA 2VCZA 1TK8B 1M9AA 3UVTA 3BBYA 2MYGA 3DEXA 4CW9A 2GZZA 3TKPA 2FD3A 3QDNA 4E68A 2DSAA 3HJPA 2H0GA 1G0TA 5BRTA 4FYUA 2B7KA 1TW9A 1XW9A 2X8HA 1VF3A 2JSZA 3CBUA 4OCFA 2AAWA 4HQZA 4NXIA 2KLXA 3KGKA 3O3TA 1B9XC 1BX9A 1QXHA 3IA1A 3TJJA 3KH9A 5DJMA 2C0GA 5CRDA 2QSIA 4MK3A 3A5WA 4YKFA 4ECJA 2HSNB 3FY7A 4XS6A 2KOKA 2H6XA 2LRNA 22GSA 1LU4A 5IM9A 3LSZA 2B3SA 1ACVA 5ECMB 3WGEA 3ZFLA 4ZL9A 4AKIA 3P2AA 9GSSA 5CRGA 2P5RA 3DVWA 3FHKA 4PNFA 3EWLA 5EY6A 1GSUA 2WW3A 1DUGA 2HSNA 2YPMA 5GSSA 2XPDA 2YNXA 3EMPA 1QGVA 4Z2UA 4BWSA 3FZ4A 5J41A 4AJ8A 2H73A 3VFIA 4HU7A 4USSA 4OD7A 1GL8A 1BG5A 3IAM2 4GDFA 1JZOA 1YEWC 4KE3A 4G0LA 4HDEA 4V2LA 3TKQA 3M0FA 1R7HA 1ST9A 3WGDA 1ABAA 2E7PA 2F9SA 5JCGA 3GL5A 4PX1A 5G31A 3I6AA 2L59A 3IHGA 4Q5RA 5A5HB 2VLVA 1V2AA 3VPQA 3ED3A 2YZUA 1GSEA 2WGRA 3VWUA 1GP1A 5EVOA 2X64A 3VPTA 4BL7B 4LMVA 4N3ZA 3G9BA 2HI7A 2V32A 2K8SA 5D9XA 3RPNA 1Z9HA 1V98A 3KTBA 4GCIA 4EF0A 3C1RA 5KOXA 4MZCA 1TI1A 5A5HA 3HCZA 3F6FA 4ML6A 1PRXA 3GN3A 1H4OA 3WYWA 1PSQA 4BL7A 2VCXA 2OE1A 2H75A 5J9BA 1PFOA 3ZITA 4EKZA 1GUHA 4G0KA 2GVPA 1SKWB 2FUG2 1JZRA 1T4ZA 1PX7A 4N10A 3A3TA 2KHPA 4MLYA 1AQWA 1ZOFA 4ZB7A 3SBCA 1B48A 1B8XA 5ID2B 2MZCA 4MCUA 5KN0A 3IDVA 2J9HA 4MJCA 3F8UA 2HSYA 2LJAA 1WOUA 1M3JA 5D96A 3F0IA 3FEUA 4DSRA 4F03A 4IJ3A 3GKMA 3KMNA 2VUPA 1Y1UA 3TU3B 3J7Yb 4PUFC 3D6IA 3P90A 5ID2A 3F63A 5G2ZA 3IPZA 1C72A 3TGZA 2H76A 1I1IP 1QK8A 2F8FA 3R3EA 3UJ1A 1VF2A 4TOPA 3CXGA 17GSA 4K1FA 1SVLA 3HDCA 4OFTA 1GSSA 2OJLA 3TJKA 1YEPA 4G9HA 1FVJA 3A2WA 1MD4A 4PI2C 1GUMA 2H1BA 2M80A 4NMUA 1A2MA 2H1LA 5D9WA 7GSSA 1M7TA 1RW1A 3MWHA 1F3AA 1EV4A 1XVQA 4TW5A 1OKDA 4AJ6A 2DJ3A 4MF7A 4X4JA 5ECOB 4I6XA 5LCZA 3HZ4A 5G30A 2PWJA 1GSQA 3IR4A 5CYYA 3D22A 1OYJA 1Q4JA 3CSIA 3C1SA 5INYA 3CSJA 4LLRA 2I3YA 4GTUA 2VL9A 4TR3A 4EIQA 1SVMA 2DIYA 2YZHA 1T3BA 4K9ZA 4IKHA 4PQHA 4MPFA 2DMLA 1GWCA 1GSFA 1TRVA 2ZNMA 4XRDA 4K2DA 2HRNA 1JLWA 2L6CA 1K0NA 2DKHA 5HFIA 4FO5A 6GSWA 5B6NA 5GSTA 5EPFA 2B1LA 2DJJA 2WZSA 3QPMA 3IBHA 4XHMA 2ON7A 4BVXA 2JZRA 1Z5YE 2YCDA 2I9HA 2IMDA 2AB6A 3FZ9A 1TRUA 5HFKA 2XBIA 2VLUA 4QL7A 1SD8A 3M3MA 3I9V2 1JZDA 2AUVA 2C0DA 4BPYA 4WEYA 2I81A 3VK9A 2WJUA 3LG6A 4PNGA 3F9UA 4ISDA 1H75A 3APSA 3L4NA 2WW2A 3N5OA 4HJMA 4TR0A 1I5GA 5IMAA 5ECLB 3ISOA 3IV4A 2C80A 1K0BA 2MMZA 3N9JA 4HOJA 2DJ0A
chains in the Genus database with same CATH topology
4TN8A 2R6KA 4I2UA 4TR4A 2OT3A 1XW6A 4ZB6A 4L8EA 1A8LA 2R4VA 5E59A 4IBPA 4IELA 4E8EA 2CAQA 4RQRA 1M2AA 1UA5A 2M46A 4K0GA 2HYXA 1A8YA 1SU9A 1VF4A 2G0FA 3GH9A 2PVOC 1KTEA 1GSYA 2LQQA 1K3YA 1GH2A 3ZLPA 3W8SA 3UBLA 3ZVJA 1PD21 3BOAA 1YQ1A 4G0IA 2FY6A 1T7PB 2BMXA 1F2EA 19GSA 4P3YB 3H79A 1TU8A 1SKRB 2CZ3A 1M0UA 1B4PA 2H19A 1AW9A 2EC4A 1WMJA 3H8QA 2RLIA 2CX4A 5IOWA 4J2FA 4HEA2 3GX0A 2C3TA 5ECSA 2VKZG 4KX4A 2X49A 3KP9A 1G6YA 1ZYPA 2WDUA 4K7IA 4HJ2A 2VO4A 4W66A 3TOUA 4NHWA 2JL4A 1GLPA 3C73A 4K5RA 2N5FA 5J5NA 2EFCA 4Z2RA 5A4VA 3A5IA 5IIZA 2VOCA 5L71A 2YOIA 1YEXA 1SL1B 2WB9A 1E6BA 2FWFA 2PERA 5D8IA 5DCHA 5G1LA 4FIWA 4Q5QA 2PPTA 1JZWA 3UIWA 3UMAA 2ZCTA 1AUCA 2XC2A 4IP1A 5DALB 3K8NA 3VWWA 4F2IA 4PTSA 2IMFA 2CVDA 3M9KA 1W4VA 10GSA 3I69A 2IMEA 2LEGA 5F06A 3DXBA 3BJ5A 2IWTA 1URMA 1UN2A 4ZB8A 1O81A 1PL1A 11GSA 2VM2A 4I5QA 3RAZA 1VGLA 3TKSE 5DALA 3HVVA 1NHOA 4KA0A 2L57A 3DGQA 4KDXA 3LGCA 2FNOA 3P7XA 2AHEA 3APOA 1CQHA 1EEMA 3ERWA 1GULA 3GSSA 1XWBA 2GT5A 4WBJA 1YJ6A 1DE2A 2VCVA 5ECKB 5JCWA 5D93A 5IOXA 1XW5A 16GSA 3LEFA 4AF2A 3M9JA 4EUYA 4AJ7A 3D5JA 2RM6A 4HQSA 3G7YA 1WJKA 4NAXA 1ZZYA 3OR5A 3HJMA 4POKA 2H8LA 3RHBA 2DC5A 2VD0A 5DDLA 3S9FA 1XIYA 2VIMA 2HLSA 1R5PA 2C3QA 2HSMB 1R4WA 1EOGA 2CA8A 3VLNA 1DSBA 1ERWA 3TKSC 1PQNA 1GTIA 4KB3A 1OVNA 2HZFA 3GRXA 3MSZA 1AQVA 3IK7A 4OWYA 3LQ7A 2I1UA 4IQAA 1ZGNA 3PH9A 4I97A 4XS1A 4ZBAA 3F3RA 3G7IA 5HR0A 1W89A 5EL8A 2HSMA 4WR4A 4MPGA 3EU3A 3GUSA 3JCML 5J4VA 3ZYWA 3HJOA 2GT6A 5D73A 1XWCA 1NSWA 3QAGA 4A5PA 3D4TA 2RIIA 5KEJA 4GSNA 2QA1A 5CNWA 1NW2A 1A2JA 2OACA 1EGOA 5H5SA 5J4UA 1ZMAA 4KSOA 1GTAA 3TJBA 4ACSA 1TU7A 3GTUB 5H5RA 4PGTA 2P31A 2X4AA 3O6TA 4XS4B 1A0FA 1PGTA 5JCUA 3LORA 2GGTA 1OKTA 3MDKA 2VCTA 2PMTA 3EPTA 3FW2A 2B5EA 1I9DA 5ECNB 4L0WA 1OC9B 2B7JA 3GMFA 3GTUA 4KAEA 1SD9A 1YDKA 4CHSA 5J3RA 1UVZA 3E0UA 4XS4A 1T1VA 1BJXA 2HRAA 2J23A 3DIEA 1ERVA 4POLA 1MDKA 4BWQA 1Y6EA 4O7HA 1MDJA 2HRFA 2H0HA 1ML6A 3CMIA 3KM6A 1KNGA 2LTKA 4G01A 3EC3A 2MMOA 1G6WA 1OC9A 4PURA 5DQSA 1XCCA 4CY6A 2FHEA 3KEBA 3GFKA 2RUEA 2EIOA 2MBTA 2H30A 2NVLA 1EEJA 1Z6NA 2CQ9A 3CWGA 2NBSA 4QQ7A 2F51A 3LXZA 3Q6OA 4GQFA 1IYIA 5HR1A 4NV5A 2H1AA 3A2VA 2FWEA 3IK9A 1Z7RA 3IXRA 3PINA 2R5GA 3QMXA 4F9ZA 1PL2A 5A1NB 1F37A 4AI6A 5DVBA 4V2MA 1FOVA 4ZL8A 2H66A 1EV9A 3A2XA 4JE1A 4FH8A 3TUEA 4TR1B 5E4WA 4X43A 4N11A 1O6JA 1TJDA 1ZCPA 2JACA 2K6VA 2O7KA 2N5BA 3LJRA 4RUVA 2YWMA 3KJYA 3PR8A 2LRTA 1TP9A 3IC4A 5A1NA 4H86A 3EVIA 5A34B 1BEDA 3FRCA 5A4WA 2O87A 5F07A 5CREA 5H5QA 4TR1A 1TK5B 2GDRA 2DJ1A 5JWOB 13GSA 1FHEA 3Q74A 4BVYB 2HFDA 2O5VA 4OMVA 1OAZA 2K9FA 2LV3A 2AV4A 3EU4A 1A2LA 1WE0A 3G7JA 5A34A 2XPEA 4WR5A 5F0GA 4G10A 5AN1A 1OC8A 2A2SA 2JADA 1ILOA 2NPBA 3VWXA 1K0CA 5HR2A 2R0CA 4EXJA 2CT6A 3F6DA 4D73B 2LJRA 4ECIA 4TVEA 2R0GA 5CRHA 4I2TA 4YQUA 4ICYA 1GUKA 1KEBA 6GSTA 5AISA 2QA2A 3DWVA 4O5QA 1F9MA 3NOFA 1KBNA 3ME7A 5J9CA 4D73A 3GKXA 5B8BA 2M72A 1OE8A 4YAVA 3R2QA 1VF1A 4L5LA 4K8MA 2N5AA 4JR4A 2F8AA 3M1GA 4ZXGA 2FA8A 3RPPA 4O92A 3GNJA 5IMZA 4KF9A 3KTLA 1DBYA 4KW6A 3QAVA 3TJGA 3P8WA 3F3QA 1UC7A 1WP0A 3KIJA 4TKYA 5KN1A 3ZRDA 3C8EA 4EC0A 4ECBA 2OKAA 1T8EB 1GTBA 2O89A 4O5RA 5B6MA 3IHQA 2FA4A 1AC1A 5ABRA 1O7UA 2EIRA 3LXTA 1S3CA 2B5XA 2EFHA 2GTUA 2X99A 4EDZA 3FZAA 2JU5A 1G7EA 4EO3A 3C71A 3FYGA 4JEDA 2YWIA 6GSYA 1SVOA 3GURA 4G19A 1ERTA 2YJ7A 4TXVA 2V6OA 2LSTA 3HMJG 2DKIA 1AQXA 3KCMA 1WPIA 2HXKA 4FYCA 5D9TA 2HT9A 2HNLA 4MH3A 2K8VA 4QL9A 3HKRA 5J47A 1AIUA 2HRKB 3TJFA 2ON5A 3HVXA 2VL2A 1THXA 3CTFA 5HQPA 3L78A 2A2PA 2OADA 1YKCA 4AKXB 5AIXA 2YP6A 2LJKA 1DE1A 1MTCA 5KN3A 5CAXA 4IVFA 1A24A 4MZBA 5GAND 1A0RP 2HRKA 1G7OA 2YWOA 1TDIA 3DRNA 4XIHA 4HU9A 5F8BA 2OA7A 1EP8A 3HHVA 2R0PA 3O76A 3QOUA 1PX6A 5KN2A 2EFEA 4Q5FA 4RI7A 4JBBA 2IFQB 1XFLA 4POMA 4JU5A 1OE7A 4KCEA 3IRAA 2CX3A 2H0IA 1HNCA 4K7NA 4PQ1A 2JZTA 2GQLA 1TKDB 2B6MA 2L4CA 3KD0A 2HE3A 3HYPA 3L0HA 3L9SA 1BF5A 4CY8A 4DEJA 1M99A 3HXSA 1FOHA 3QR6A 1SK0A 2IFQA 2VAFA 1SJ6A 2A4VA 2A4HA 3WT1A 4IS0A 1XWGA 2I4AA 1WIKA 3TCOA 1FO5A 3HVSA 2PVQA 4XTSA 4ML1A 3SWLA 1O85A 5IPGA 1TXUA 3E9JB 3UARA 4JRRA 3F4SA 3WD6A 3MAKA 2GZPA 4HS1A 4YKGA 4WF5A 3FK8A 1LJRA 4DVCA 2V2GA 3KH7A 4KGIA 4NPBA 4AKGA 3WT2A 2YV9A 3H93A 4K5SA 1YKAA 4MA9A 4L5OA 2O85A 1M2DA 3PPUA 1X9SB 1O8WA 1SENA 3FR9A 5G5EA 3GX8A 2QC7A 5IMCA 2KP2A 5IMFA 2H72A 1YF1A 2LRCA 1N2AA 4K7OA 1XPVA 2QKEA 4V2NA 5GZZB 5IMDA 1GRXA 2C3NA 4IJIA 4IP6A 4EVMA 3CRUA 3LYPA 3MNGA 2WFCA 2PN8A 1EWXA 3UOMA 3EURA 2C1YA 3EINA 5IPHA 3PGTA 4LL4B 5ECRB 4YAPA 1QUWA 3QCPA 3HZ8A 3MIXA 1FG4A 2OBIA 3GIXA 2BTOT 3TDGA 3M8NA 2VL3A 2LKUA 5LD0A 3W8JA 2JSYA 4MDCA 1NM3A 1FAAA 1PMTA 3U5RE 20GSA 2QGVA 2YWNA 4MF5A 1K3OA 5CRWA 1S3AA 2IN3A 2IMKA 2H71A 3MYDA 3GYKA 3DMLA 2ZUPA 5G1KA 3DYRA 5IQYA 5A5KA 3LW9A 3FKFA 1U88A 4ID0A 2E2MA 2IPAA 5CO3A 1GSDA 4GSSA 4PUAA 5BMUB 4OO5A 2B5YA 4E8HA 2LQOA 5ELAA 1XOAA 1X9MB 5ECPB 3ZMLA 12GSA 4GWRA 2C8UA 1FB0A 4GQCA 2YJHA 4FQUA 5FWGA 1YF0A 2OBKA 4POBA 1EP7A 2C4JA 3VI7A 5BMUA 3CTGA 4GRFA 2CVKA 4HZ4A 1OC3A 1K0DA 1TI3A 4WF4A 2EIQA 1V58A 2IIYA 3ZREA 2H74A 5J4YA 3F4RA 6GSVA 5FHIA 4MMMA 1CQGA 3FMWA 5ECQB 1ON4A 4MF6A 2WRTA 2K18A 2WCIA 3CYNA 1NHYA 3ZL5A 1V40A 3HA9A 4RQXA 3AY8A 4NV2A 2YN1A 4KUNA 3H4KA 3C7MA 2VCWA 2LNSA 3DVXA 3WGXA 2H6YA 1X5CA 2REMA 4JR6A 2UV8G 2VCQA 3DD3A 2GLRA 3LYKA 2VL2C 1N25A 5ECHB 4ILFA 4DSSB 4LMWA 2TRXA 5DAKB 1BQ7A 5ENUA 2FGXA 1JFUA 1ZL9A 2KUCA 4GSTA 1U87A 1PN0A 5DQYA 2HSHA 1GNWA 2AYTA 1T4YA 1Y25A 6GSSA 3I43A 3L9VA 1A23A 4IW9A 4DSSA 4BA7A 1U3AA 2F3MA 5DAKA 1F6MC 3BCKA 5JWRB 3D4MA 2CVBA 1J08A 2L5LA 3F4TA 2OE0A 1LBKA 2HZEB 2WULA 4ULXA 1SYRA 1SK2A 1R5AA 5DCGA 4KNDA 3UBKA 1WWJA 1Q98A 2KP1A 1XBSA 2H01A 4Q5NA 1HYUA 2E2GA 2FWHA 1SL2B 2X8GA 5JWQB 4WBRD 1TK0B 5IMVA 4J57E 1PN9A 1X5DA 3IE3A 2HZEA 4Z7XA 2H1GA 18GSA 4KH7A 3TOTA 3ME8A 3KMOA 2LNTA 5FT3A 4IN0A 2GSQA 1K0OA 1U6TA 2HQTA 1Z6MA 5ELGA 4NHZA 4HUAA 4YQMA 1XWAA 1SYXA 4MJBA 4ZB9A 4BVYA 2MMAA 1MEKA 4OFNA 3D21A 2PU9C 3U6VA 1O73A 3VWVA 2GSRA 1WRYA 4EL1A 1USBA 1J9BA 5C04A 1V57A 3GA4A 3GL3A 4X0XA 1AXDA 4HI7A 4EDYA 3NIVA 1R26A 2L4QA 1S3DA 1U3IA 2GQKA 1RK4A 3ZIVA 4YH2A 3TRQA 4O32A 2D2ZA 4ECCA 5LNKe 2NTOA 1VRSD 4RI6A 3KZQA 2EFDA 2WS2A 2G2QA 5F05A 2R37A 2H70A 4TRXA 1QMVA 2GZYA 5C00A 2RUFA 3TKSA 3ZZXA 5D9VA 2DMMA 2VD1A 1SJZA 4N30A 1EZKA 1K0AA 2IL3A 1EOHA 3IC8A 2R3XA 1XVWA 3Q19A 3FZ5A 1PKWA 5G5FA 3VI5A 2DJKA 1YVLA 1GLQA 4BVXB 1Z7PA 3E3EA 4MP4A 2IMIA 2BJXA 1X9WB 4MNNA 3EMXA 1V9WA 4ZIJA 1O8XA 5COHA 3NZNA 2AJQB 1M9BA 1YY7A 4OO4A 4G2EA 1GNEA 1B4QA 4GLTA 3W6GA 5B8AA 3TRXA 4F82A 1SKSB 3ZMKA 1Z3EA 3TB2A 5HFGA 1RQMA 4IHUA 4CDOA 1X5EA 4AGSA 1HNAA 1XWKA 4KSMA 1EGRA 1K3LA 3UAPA 1B9YC 4EIPA 1T00A 4V1Ap 4ZILA 3ZFBA 3GHAA 5DBQA 1TTZA 2V41A 3FR3A 4F0BA 4MZWA 3QFBC 4DSQA 4PQIA 1AAZA 3QAWA 1TXXA 4GXZA 2LS5A 5AIVA 1JLVA 2JZSA 3IOSA 2GSTA 2H1DA 3ERGA 4XRAA 5ECIB 2ALBA 3CRTA 2O8VB 1J0FA 4AKHA 4Z2TA 2P0GA 1ZYNA 2GQMA 4YQVA 5A4UA 1IYHA 4GF0A 3UL3A 6GSXA 4PXOA 1PA3A 8GSSA 2XBQA 3GKNA 5B7CA 2LUSA 1MDIA 3EYTA 4LA1A 4MJAA 3LWAA 2DBCA 2ES7A 1BYEA 4IQ1A 3ERFA 2TRCP 4LL1B 2VLTA 3KXOA 2DJ2A 2MBSA 5J40A 4V1Ag 2CV4A 4KCAA 4QMKA 4K0NA 3HD5A 2B1KA 4XCSA 4MABA 1HD2A 1X0RA 14GSA 1E2YA 3H1NA 1K0MA 3Q18A 1F3BA 4WKWA 2RM5A 3CSHA 3GSTA 4J56E 1M2BA 1HQOA 2X8CA 4HZ2A 2P5QA 4I8BA 1ZYEA 2CAIA 4KDUA 3GV1A 1XZOA 2FCHA 5KOWA 3RHCA 4JZQA 3D0ZA 2C0FA 4O5UA 2IJYA 6GSUA 4L0UA 2PGTA 2PUKC 2NDOA 1YZXA 2UZ8A 2VM1A 1QFNA 4MJEA 3HY2A 2V6KA 1XOBA 3UEMA 1TRSA 4OFMA 3KP8A 1BAYA 5GAPD 3V1WA 4N0ZA 1THOA 2DIZA 2H6ZA 4N0VA 1QQ2A 1TOFA 1TRWA 4K2XA 1GTUA 1SL0B 3DKSA 4TXOB 3TKRA 2OE3A 2Z9SA 5HR3A 3TRPA 4OCEA 2C0EA 3BCIA 5DJLA 1N8JA 4ZBBA 3UVHA 5CP1A 3QD9A 3GH6A 3RBTA 2A2RA 5IO2A 4K6XA 4WXTA 2XHFA 2GSSA 2YV7A 2CZ2A 3BD2A 4TXOA 1XXUA 5IO0A 4ZL7A 4IGJA 2L6DA 3RDWA 3US3A 2TIRA 3VURA 4WETA 2WZ9A 2L5OA 2YANA 1SK1A 2E0QA 2FLSA 2V1MA 3LFLA 1BG1A 1FVKA 4FYBA 4MH2A 2MMNA 5AGYA 1PKZA 1MD3A 2FWGA 4F0CA 3ZVJD 2GS3A 3IAS2 2R2JA 1FW1A 3APQA 3ZIJA 1ZYQB 2DLXA 3ZTLA 4EE0A 4NWYA 1HNBA 1SJIA 3FR6A 2PBJA 1JHBA 1ERUA 3GKKA 4ZBDA 3J7Yk 3EE2A 3L9UA 4X1UA 3QFAC 1FB6A 4KDYA 2VCZA 1TK8B 1M9AA 3UVTA 3BBYA 2MYGA 3DEXA 4CW9A 2GZZA 3TKPA 2FD3A 3QDNA 4E68A 2DSAA 3HJPA 2H0GA 1G0TA 5BRTA 4FYUA 2B7KA 1TW9A 1XW9A 2X8HA 1VF3A 2JSZA 3CBUA 4OCFA 2AAWA 4HQZA 4NXIA 2KLXA 3KGKA 3O3TA 1B9XC 1BX9A 1QXHA 3IA1A 3TJJA 3KH9A 5DJMA 2C0GA 5CRDA 2QSIA 4MK3A 3A5WA 4YKFA 4ECJA 2HSNB 3FY7A 4XS6A 2KOKA 2H6XA 2LRNA 22GSA 1LU4A 5IM9A 3LSZA 2B3SA 1ACVA 5ECMB 3WGEA 3ZFLA 4ZL9A 4AKIA 3P2AA 9GSSA 5CRGA 2P5RA 3DVWA 3FHKA 4PNFA 3EWLA 5EY6A 1GSUA 1DUGA 2HSNA 2YPMA 5GSSA 2XPDA 2YNXA 3EMPA 1QGVA 4Z2UA 4BWSA 3FZ4A 5J41A 4AJ8A 2H73A 3VFIA 4HU7A 4USSA 4OD7A 1GL8A 1BG5A 3IAM2 4GDFA 1JZOA 4KE3A 4G0LA 4HDEA 4V2LA 3TKQA 3M0FA 1R7HA 1ST9A 3WGDA 1ABAA 2E7PA 2F9SA 5JCGA 3GL5A 4PX1A 5G31A 3I6AA 2L59A 3IHGA 4Q5RA 5A5HB 2VLVA 1V2AA 3VPQA 3ED3A 2YZUA 1GSEA 2WGRA 3VWUA 1GP1A 5EVOA 2X64A 3VPTA 4BL7B 4LMVA 4N3ZA 3G9BA 2HI7A 2V32A 2K8SA 5D9XA 3RPNA 1Z9HA 1V98A 3KTBA 4GCIA 4EF0A 3C1RA 5KOXA 4MZCA 1TI1A 5A5HA 3HCZA 3F6FA 4ML6A 1PRXA 3GN3A 1H4OA 3WYWA 1PSQA 4BL7A 2VCXA 2OE1A 2H75A 5J9BA 3ZITA 4EKZA 1GUHA 4G0KA 2GVPA 1SKWB 2FUG2 1JZRA 1T4ZA 1PX7A 4N10A 3A3TA 2KHPA 4MLYA 1AQWA 1ZOFA 4ZB7A 3SBCA 1B48A 1B8XA 5ID2B 2MZCA 4MCUA 5KN0A 3IDVA 2J9HA 4MJCA 3F8UA 2HSYA 2LJAA 1WOUA 5D96A 3F0IA 3FEUA 4DSRA 4F03A 4IJ3A 3GKMA 3KMNA 2VUPA 1Y1UA 3TU3B 3J7Yb 4PUFC 3D6IA 3P90A 5ID2A 3F63A 5G2ZA 3IPZA 1C72A 3TGZA 2H76A 1QK8A 2F8FA 3R3EA 3UJ1A 1VF2A 4TOPA 3CXGA 17GSA 4K1FA 1SVLA 3HDCA 4OFTA 1GSSA 2OJLA 3TJKA 1YEPA 4G9HA 1FVJA 3A2WA 1MD4A 1GUMA 2H1BA 2M80A 4NMUA 1A2MA 2H1LA 5D9WA 7GSSA 1M7TA 1RW1A 3MWHA 1F3AA 1EV4A 1XVQA 4TW5A 1OKDA 4AJ6A 2DJ3A 4MF7A 4X4JA 5ECOB 4I6XA 5LCZA 3HZ4A 5G30A 2PWJA 1GSQA 3IR4A 5CYYA 3D22A 1OYJA 1Q4JA 3CSIA 3C1SA 5INYA 3CSJA 4LLRA 2I3YA 4GTUA 2VL9A 4TR3A 4EIQA 1SVMA 2DIYA 2YZHA 1T3BA 4K9ZA 4IKHA 4PQHA 4MPFA 2DMLA 1GWCA 1GSFA 1TRVA 2ZNMA 4XRDA 4K2DA 2HRNA 1JLWA 2L6CA 1K0NA 2DKHA 5HFIA 4FO5A 6GSWA 5B6NA 5GSTA 5EPFA 2B1LA 2DJJA 3QPMA 3IBHA 4XHMA 2ON7A 4BVXA 2JZRA 1Z5YE 2YCDA 2I9HA 2IMDA 2AB6A 3FZ9A 1TRUA 5HFKA 2XBIA 2VLUA 4QL7A 1SD8A 3M3MA 3I9V2 1JZDA 2AUVA 2C0DA 4BPYA 4WEYA 2I81A 3VK9A 2WJUA 3LG6A 4PNGA 3F9UA 4ISDA 1H75A 3APSA 3L4NA 3N5OA 4HJMA 4TR0A 1I5GA 5IMAA 5ECLB 3ISOA 3IV4A 2C80A 1K0BA 2MMZA 3N9JA 4HOJA 2DJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN8 A;  2R6K A;  4I2U A;  4TR4 A;  1XW6 A;  4ZB6 A;  4L8E A;  1A8L A;  2R4V A;  5E59 A;  4IBP A;  4IEL A;  4E8E A;  2CAQ A;  4RQR A;  1M2A A;  1UA5 A;  2M46 A;  4K0G A;  2HYX A;  1A8Y A;  1SU9 A;  1VF4 A;  2G0F A;  3GH9 A;  2PVO C;  1KTE A;  1GSY A;  2LQQ A;  1K3Y A;  1GH2 A;  3ZLP A;  3W8S A;  3UBL A;  3ZVJ A;  1PD2 1;  3BOA A;  1YQ1 A;  4G0I A;  2FY6 A;  1T7P B;  2BMX A;  1F2E A;  19GS A;  4P3Y B;  3H79 A;  1TU8 A;  1SKR B;  2CZ3 A;  1M0U A;  1B4P A;  2H19 A;  1AW9 A;  2EC4 A;  1WMJ A;  3H8Q A;  2RLI A;  2CX4 A;  5IOW A;  4J2F A;  4HEA 2;  3GX0 A;  2C3T A;  5ECS A;  4KX4 A;  3KP9 A;  1G6Y A;  2WDU A;  4K7I A;  4HJ2 A;  2VO4 A;  3TOU A;  4NHW A;  2JL4 A;  1GLP A;  3C73 A;  2N5F A;  5J5N A;  5A4V A;  5IIZ A;  2VOC A;  5L71 A;  2YOI A;  1YEX A;  1SL1 B;  2WB9 A;  1E6B A;  2FWF A;  2PER A;  5D8I A;  5DCH A;  5G1L A;  4FIW A;  4Q5Q A;  2PPT A;  1JZW A;  3UIW A;  3UMA A;  2ZCT A;  1AUC A;  2XC2 A;  4IP1 A;  5DAL B;  3K8N A;  3VWW A;  4F2I A;  4PTS A;  2IMF A;  2CVD A;  3M9K A;  1W4V A;  10GS A;  3I69 A;  2IME A;  2LEG A;  5F06 A;  3DXB A;  3BJ5 A;  2IWT A;  1URM A;  1UN2 A;  4ZB8 A;  1O81 A;  1PL1 A;  11GS A;  2VM2 A;  4I5Q A;  3RAZ A;  1VGL A;  3TKS E;  5DAL A;  3HVV A;  1NHO A;  4KA0 A;  2L57 A;  3DGQ A;  4KDX A;  3LGC A;  2FNO A;  3P7X A;  2AHE A;  3APO A;  1CQH A;  1EEM A;  3ERW A;  1GUL A;  3GSS A;  1XWB A;  2GT5 A;  4WBJ A;  1YJ6 A;  1DE2 A;  2VCV A;  5ECK B;  5JCW A;  5D93 A;  5IOX A;  1XW5 A;  16GS A;  3LEF A;  4AF2 A;  3M9J A;  4EUY A;  4AJ7 A;  3D5J A;  2RM6 A;  4HQS A;  3G7Y A;  1WJK A;  4NAX A;  1ZZY A;  3OR5 A;  3HJM A;  4POK A;  2H8L A;  3RHB A;  2DC5 A;  2VD0 A;  5DDL A;  3S9F A;  1XIY A;  2VIM A;  2HLS A;  1R5P A;  2C3Q A;  2HSM B;  1R4W A;  1EOG A;  2CA8 A;  3VLN A;  1DSB A;  1ERW A;  3TKS C;  1PQN A;  1GTI A;  4KB3 A;  1OVN A;  2HZF A;  3GRX A;  3MSZ A;  1AQV A;  3IK7 A;  4OWY A;  3LQ7 A;  2I1U A;  4IQA A;  1ZGN A;  3PH9 A;  4I97 A;  4XS1 A;  4ZBA A;  3F3R A;  3G7I A;  5HR0 A;  1W89 A;  5EL8 A;  2HSM A;  4WR4 A;  4MPG A;  3EU3 A;  3GUS A;  3JCM L;  3ZYW A;  3HJO A;  2GT6 A;  5D73 A;  1XWC A;  1NSW A;  3QAG A;  3D4T A;  2RII A;  5KEJ A;  4GSN A;  5CNW A;  1NW2 A;  1A2J A;  2OAC A;  1EGO A;  5H5S A;  5J4U A;  1ZMA A;  4KSO A;  1GTA A;  3TJB A;  4ACS A;  1TU7 A;  3GTU B;  5H5R A;  4PGT A;  2P31 A;  3O6T A;  4XS4 B;  1A0F A;  1PGT A;  5JCU A;  3LOR A;  2GGT A;  1OKT A;  3MDK A;  2VCT A;  2PMT A;  3FW2 A;  2B5E A;  1I9D A;  5ECN B;  4L0W A;  1OC9 B;  2B7J A;  3GMF A;  3GTU A;  4KAE A;  1SD9 A;  1YDK A;  4CHS A;  5J3R A;  1UVZ A;  3E0U A;  4XS4 A;  1T1V A;  1BJX A;  2HRA A;  2J23 A;  3DIE A;  1ERV A;  4POL A;  1MDK A;  4BWQ A;  1Y6E A;  4O7H A;  1MDJ A;  2HRF A;  2H0H A;  1ML6 A;  3CMI A;  3KM6 A;  1KNG A;  2LTK A;  3EC3 A;  2MMO A;  1G6W A;  1OC9 A;  4PUR A;  5DQS A;  1XCC A;  2FHE A;  3KEB A;  3GFK A;  2RUE A;  2EIO A;  2MBT A;  2H30 A;  2NVL A;  1EEJ A;  1Z6N A;  2CQ9 A;  2NBS A;  4QQ7 A;  2F51 A;  3LXZ A;  3Q6O A;  4GQF A;  1IYI A;  5HR1 A;  4NV5 A;  2H1A A;  3A2V A;  2FWE A;  3IK9 A;  1Z7R A;  3IXR A;  3PIN A;  2R5G A;  3QMX A;  4F9Z A;  1PL2 A;  1F37 A;  5DVB A;  4V2M A;  1FOV A;  4ZL8 A;  2H66 A;  1EV9 A;  3A2X A;  4JE1 A;  4FH8 A;  3TUE A;  4TR1 B;  5E4W A;  4X43 A;  4N11 A;  1O6J A;  1TJD A;  1ZCP A;  2JAC A;  2K6V A;  2O7K A;  2N5B A;  3LJR A;  4RUV A;  2YWM A;  3KJY A;  3PR8 A;  2LRT A;  1TP9 A;  3IC4 A;  4H86 A;  3EVI A;  1BED A;  3FRC A;  5A4W A;  2O87 A;  5F07 A;  5CRE A;  5H5Q A;  4TR1 A;  1TK5 B;  2GDR A;  2DJ1 A;  5JWO B;  13GS A;  1FHE A;  3Q74 A;  4BVY B;  2HFD A;  4OMV A;  1OAZ A;  2K9F A;  2LV3 A;  2AV4 A;  3EU4 A;  1A2L A;  1WE0 A;  3G7J A;  2XPE A;  4WR5 A;  5F0G A;  4G10 A;  5AN1 A;  1OC8 A;  2A2S A;  2JAD A;  1ILO A;  2NPB A;  3VWX A;  1K0C A;  5HR2 A;  4EXJ A;  2CT6 A;  3F6D A;  4D73 B;  2LJR A;  4ECI A;  4TVE A;  5CRH A;  4I2T A;  4YQU A;  1GUK A;  1KEB A;  6GST A;  5AIS A;  3DWV A;  1F9M A;  3NOF A;  1KBN A;  3ME7 A;  5J9C A;  4D73 A;  3GKX A;  5B8B A;  2M72 A;  1OE8 A;  4YAV A;  3R2Q A;  1VF1 A;  4L5L A;  4K8M A;  2N5A A;  4JR4 A;  2F8A A;  3M1G A;  4ZXG A;  2FA8 A;  3RPP A;  4O92 A;  3GNJ A;  5IMZ A;  4KF9 A;  3KTL A;  1DBY A;  4KW6 A;  3QAV A;  3TJG A;  3P8W A;  3F3Q A;  1UC7 A;  1WP0 A;  3KIJ A;  4TKY A;  5KN1 A;  3ZRD A;  3C8E A;  4EC0 A;  4ECB A;  2OKA A;  1T8E B;  1GTB A;  2O89 A;  4O5R A;  5B6M A;  3IHQ A;  2FA4 A;  1AC1 A;  5ABR A;  1O7U A;  2EIR A;  3LXT A;  1S3C A;  2B5X A;  2GTU A;  2X99 A;  4EDZ A;  3FZA A;  2JU5 A;  1G7E A;  4EO3 A;  3C71 A;  3FYG A;  4JED A;  2YWI A;  6GSY A;  3GUR A;  4G19 A;  1ERT A;  2YJ7 A;  4TXV A;  2V6O A;  2LST A;  1AQX A;  3KCM A;  1WPI A;  2HXK A;  4FYC A;  5D9T A;  2HT9 A;  2HNL A;  4MH3 A;  2K8V A;  4QL9 A;  3HKR A;  1AIU A;  2HRK B;  3TJF A;  2ON5 A;  3HVX A;  2VL2 A;  1THX A;  3CTF A;  5HQP A;  3L78 A;  2OAD A;  1YKC A;  5AIX A;  2YP6 A;  2LJK A;  1DE1 A;  1MTC A;  5KN3 A;  5CAX A;  4IVF A;  1A24 A;  4MZB A;  5GAN D;  1A0R P;  2HRK A;  1G7O A;  2YWO A;  1TDI A;  3DRN A;  4XIH A;  4HU9 A;  5F8B A;  2OA7 A;  1EP8 A;  3HHV A;  3O76 A;  3QOU A;  1PX6 A;  5KN2 A;  4Q5F A;  4RI7 A;  4JBB A;  2IFQ B;  1XFL A;  4POM A;  4JU5 A;  1OE7 A;  4KCE A;  3IRA A;  2CX3 A;  2H0I A;  1HNC A;  4K7N A;  4PQ1 A;  2JZT A;  2GQL A;  1TKD B;  2B6M A;  2L4C A;  3KD0 A;  2HE3 A;  3HYP A;  3L0H A;  3L9S A;  4DEJ A;  1M99 A;  3HXS A;  3QR6 A;  1SK0 A;  2IFQ A;  1SJ6 A;  2A4V A;  2VAF A;  3WT1 A;  4IS0 A;  1XWG A;  2I4A A;  1WIK A;  3TCO A;  1FO5 A;  3HVS A;  2PVQ A;  4XTS A;  4ML1 A;  3SWL A;  1O85 A;  5IPG A;  3E9J B;  3UAR A;  4JRR A;  3F4S A;  3WD6 A;  3MAK A;  2GZP A;  4HS1 A;  4WF5 A;  3FK8 A;  1LJR A;  4DVC A;  2V2G A;  3KH7 A;  4KGI A;  4NPB A;  3WT2 A;  2YV9 A;  3H93 A;  1YKA A;  4MA9 A;  4L5O A;  2O85 A;  1M2D A;  3PPU A;  1X9S B;  1O8W A;  1SEN A;  3FR9 A;  5G5E A;  3GX8 A;  2QC7 A;  5IMC A;  2KP2 A;  5IMF A;  2H72 A;  1YF1 A;  2LRC A;  1N2A A;  4K7O A;  1XPV A;  2QKE A;  4V2N A;  5GZZ B;  5IMD A;  1GRX A;  2C3N A;  4IJI A;  4IP6 A;  4EVM A;  3CRU A;  3LYP A;  3MNG A;  2WFC A;  2PN8 A;  1EWX A;  3UOM A;  3EUR A;  2C1Y A;  3EIN A;  5IPH A;  3PGT A;  4LL4 B;  5ECR B;  4YAP A;  1QUW A;  3QCP A;  3HZ8 A;  1FG4 A;  2OBI A;  3GIX A;  2BTO T;  3TDG A;  3M8N A;  2VL3 A;  2LKU A;  5LD0 A;  3W8J A;  2JSY A;  4MDC A;  1NM3 A;  1FAA A;  1PMT A;  3U5R E;  20GS A;  2QGV A;  2YWN A;  4MF5 A;  1K3O A;  5CRW A;  1S3A A;  2IN3 A;  2IMK A;  2H71 A;  3GYK A;  3DML A;  2ZUP A;  5G1K A;  3DYR A;  5IQY A;  5A5K A;  3FKF A;  1U88 A;  4ID0 A;  2E2M A;  2IPA A;  5CO3 A;  1GSD A;  4GSS A;  4PUA A;  4OO5 A;  2B5Y A;  4E8H A;  2LQO A;  5ELA A;  1XOA A;  1X9M B;  5ECP B;  3ZML A;  12GS A;  4GWR A;  2C8U A;  1FB0 A;  4GQC A;  2YJH A;  4FQU A;  5FWG A;  1YF0 A;  2OBK A;  4POB A;  1EP7 A;  2C4J A;  3VI7 A;  5BMU A;  3CTG A;  4GRF A;  2CVK A;  4HZ4 A;  1OC3 A;  1K0D A;  1TI3 A;  4WF4 A;  2EIQ A;  1V58 A;  2IIY A;  3ZRE A;  2H74 A;  3F4R A;  6GSV A;  5FHI A;  4MMM A;  1CQG A;  5ECQ B;  1ON4 A;  4MF6 A;  2WRT A;  2K18 A;  2WCI A;  3CYN A;  1NHY A;  3ZL5 A;  1V40 A;  3HA9 A;  4RQX A;  3AY8 A;  4NV2 A;  2YN1 A;  4KUN A;  3H4K A;  3C7M A;  2VCW A;  2LNS A;  3DVX A;  3WGX A;  2H6Y A;  1X5C A;  2REM A;  4JR6 A;  2VCQ A;  3DD3 A;  2GLR A;  3LYK A;  2VL2 C;  5ECH B;  4ILF A;  4DSS B;  4LMW A;  2TRX A;  5DAK B;  1BQ7 A;  5ENU A;  2FGX A;  1JFU A;  1ZL9 A;  2KUC A;  4GST A;  1U87 A;  5DQY A;  2HSH A;  1GNW A;  2AYT A;  1T4Y A;  1Y25 A;  6GSS A;  3I43 A;  3L9V A;  1A23 A;  4IW9 A;  4DSS A;  4BA7 A;  1U3A A;  2F3M A;  5DAK A;  1F6M C;  3BCK A;  5JWR B;  3D4M A;  2CVB A;  1J08 A;  2L5L A;  3F4T A;  2OE0 A;  1LBK A;  2HZE B;  2WUL A;  4ULX A;  1SYR A;  1SK2 A;  1R5A A;  5DCG A;  4KND A;  3UBK A;  1WWJ A;  1Q98 A;  2KP1 A;  1XBS A;  2H01 A;  4Q5N A;  1HYU A;  2E2G A;  2FWH A;  1SL2 B;  2X8G A;  5JWQ B;  4WBR D;  1TK0 B;  5IMV A;  4J57 E;  1PN9 A;  1X5D A;  3IE3 A;  2HZE A;  4Z7X A;  2H1G A;  18GS A;  4KH7 A;  3TOT A;  3ME8 A;  3KMO A;  2LNT A;  5FT3 A;  4IN0 A;  2GSQ A;  1K0O A;  1U6T A;  2HQT A;  1Z6M A;  5ELG A;  4NHZ A;  4HUA A;  4YQM A;  1XWA A;  1SYX A;  4MJB A;  4ZB9 A;  4BVY A;  2MMA A;  1MEK A;  4OFN A;  3D21 A;  2PU9 C;  3U6V A;  1O73 A;  3VWV A;  2GSR A;  1WRY A;  4EL1 A;  1USB A;  1J9B A;  5C04 A;  1V57 A;  3GA4 A;  3GL3 A;  4X0X A;  1AXD A;  4HI7 A;  4EDY A;  3NIV A;  1R26 A;  2L4Q A;  1S3D A;  1U3I A;  2GQK A;  1RK4 A;  3ZIV A;  4YH2 A;  3TRQ A;  4O32 A;  2D2Z A;  4ECC A;  5LNK e;  2NTO A;  1VRS D;  4RI6 A;  3KZQ A;  2WS2 A;  2G2Q A;  5F05 A;  2R37 A;  2H70 A;  4TRX A;  1QMV A;  2GZY A;  5C00 A;  2RUF A;  3TKS A;  3ZZX A;  5D9V A;  2DMM A;  2VD1 A;  1SJZ A;  4N30 A;  1EZK A;  1K0A A;  2IL3 A;  1EOH A;  3IC8 A;  2R3X A;  1XVW A;  3Q19 A;  3FZ5 A;  1PKW A;  5G5F A;  3VI5 A;  2DJK A;  1GLQ A;  4BVX B;  1Z7P A;  3E3E A;  4MP4 A;  2IMI A;  2BJX A;  1X9W B;  3EMX A;  1V9W A;  4ZIJ A;  1O8X A;  5COH A;  3NZN A;  2AJQ B;  1M9B A;  1YY7 A;  4OO4 A;  4G2E A;  1GNE A;  1B4Q A;  4GLT A;  3W6G A;  5B8A A;  3TRX A;  4F82 A;  1SKS B;  3ZMK A;  1Z3E A;  3TB2 A;  5HFG A;  1RQM A;  4IHU A;  4CDO A;  1X5E A;  4AGS A;  1HNA A;  1XWK A;  4KSM A;  1EGR A;  1K3L A;  3UAP A;  1B9Y C;  1T00 A;  4V1A p;  4ZIL A;  3ZFB A;  3GHA A;  5DBQ A;  1TTZ A;  2V41 A;  3FR3 A;  4F0B A;  4MZW A;  3QFB C;  4DSQ A;  4PQI A;  1AAZ A;  3QAW A;  1TXX A;  4GXZ A;  2LS5 A;  5AIV A;  1JLV A;  2JZS A;  3IOS A;  2GST A;  2H1D A;  3ERG A;  4XRA A;  5ECI B;  2ALB A;  3CRT A;  2O8V B;  1J0F A;  2P0G A;  2GQM A;  4YQV A;  5A4U A;  1IYH A;  4GF0 A;  3UL3 A;  6GSX A;  4PXO A;  1PA3 A;  8GSS A;  2XBQ A;  3GKN A;  5B7C A;  2LUS A;  1MDI A;  3EYT A;  4LA1 A;  4MJA A;  3LWA A;  2DBC A;  2ES7 A;  1BYE A;  4IQ1 A;  3ERF A;  2TRC P;  4LL1 B;  2VLT A;  3KXO A;  2DJ2 A;  2MBS A;  4V1A g;  2CV4 A;  4KCA A;  4K0N A;  3HD5 A;  2B1K A;  4XCS A;  4MAB A;  1HD2 A;  1X0R A;  14GS A;  1E2Y A;  3H1N A;  1K0M A;  3Q18 A;  1F3B A;  4WKW A;  2RM5 A;  3CSH A;  3GST A;  4J56 E;  1M2B A;  1HQO A;  2X8C A;  4HZ2 A;  2P5Q A;  4I8B A;  1ZYE A;  2CAI A;  4KDU A;  3GV1 A;  1XZO A;  2FCH A;  3RHC A;  4JZQ A;  3D0Z A;  2C0F A;  2IJY A;  6GSU A;  4L0U A;  2PGT A;  2PUK C;  2NDO A;  1YZX A;  2UZ8 A;  2VM1 A;  1QFN A;  4MJE A;  3HY2 A;  2V6K A;  1XOB A;  3UEM A;  1TRS A;  4OFM A;  3KP8 A;  1BAY A;  5GAP D;  3V1W A;  4N0Z A;  1THO A;  2DIZ A;  2H6Z A;  4N0V A;  1QQ2 A;  1TOF A;  1TRW A;  1GTU A;  1SL0 B;  3DKS A;  4TXO B;  3TKR A;  2OE3 A;  2Z9S A;  5HR3 A;  3TRP A;  4OCE A;  2C0E A;  3BCI A;  5DJL A;  1N8J A;  4ZBB A;  3UVH A;  5CP1 A;  3QD9 A;  3GH6 A;  3RBT A;  2A2R A;  5IO2 A;  4K6X A;  4WXT A;  2XHF A;  2GSS A;  2YV7 A;  2CZ2 A;  3BD2 A;  4TXO A;  1XXU A;  5IO0 A;  4ZL7 A;  4IGJ A;  2L6D A;  3RDW A;  3US3 A;  2TIR A;  3VUR A;  4WET A;  2WZ9 A;  2L5O A;  2YAN A;  1SK1 A;  2E0Q A;  2FLS A;  2V1M A;  3LFL A;  1FVK A;  4FYB A;  4MH2 A;  2MMN A;  5AGY A;  1PKZ A;  1MD3 A;  2FWG A;  4F0C A;  3ZVJ D;  2GS3 A;  3IAS 2;  2R2J A;  1FW1 A;  3APQ A;  3ZIJ A;  1ZYQ B;  2DLX A;  3ZTL A;  4EE0 A;  4NWY A;  1HNB A;  1SJI A;  3FR6 A;  2PBJ A;  1JHB A;  1ERU A;  3GKK A;  4ZBD A;  3J7Y k;  3EE2 A;  3L9U A;  4X1U A;  3QFA C;  1FB6 A;  4KDY A;  2VCZ A;  1TK8 B;  1M9A A;  3UVT A;  3BBY A;  2MYG A;  3DEX A;  4CW9 A;  2GZZ A;  3TKP A;  2FD3 A;  3QDN A;  2DSA A;  3HJP A;  2H0G A;  1G0T A;  4FYU A;  2B7K A;  1TW9 A;  1XW9 A;  2X8H A;  1VF3 A;  2JSZ A;  3CBU A;  4OCF A;  2AAW A;  4HQZ A;  4NXI A;  2KLX A;  3KGK A;  3O3T A;  1B9X C;  1BX9 A;  1QXH A;  3IA1 A;  3TJJ A;  3KH9 A;  5DJM A;  2C0G A;  5CRD A;  2QSI A;  4MK3 A;  3A5W A;  4ECJ A;  2HSN B;  3FY7 A;  4XS6 A;  2KOK A;  2H6X A;  2LRN A;  22GS A;  1LU4 A;  5IM9 A;  3LSZ A;  2B3S A;  1ACV A;  5ECM B;  3WGE A;  3ZFL A;  4ZL9 A;  3P2A A;  9GSS A;  5CRG A;  2P5R A;  3DVW A;  3FHK A;  4PNF A;  3EWL A;  5EY6 A;  1GSU A;  1DUG A;  2YPM A;  5GSS A;  2XPD A;  2YNX A;  3EMP A;  1QGV A;  4BWS A;  3FZ4 A;  5J41 A;  4AJ8 A;  2H73 A;  3VFI A;  4HU7 A;  4USS A;  4OD7 A;  1GL8 A;  1BG5 A;  3IAM 2;  1JZO A;  4KE3 A;  4G0L A;  4HDE A;  4V2L A;  3TKQ A;  3M0F A;  1R7H A;  1ST9 A;  3WGD A;  1ABA A;  2E7P A;  2F9S A;  5JCG A;  3GL5 A;  4PX1 A;  5G31 A;  3I6A A;  2L59 A;  4Q5R A;  2VLV A;  1V2A A;  3VPQ A;  3ED3 A;  2YZU A;  1GSE A;  2WGR A;  3VWU A;  1GP1 A;  5EVO A;  2X64 A;  3VPT A;  4BL7 B;  4LMV A;  3G9B A;  2HI7 A;  2V32 A;  2K8S A;  5D9X A;  3RPN A;  1Z9H A;  1V98 A;  3KTB A;  4GCI A;  4EF0 A;  3C1R A;  4MZC A;  1TI1 A;  3HCZ A;  3F6F A;  4ML6 A;  1PRX A;  3GN3 A;  1H4O A;  3WYW A;  1PSQ A;  4BL7 A;  2VCX A;  2OE1 A;  2H75 A;  5J9B A;  3ZIT A;  4EKZ A;  1GUH A;  4G0K A;  2GVP A;  1SKW B;  2FUG 2;  1JZR A;  1T4Z A;  1PX7 A;  4N10 A;  3A3T A;  2KHP A;  4MLY A;  1AQW A;  1ZOF A;  3SBC A;  1B48 A;  1B8X A;  5ID2 B;  2MZC A;  4MCU A;  5KN0 A;  3IDV A;  2J9H A;  4MJC A;  3F8U A;  2HSY A;  2LJA A;  1WOU A;  5D96 A;  3F0I A;  3FEU A;  4DSR A;  4F03 A;  4IJ3 A;  3GKM A;  3KMN A;  2VUP A;  3J7Y b;  4PUF C;  3D6I A;  3P90 A;  5ID2 A;  3F63 A;  5G2Z A;  3IPZ A;  1C72 A;  3TGZ A;  2H76 A;  1QK8 A;  2F8F A;  3R3E A;  3UJ1 A;  1VF2 A;  4TOP A;  3CXG A;  17GS A;  4K1F A;  3HDC A;  4OFT A;  1GSS A;  2OJL A;  3TJK A;  1YEP A;  4G9H A;  1FVJ A;  3A2W A;  1MD4 A;  1GUM A;  2H1B A;  2M80 A;  4NMU A;  1A2M A;  5D9W A;  7GSS A;  1M7T A;  1RW1 A;  3MWH A;  1F3A A;  1EV4 A;  1XVQ A;  4TW5 A;  1OKD A;  4AJ6 A;  2DJ3 A;  4MF7 A;  5ECO B;  4I6X A;  5LCZ A;  3HZ4 A;  5G30 A;  2PWJ A;  1GSQ A;  3IR4 A;  5CYY A;  3D22 A;  1OYJ A;  1Q4J A;  3CSI A;  3C1S A;  5INY A;  3CSJ A;  4LLR A;  2I3Y A;  4GTU A;  2VL9 A;  4TR3 A;  2DIY A;  2YZH A;  1T3B A;  4K9Z A;  4IKH A;  4PQH A;  4MPF A;  2DML A;  1GWC A;  1GSF A;  1TRV A;  2ZNM A;  4XRD A;  4K2D A;  2HRN A;  1JLW A;  2L6C A;  1K0N A;  5HFI A;  4FO5 A;  6GSW A;  5B6N A;  5GST A;  5EPF A;  2B1L A;  2DJJ A;  3QPM A;  3IBH A;  4XHM A;  2ON7 A;  4BVX A;  2JZR A;  1Z5Y E;  2YCD A;  2I9H A;  2IMD A;  2AB6 A;  3FZ9 A;  1TRU A;  5HFK A;  2XBI A;  2VLU A;  4QL7 A;  1SD8 A;  3M3M A;  3I9V 2;  1JZD A;  2AUV A;  2C0D A;  4BPY A;  4WEY A;  2I81 A;  3VK9 A;  2WJU A;  3LG6 A;  4PNG A;  3F9U A;  4ISD A;  1H75 A;  3APS A;  3L4N A;  3N5O A;  4HJM A;  4TR0 A;  1I5G A;  5IMA A;  5ECL B;  3ISO A;  3IV4 A;  2C80 A;  1K0B A;  2MMZ A;  3N9J A;  4HOJ A;  2DJ0 A; 
#chains in the Genus database with same CATH topology
 4TN8 A;  2R6K A;  4I2U A;  4TR4 A;  2OT3 A;  1XW6 A;  4ZB6 A;  4L8E A;  1A8L A;  2R4V A;  5E59 A;  4IBP A;  4IEL A;  4E8E A;  2CAQ A;  4RQR A;  1M2A A;  1UA5 A;  2M46 A;  2O3E A;  4K0G A;  2HYX A;  1A8Y A;  1SU9 A;  1VF4 A;  2G0F A;  3GH9 A;  2PVO C;  1KTE A;  1GSY A;  2LQQ A;  1K3Y A;  1GH2 A;  3ZLP A;  3W8S A;  3UBL A;  3ZVJ A;  1PD2 1;  3BOA A;  1YQ1 A;  4G0I A;  2FY6 A;  1T7P B;  2BMX A;  1F2E A;  4PHZ C;  19GS A;  4P3Y B;  3H79 A;  1TU8 A;  1SKR B;  2CZ3 A;  1M0U A;  1B4P A;  2H19 A;  1AW9 A;  2EC4 A;  1WMJ A;  3H8Q A;  2RLI A;  2CX4 A;  5IOW A;  4J2F A;  4HEA 2;  3GX0 A;  2C3T A;  5ECS A;  2VKZ G;  4KX4 A;  2X49 A;  3KP9 A;  1G6Y A;  1ZYP A;  2WDU A;  4K7I A;  4HJ2 A;  2VO4 A;  4W66 A;  3TOU A;  4NHW A;  2JL4 A;  1GLP A;  3C73 A;  4K5R A;  2N5F A;  5J5N A;  2EFC A;  4Z2R A;  5A4V A;  3A5I A;  5IIZ A;  1XG8 A;  2VOC A;  5L71 A;  2YOI A;  1YEX A;  1SL1 B;  2WB9 A;  3RGB C;  1E6B A;  2FWF A;  2PER A;  5D8I A;  5DCH A;  5G1L A;  4FIW A;  4Q5Q A;  2PPT A;  2WVY A;  1JZW A;  3UIW A;  3UMA A;  2ZCT A;  1AUC A;  2XC2 A;  4IP1 A;  5DAL B;  3K8N A;  3VWW A;  4F2I A;  4PTS A;  2IMF A;  2CVD A;  3M9K A;  3CHX C;  1W4V A;  4FXY P;  10GS A;  3I69 A;  2IME A;  2LEG A;  5F06 A;  3DXB A;  3BJ5 A;  2IWT A;  1URM A;  1UN2 A;  4ZB8 A;  1O81 A;  1PL1 A;  11GS A;  2VM2 A;  4I5Q A;  3RAZ A;  1VGL A;  3TKS E;  5DAL A;  3HVV A;  1NHO A;  4KA0 A;  2L57 A;  3DGQ A;  4KDX A;  3LGC A;  2FNO A;  3P7X A;  2AHE A;  3APO A;  1CQH A;  1EEM A;  3ERW A;  1GUL A;  3GSS A;  1XWB A;  2GT5 A;  4WBJ A;  1YJ6 A;  1DE2 A;  2VCV A;  5ECK B;  5JCW A;  5D93 A;  5IOX A;  1XW5 A;  16GS A;  3LEF A;  4AF2 A;  3M9J A;  4EUY A;  4AJ7 A;  3D5J A;  2RM6 A;  4HQS A;  3G7Y A;  1WJK A;  4NAX A;  1ZZY A;  3OR5 A;  3HJM A;  4POK A;  2H8L A;  3RHB A;  2DC5 A;  2VD0 A;  5DDL A;  3S9F A;  1XIY A;  2VIM A;  2HLS A;  1R5P A;  2C3Q A;  2HSM B;  1R4W A;  1EOG A;  2CA8 A;  3VLN A;  1DSB A;  1ERW A;  3TKS C;  1PQN A;  1GTI A;  4KB3 A;  1OVN A;  2HZF A;  3GRX A;  3MSZ A;  1AQV A;  3IK7 A;  4OWY A;  3LQ7 A;  2I1U A;  4IQA A;  1ZGN A;  3PH9 A;  4I97 A;  4XS1 A;  4ZBA A;  3F3R A;  3G7I A;  5HR0 A;  1W89 A;  5EL8 A;  2HSM A;  4WR4 A;  4MPG A;  3EU3 A;  3GUS A;  3JCM L;  5J4V A;  3ZYW A;  3HJO A;  2GT6 A;  5D73 A;  1XWC A;  1NSW A;  3QAG A;  4A5P A;  3D4T A;  2RII A;  5KEJ A;  4GSN A;  2QA1 A;  5CNW A;  1NW2 A;  1A2J A;  2OAC A;  1EGO A;  5H5S A;  5J4U A;  1ZMA A;  4KSO A;  1GTA A;  3TJB A;  4ACS A;  1TU7 A;  3GTU B;  5H5R A;  4PGT A;  2P31 A;  2X4A A;  3O6T A;  4XS4 B;  1A0F A;  1PGT A;  5JCU A;  3LOR A;  2GGT A;  1OKT A;  3MDK A;  2VCT A;  2PMT A;  3EPT A;  3FW2 A;  2B5E A;  1I9D A;  5ECN B;  4L0W A;  1OC9 B;  4HSC X;  2B7J A;  3GMF A;  3GTU A;  4KAE A;  1SD9 A;  1YDK A;  4CHS A;  5J3R A;  1UVZ A;  3E0U A;  4XS4 A;  1T1V A;  1BJX A;  2HRA A;  2J23 A;  3DIE A;  1ERV A;  4POL A;  1MDK A;  4BWQ A;  1Y6E A;  4O7H A;  1MDJ A;  2HRF A;  2H0H A;  1ML6 A;  3CMI A;  3KM6 A;  1KNG A;  2LTK A;  4G01 A;  3EC3 A;  2MMO A;  1G6W A;  1OC9 A;  4PUR A;  5DQS A;  1XCC A;  4CY6 A;  2FHE A;  3KEB A;  3GFK A;  2RUE A;  2EIO A;  2MBT A;  2H30 A;  2NVL A;  1EEJ A;  1Z6N A;  2CQ9 A;  3CWG A;  2NBS A;  4QQ7 A;  2F51 A;  3LXZ A;  3Q6O A;  4GQF A;  1IYI A;  5HR1 A;  3RFR C;  4NV5 A;  2H1A A;  3A2V A;  2FWE A;  3IK9 A;  1Z7R A;  3IXR A;  3PIN A;  2R5G A;  3QMX A;  4F9Z A;  1PL2 A;  5A1N B;  1F37 A;  4AI6 A;  5DVB A;  4V2M A;  1FOV A;  4ZL8 A;  2H66 A;  1EV9 A;  3A2X A;  4JE1 A;  4FH8 A;  3TUE A;  4TR1 B;  5E4W A;  4X43 A;  4N11 A;  1O6J A;  1TJD A;  1ZCP A;  2JAC A;  2K6V A;  2O7K A;  2N5B A;  3LJR A;  4RUV A;  2YWM A;  3KJY A;  3PR8 A;  2LRT A;  1TP9 A;  3IC4 A;  5A1N A;  4H86 A;  3EVI A;  5A34 B;  1BED A;  3FRC A;  5A4W A;  2O87 A;  5F07 A;  5CRE A;  5H5Q A;  4TR1 A;  1TK5 B;  2GDR A;  2DJ1 A;  5JWO B;  13GS A;  1FHE A;  3Q74 A;  4BVY B;  2HFD A;  2O5V A;  4OMV A;  1OAZ A;  2K9F A;  2LV3 A;  2AV4 A;  3EU4 A;  1A2L A;  1WE0 A;  3G7J A;  5A34 A;  2XPE A;  4WR5 A;  5F0G A;  4G10 A;  5AN1 A;  1OC8 A;  2A2S A;  2JAD A;  1ILO A;  2NPB A;  3VWX A;  1K0C A;  5HR2 A;  2R0C A;  4EXJ A;  2CT6 A;  3F6D A;  4D73 B;  2LJR A;  4ECI A;  4TVE A;  2R0G A;  5CRH A;  4I2T A;  4YQU A;  4ICY A;  1GUK A;  1KEB A;  6GST A;  5AIS A;  2QA2 A;  3DWV A;  4O5Q A;  1F9M A;  3NOF A;  1KBN A;  3ME7 A;  5J9C A;  4D73 A;  3GKX A;  5B8B A;  2M72 A;  1OE8 A;  4YAV A;  3R2Q A;  1VF1 A;  4L5L A;  4K8M A;  2N5A A;  4JR4 A;  2F8A A;  3M1G A;  4ZXG A;  2FA8 A;  3RPP A;  4O92 A;  3GNJ A;  5IMZ A;  4KF9 A;  3KTL A;  1DBY A;  4KW6 A;  3QAV A;  3TJG A;  3P8W A;  3F3Q A;  1UC7 A;  1WP0 A;  3KIJ A;  4TKY A;  5KN1 A;  3ZRD A;  3C8E A;  4EC0 A;  4ECB A;  2OKA A;  1T8E B;  1GTB A;  2O89 A;  4O5R A;  5B6M A;  3IHQ A;  2FA4 A;  1AC1 A;  5ABR A;  1O7U A;  2EIR A;  3LXT A;  1S3C A;  2B5X A;  2EFH A;  2GTU A;  2X99 A;  4EDZ A;  3FZA A;  2JU5 A;  1G7E A;  4EO3 A;  3C71 A;  3FYG A;  4JED A;  2YWI A;  6GSY A;  1SVO A;  3GUR A;  4G19 A;  1ERT A;  2YJ7 A;  4TXV A;  2V6O A;  2LST A;  2WVZ A;  3HMJ G;  2DKI A;  1AQX A;  3KCM A;  1WPI A;  2HXK A;  4FYC A;  5D9T A;  2HT9 A;  2HNL A;  4MH3 A;  2K8V A;  4QL9 A;  3HKR A;  5J47 A;  1AIU A;  2HRK B;  3TJF A;  2ON5 A;  3CQF A;  3HVX A;  2VL2 A;  1THX A;  3CTF A;  5HQP A;  3L78 A;  2A2P A;  2OAD A;  1YKC A;  4AKX B;  5AIX A;  2YP6 A;  2LJK A;  1DE1 A;  1MTC A;  5KN3 A;  5CAX A;  4IVF A;  1A24 A;  4MZB A;  5GAN D;  1A0R P;  2HRK A;  1G7O A;  2YWO A;  1TDI A;  3DRN A;  4XIH A;  4HU9 A;  5F8B A;  2OA7 A;  1EP8 A;  3HHV A;  2R0P A;  3O76 A;  3QOU A;  1PX6 A;  5KN2 A;  2EFE A;  4Q5F A;  4RI7 A;  4JBB A;  2IFQ B;  1XFL A;  4POM A;  4JU5 A;  1OE7 A;  4KCE A;  2WVX B;  3IRA A;  2CX3 A;  2H0I A;  1HNC A;  4K7N A;  4PQ1 A;  2JZT A;  2GQL A;  1TKD B;  2B6M A;  2L4C A;  3KD0 A;  2HE3 A;  3HYP A;  3L0H A;  3L9S A;  1BF5 A;  4CY8 A;  4DEJ A;  1M99 A;  3HXS A;  1FOH A;  3QR6 A;  1SK0 A;  2IFQ A;  2VAF A;  1SJ6 A;  2A4V A;  2A4H A;  3WT1 A;  4IS0 A;  2WVX A;  1XWG A;  2I4A A;  1WIK A;  3TCO A;  1FO5 A;  3HVS A;  2PVQ A;  4XTS A;  4ML1 A;  3SWL A;  1O85 A;  5IPG A;  1TXU A;  3E9J B;  3UAR A;  4JRR A;  3F4S A;  3WD6 A;  3MAK A;  2GZP A;  4HS1 A;  4YKG A;  4WF5 A;  3FK8 A;  1LJR A;  4DVC A;  2V2G A;  3KH7 A;  4KGI A;  4NPB A;  4AKG A;  3WT2 A;  2WW0 A;  2YV9 A;  3H93 A;  4K5S A;  1YKA A;  4MA9 A;  4L5O A;  2O85 A;  1M2D A;  3PPU A;  1X9S B;  1O8W A;  1SEN A;  3FR9 A;  5G5E A;  3GX8 A;  2QC7 A;  5IMC A;  2KP2 A;  5IMF A;  2H72 A;  1YF1 A;  2LRC A;  1N2A A;  4K7O A;  1XPV A;  2QKE A;  4V2N A;  5GZZ B;  5IMD A;  1GRX A;  2C3N A;  4IJI A;  4IP6 A;  4EVM A;  3CRU A;  2O36 A;  3LYP A;  3MNG A;  2WFC A;  2PN8 A;  1EWX A;  3UOM A;  3EUR A;  2C1Y A;  3EIN A;  5IPH A;  3PGT A;  4LL4 B;  5ECR B;  4YAP A;  1QUW A;  3QCP A;  3HZ8 A;  3MIX A;  1FG4 A;  2OBI A;  3GIX A;  2BTO T;  3TDG A;  3M8N A;  2VL3 A;  2LKU A;  5LD0 A;  3W8J A;  2JSY A;  4MDC A;  1NM3 A;  1FAA A;  1PMT A;  3U5R E;  20GS A;  2QGV A;  2YWN A;  4MF5 A;  1K3O A;  5CRW A;  1S3A A;  2IN3 A;  2IMK A;  2H71 A;  3MYD A;  3GYK A;  3DML A;  2ZUP A;  5G1K A;  3DYR A;  5IQY A;  5A5K A;  3LW9 A;  3FKF A;  1U88 A;  4ID0 A;  2E2M A;  2IPA A;  5CO3 A;  1GSD A;  4GSS A;  4PUA A;  5BMU B;  4OO5 A;  2B5Y A;  4E8H A;  2LQO A;  5ELA A;  1XOA A;  1X9M B;  5ECP B;  3ZML A;  12GS A;  4GWR A;  2C8U A;  1FB0 A;  4GQC A;  1M3I A;  2YJH A;  4FQU A;  5FWG A;  1YF0 A;  2OBK A;  4POB A;  1EP7 A;  2C4J A;  3VI7 A;  5BMU A;  3CTG A;  4GRF A;  2CVK A;  4HZ4 A;  1OC3 A;  1K0D A;  1TI3 A;  4WF4 A;  2EIQ A;  1V58 A;  2IIY A;  3ZRE A;  2H74 A;  5J4Y A;  3F4R A;  6GSV A;  5FHI A;  4MMM A;  1CQG A;  3FMW A;  5ECQ B;  1ON4 A;  4MF6 A;  2WRT A;  2K18 A;  2WCI A;  3CYN A;  1NHY A;  3ZL5 A;  1V40 A;  3HA9 A;  4RQX A;  3AY8 A;  4NV2 A;  2YN1 A;  4KUN A;  3H4K A;  3C7M A;  2VCW A;  2LNS A;  3DVX A;  3WGX A;  2H6Y A;  1X5C A;  2REM A;  4JR6 A;  2UV8 G;  2VCQ A;  3DD3 A;  2GLR A;  3LYK A;  2VL2 C;  1N25 A;  5ECH B;  4ILF A;  4DSS B;  4LMW A;  2TRX A;  5DAK B;  1BQ7 A;  2WW1 A;  5ENU A;  2FGX A;  1JFU A;  1ZL9 A;  2KUC A;  4GST A;  1U87 A;  1PN0 A;  5DQY A;  2HSH A;  1GNW A;  2AYT A;  1T4Y A;  1Y25 A;  6GSS A;  3I43 A;  3L9V A;  1A23 A;  4IW9 A;  4DSS A;  4BA7 A;  1U3A A;  2F3M A;  5DAK A;  1F6M C;  3BCK A;  5JWR B;  3D4M A;  2CVB A;  1J08 A;  2L5L A;  3F4T A;  2OE0 A;  1LBK A;  2HZE B;  2WUL A;  4ULX A;  1SYR A;  1SK2 A;  1R5A A;  5DCG A;  4KND A;  3UBK A;  1WWJ A;  1Q98 A;  2KP1 A;  1XBS A;  2H01 A;  4Q5N A;  1HYU A;  2E2G A;  2FWH A;  1SL2 B;  2X8G A;  5JWQ B;  4WBR D;  1TK0 B;  5IMV A;  4J57 E;  1PN9 A;  1X5D A;  3IE3 A;  2HZE A;  4Z7X A;  2H1G A;  18GS A;  4KH7 A;  3TOT A;  3ME8 A;  3KMO A;  2LNT A;  5FT3 A;  4IN0 A;  2GSQ A;  1K0O A;  1U6T A;  2HQT A;  1Z6M A;  1S3R A;  5ELG A;  4NHZ A;  4HUA A;  4YQM A;  1XWA A;  1SYX A;  4MJB A;  4ZB9 A;  4BVY A;  2MMA A;  1MEK A;  4OFN A;  3D21 A;  2PU9 C;  3U6V A;  1O73 A;  3VWV A;  2GSR A;  1WRY A;  4EL1 A;  1USB A;  1J9B A;  5C04 A;  1V57 A;  3GA4 A;  3GL3 A;  4X0X A;  1AXD A;  4HI7 A;  4EDY A;  3NIV A;  1R26 A;  2L4Q A;  1S3D A;  1U3I A;  2GQK A;  1RK4 A;  3ZIV A;  4YH2 A;  3TRQ A;  4O32 A;  2D2Z A;  4ECC A;  5LNK e;  2NTO A;  1VRS D;  4RI6 A;  3KZQ A;  2EFD A;  2WS2 A;  2G2Q A;  5F05 A;  2R37 A;  2H70 A;  4TRX A;  1QMV A;  2GZY A;  5C00 A;  2RUF A;  3TKS A;  3ZZX A;  5D9V A;  2DMM A;  2VD1 A;  1SJZ A;  4N30 A;  1EZK A;  1K0A A;  2IL3 A;  1EOH A;  3IC8 A;  2R3X A;  1XVW A;  3Q19 A;  3FZ5 A;  1PKW A;  5G5F A;  3VI5 A;  2DJK A;  1YVL A;  1GLQ A;  4BVX B;  1Z7P A;  3E3E A;  4MP4 A;  2IMI A;  2BJX A;  1X9W B;  4MNN A;  3EMX A;  1V9W A;  4ZIJ A;  1O8X A;  5COH A;  3NZN A;  2AJQ B;  1M9B A;  1YY7 A;  4OO4 A;  4G2E A;  1GNE A;  1B4Q A;  4GLT A;  3W6G A;  5B8A A;  3TRX A;  4F82 A;  1SKS B;  3ZMK A;  1Z3E A;  3TB2 A;  4BIK A;  5HFG A;  1RQM A;  4IHU A;  4CDO A;  1X5E A;  4AGS A;  1HNA A;  3HVN A;  1XWK A;  4KSM A;  1EGR A;  1K3L A;  3UAP A;  1B9Y C;  4EIP A;  1T00 A;  4V1A p;  4ZIL A;  3ZFB A;  3GHA A;  5DBQ A;  1TTZ A;  2V41 A;  3FR3 A;  4F0B A;  4MZW A;  3QFB C;  4DSQ A;  4PQI A;  1AAZ A;  3QAW A;  1TXX A;  4GXZ A;  2LS5 A;  5AIV A;  1JLV A;  2JZS A;  3IOS A;  2GST A;  2H1D A;  3ERG A;  4XRA A;  5ECI B;  2ALB A;  3CRT A;  2O8V B;  1J0F A;  4AKH A;  4Z2T A;  2P0G A;  1ZYN A;  2GQM A;  4YQV A;  5A4U A;  1IYH A;  4GF0 A;  3UL3 A;  6GSX A;  4PXO A;  1PA3 A;  8GSS A;  2XBQ A;  3GKN A;  5B7C A;  2LUS A;  1MDI A;  3EYT A;  4LA1 A;  4MJA A;  3LWA A;  2DBC A;  2ES7 A;  1BYE A;  4IQ1 A;  3ERF A;  2TRC P;  4LL1 B;  2VLT A;  3KXO A;  2DJ2 A;  2MBS A;  5J40 A;  4V1A g;  2CV4 A;  4KCA A;  4QMK A;  4K0N A;  3HD5 A;  2B1K A;  4XCS A;  4MAB A;  1HD2 A;  1X0R A;  14GS A;  1E2Y A;  3H1N A;  1K0M A;  3Q18 A;  1F3B A;  4PI0 C;  4WKW A;  2RM5 A;  3CSH A;  3GST A;  4J56 E;  1M2B A;  1HQO A;  2X8C A;  4HZ2 A;  2P5Q A;  4I8B A;  1ZYE A;  2CAI A;  4KDU A;  3GV1 A;  1XZO A;  2FCH A;  5KOW A;  3RHC A;  4JZQ A;  3D0Z A;  2C0F A;  4O5U A;  2IJY A;  6GSU A;  4L0U A;  2PGT A;  2PUK C;  2NDO A;  1YZX A;  2UZ8 A;  2VM1 A;  1S4B P;  1QFN A;  4MJE A;  3HY2 A;  2V6K A;  1XOB A;  3UEM A;  1TRS A;  4OFM A;  3KP8 A;  1BAY A;  5GAP D;  3V1W A;  4N0Z A;  1THO A;  2DIZ A;  2H6Z A;  4N0V A;  1QQ2 A;  1TOF A;  1TRW A;  4K2X A;  1GTU A;  1SL0 B;  3DKS A;  4TXO B;  3TKR A;  2OE3 A;  2Z9S A;  5HR3 A;  3TRP A;  4OCE A;  2C0E A;  3BCI A;  5DJL A;  1N8J A;  4ZBB A;  3UVH A;  5CP1 A;  3QD9 A;  3GH6 A;  3RBT A;  2A2R A;  5IO2 A;  4K6X A;  4WXT A;  2XHF A;  2GSS A;  2YV7 A;  2CZ2 A;  3BD2 A;  4TXO A;  1XXU A;  5IO0 A;  4ZL7 A;  4IGJ A;  2L6D A;  3RDW A;  3US3 A;  2TIR A;  3VUR A;  4WET A;  2WZ9 A;  2L5O A;  2YAN A;  1SK1 A;  2E0Q A;  2FLS A;  2V1M A;  3LFL A;  1BG1 A;  1FVK A;  4FYB A;  4MH2 A;  2MMN A;  5AGY A;  1PKZ A;  1MD3 A;  2FWG A;  4F0C A;  3ZVJ D;  2GS3 A;  3IAS 2;  2R2J A;  1FW1 A;  3APQ A;  3ZIJ A;  1ZYQ B;  2DLX A;  3ZTL A;  4EE0 A;  4NWY A;  1HNB A;  1SJI A;  3FR6 A;  2PBJ A;  1JHB A;  1ERU A;  3GKK A;  4ZBD A;  3J7Y k;  3EE2 A;  3L9U A;  4X1U A;  3QFA C;  1FB6 A;  4KDY A;  2VCZ A;  1TK8 B;  1M9A A;  3UVT A;  3BBY A;  2MYG A;  3DEX A;  4CW9 A;  2GZZ A;  3TKP A;  2FD3 A;  3QDN A;  4E68 A;  2DSA A;  3HJP A;  2H0G A;  1G0T A;  5BRT A;  4FYU A;  2B7K A;  1TW9 A;  1XW9 A;  2X8H A;  1VF3 A;  2JSZ A;  3CBU A;  4OCF A;  2AAW A;  4HQZ A;  4NXI A;  2KLX A;  3KGK A;  3O3T A;  1B9X C;  1BX9 A;  1QXH A;  3IA1 A;  3TJJ A;  3KH9 A;  5DJM A;  2C0G A;  5CRD A;  2QSI A;  4MK3 A;  3A5W A;  4YKF A;  4ECJ A;  2HSN B;  3FY7 A;  4XS6 A;  2KOK A;  2H6X A;  2LRN A;  22GS A;  1LU4 A;  5IM9 A;  3LSZ A;  2B3S A;  1ACV A;  5ECM B;  3WGE A;  3ZFL A;  4ZL9 A;  4AKI A;  3P2A A;  9GSS A;  5CRG A;  2P5R A;  3DVW A;  3FHK A;  4PNF A;  3EWL A;  5EY6 A;  1GSU A;  2WW3 A;  1DUG A;  2HSN A;  2YPM A;  5GSS A;  2XPD A;  2YNX A;  3EMP A;  1QGV A;  4Z2U A;  4BWS A;  3FZ4 A;  5J41 A;  4AJ8 A;  2H73 A;  3VFI A;  4HU7 A;  4USS A;  4OD7 A;  1GL8 A;  1BG5 A;  3IAM 2;  4GDF A;  1JZO A;  1YEW C;  4KE3 A;  4G0L A;  4HDE A;  4V2L A;  3TKQ A;  3M0F A;  1R7H A;  1ST9 A;  3WGD A;  1ABA A;  2E7P A;  2F9S A;  5JCG A;  3GL5 A;  4PX1 A;  5G31 A;  3I6A A;  2L59 A;  3IHG A;  4Q5R A;  5A5H B;  2VLV A;  1V2A A;  3VPQ A;  3ED3 A;  2YZU A;  1GSE A;  2WGR A;  3VWU A;  1GP1 A;  5EVO A;  2X64 A;  3VPT A;  4BL7 B;  4LMV A;  4N3Z A;  3G9B A;  2HI7 A;  2V32 A;  2K8S A;  5D9X A;  3RPN A;  1Z9H A;  1V98 A;  3KTB A;  4GCI A;  4EF0 A;  3C1R A;  5KOX A;  4MZC A;  1TI1 A;  5A5H A;  3HCZ A;  3F6F A;  4ML6 A;  1PRX A;  3GN3 A;  1H4O A;  3WYW A;  1PSQ A;  4BL7 A;  2VCX A;  2OE1 A;  2H75 A;  5J9B A;  1PFO A;  3ZIT A;  4EKZ A;  1GUH A;  4G0K A;  2GVP A;  1SKW B;  2FUG 2;  1JZR A;  1T4Z A;  1PX7 A;  4N10 A;  3A3T A;  2KHP A;  4MLY A;  1AQW A;  1ZOF A;  4ZB7 A;  3SBC A;  1B48 A;  1B8X A;  5ID2 B;  2MZC A;  4MCU A;  5KN0 A;  3IDV A;  2J9H A;  4MJC A;  3F8U A;  2HSY A;  2LJA A;  1WOU A;  1M3J A;  5D96 A;  3F0I A;  3FEU A;  4DSR A;  4F03 A;  4IJ3 A;  3GKM A;  3KMN A;  2VUP A;  1Y1U A;  3TU3 B;  3J7Y b;  4PUF C;  3D6I A;  3P90 A;  5ID2 A;  3F63 A;  5G2Z A;  3IPZ A;  1C72 A;  3TGZ A;  2H76 A;  1I1I P;  1QK8 A;  2F8F A;  3R3E A;  3UJ1 A;  1VF2 A;  4TOP A;  3CXG A;  17GS A;  4K1F A;  1SVL A;  3HDC A;  4OFT A;  1GSS A;  2OJL A;  3TJK A;  1YEP A;  4G9H A;  1FVJ A;  3A2W A;  1MD4 A;  4PI2 C;  1GUM A;  2H1B A;  2M80 A;  4NMU A;  1A2M A;  2H1L A;  5D9W A;  7GSS A;  1M7T A;  1RW1 A;  3MWH A;  1F3A A;  1EV4 A;  1XVQ A;  4TW5 A;  1OKD A;  4AJ6 A;  2DJ3 A;  4MF7 A;  4X4J A;  5ECO B;  4I6X A;  5LCZ A;  3HZ4 A;  5G30 A;  2PWJ A;  1GSQ A;  3IR4 A;  5CYY A;  3D22 A;  1OYJ A;  1Q4J A;  3CSI A;  3C1S A;  5INY A;  3CSJ A;  4LLR A;  2I3Y A;  4GTU A;  2VL9 A;  4TR3 A;  4EIQ A;  1SVM A;  2DIY A;  2YZH A;  1T3B A;  4K9Z A;  4IKH A;  4PQH A;  4MPF A;  2DML A;  1GWC A;  1GSF A;  1TRV A;  2ZNM A;  4XRD A;  4K2D A;  2HRN A;  1JLW A;  2L6C A;  1K0N A;  2DKH A;  5HFI A;  4FO5 A;  6GSW A;  5B6N A;  5GST A;  5EPF A;  2B1L A;  2DJJ A;  2WZS A;  3QPM A;  3IBH A;  4XHM A;  2ON7 A;  4BVX A;  2JZR A;  1Z5Y E;  2YCD A;  2I9H A;  2IMD A;  2AB6 A;  3FZ9 A;  1TRU A;  5HFK A;  2XBI A;  2VLU A;  4QL7 A;  1SD8 A;  3M3M A;  3I9V 2;  1JZD A;  2AUV A;  2C0D A;  4BPY A;  4WEY A;  2I81 A;  3VK9 A;  2WJU A;  3LG6 A;  4PNG A;  3F9U A;  4ISD A;  1H75 A;  3APS A;  3L4N A;  2WW2 A;  3N5O A;  4HJM A;  4TR0 A;  1I5G A;  5IMA A;  5ECL B;  3ISO A;  3IV4 A;  2C80 A;  1K0B A;  2MMZ A;  3N9J A;  4HOJ A;  2DJ0 A; 
#chains in the Genus database with same CATH homology
 4TN8 A;  2R6K A;  4I2U A;  4TR4 A;  2OT3 A;  1XW6 A;  4ZB6 A;  4L8E A;  1A8L A;  2R4V A;  5E59 A;  4IBP A;  4IEL A;  4E8E A;  2CAQ A;  4RQR A;  1M2A A;  1UA5 A;  2M46 A;  4K0G A;  2HYX A;  1A8Y A;  1SU9 A;  1VF4 A;  2G0F A;  3GH9 A;  2PVO C;  1KTE A;  1GSY A;  2LQQ A;  1K3Y A;  1GH2 A;  3ZLP A;  3W8S A;  3UBL A;  3ZVJ A;  1PD2 1;  3BOA A;  1YQ1 A;  4G0I A;  2FY6 A;  1T7P B;  2BMX A;  1F2E A;  19GS A;  4P3Y B;  3H79 A;  1TU8 A;  1SKR B;  2CZ3 A;  1M0U A;  1B4P A;  2H19 A;  1AW9 A;  2EC4 A;  1WMJ A;  3H8Q A;  2RLI A;  2CX4 A;  5IOW A;  4J2F A;  4HEA 2;  3GX0 A;  2C3T A;  5ECS A;  2VKZ G;  4KX4 A;  2X49 A;  3KP9 A;  1G6Y A;  1ZYP A;  2WDU A;  4K7I A;  4HJ2 A;  2VO4 A;  4W66 A;  3TOU A;  4NHW A;  2JL4 A;  1GLP A;  3C73 A;  4K5R A;  2N5F A;  5J5N A;  2EFC A;  4Z2R A;  5A4V A;  3A5I A;  5IIZ A;  2VOC A;  5L71 A;  2YOI A;  1YEX A;  1SL1 B;  2WB9 A;  1E6B A;  2FWF A;  2PER A;  5D8I A;  5DCH A;  5G1L A;  4FIW A;  4Q5Q A;  2PPT A;  1JZW A;  3UIW A;  3UMA A;  2ZCT A;  1AUC A;  2XC2 A;  4IP1 A;  5DAL B;  3K8N A;  3VWW A;  4F2I A;  4PTS A;  2IMF A;  2CVD A;  3M9K A;  1W4V A;  10GS A;  3I69 A;  2IME A;  2LEG A;  5F06 A;  3DXB A;  3BJ5 A;  2IWT A;  1URM A;  1UN2 A;  4ZB8 A;  1O81 A;  1PL1 A;  11GS A;  2VM2 A;  4I5Q A;  3RAZ A;  1VGL A;  3TKS E;  5DAL A;  3HVV A;  1NHO A;  4KA0 A;  2L57 A;  3DGQ A;  4KDX A;  3LGC A;  2FNO A;  3P7X A;  2AHE A;  3APO A;  1CQH A;  1EEM A;  3ERW A;  1GUL A;  3GSS A;  1XWB A;  2GT5 A;  4WBJ A;  1YJ6 A;  1DE2 A;  2VCV A;  5ECK B;  5JCW A;  5D93 A;  5IOX A;  1XW5 A;  16GS A;  3LEF A;  4AF2 A;  3M9J A;  4EUY A;  4AJ7 A;  3D5J A;  2RM6 A;  4HQS A;  3G7Y A;  1WJK A;  4NAX A;  1ZZY A;  3OR5 A;  3HJM A;  4POK A;  2H8L A;  3RHB A;  2DC5 A;  2VD0 A;  5DDL A;  3S9F A;  1XIY A;  2VIM A;  2HLS A;  1R5P A;  2C3Q A;  2HSM B;  1R4W A;  1EOG A;  2CA8 A;  3VLN A;  1DSB A;  1ERW A;  3TKS C;  1PQN A;  1GTI A;  4KB3 A;  1OVN A;  2HZF A;  3GRX A;  3MSZ A;  1AQV A;  3IK7 A;  4OWY A;  3LQ7 A;  2I1U A;  4IQA A;  1ZGN A;  3PH9 A;  4I97 A;  4XS1 A;  4ZBA A;  3F3R A;  3G7I A;  5HR0 A;  1W89 A;  5EL8 A;  2HSM A;  4WR4 A;  4MPG A;  3EU3 A;  3GUS A;  3JCM L;  5J4V A;  3ZYW A;  3HJO A;  2GT6 A;  5D73 A;  1XWC A;  1NSW A;  3QAG A;  4A5P A;  3D4T A;  2RII A;  5KEJ A;  4GSN A;  2QA1 A;  5CNW A;  1NW2 A;  1A2J A;  2OAC A;  1EGO A;  5H5S A;  5J4U A;  1ZMA A;  4KSO A;  1GTA A;  3TJB A;  4ACS A;  1TU7 A;  3GTU B;  5H5R A;  4PGT A;  2P31 A;  2X4A A;  3O6T A;  4XS4 B;  1A0F A;  1PGT A;  5JCU A;  3LOR A;  2GGT A;  1OKT A;  3MDK A;  2VCT A;  2PMT A;  3EPT A;  3FW2 A;  2B5E A;  1I9D A;  5ECN B;  4L0W A;  1OC9 B;  2B7J A;  3GMF A;  3GTU A;  4KAE A;  1SD9 A;  1YDK A;  4CHS A;  5J3R A;  1UVZ A;  3E0U A;  4XS4 A;  1T1V A;  1BJX A;  2HRA A;  2J23 A;  3DIE A;  1ERV A;  4POL A;  1MDK A;  4BWQ A;  1Y6E A;  4O7H A;  1MDJ A;  2HRF A;  2H0H A;  1ML6 A;  3CMI A;  3KM6 A;  1KNG A;  2LTK A;  4G01 A;  3EC3 A;  2MMO A;  1G6W A;  1OC9 A;  4PUR A;  5DQS A;  1XCC A;  4CY6 A;  2FHE A;  3KEB A;  3GFK A;  2RUE A;  2EIO A;  2MBT A;  2H30 A;  2NVL A;  1EEJ A;  1Z6N A;  2CQ9 A;  3CWG A;  2NBS A;  4QQ7 A;  2F51 A;  3LXZ A;  3Q6O A;  4GQF A;  1IYI A;  5HR1 A;  4NV5 A;  2H1A A;  3A2V A;  2FWE A;  3IK9 A;  1Z7R A;  3IXR A;  3PIN A;  2R5G A;  3QMX A;  4F9Z A;  1PL2 A;  5A1N B;  1F37 A;  4AI6 A;  5DVB A;  4V2M A;  1FOV A;  4ZL8 A;  2H66 A;  1EV9 A;  3A2X A;  4JE1 A;  4FH8 A;  3TUE A;  4TR1 B;  5E4W A;  4X43 A;  4N11 A;  1O6J A;  1TJD A;  1ZCP A;  2JAC A;  2K6V A;  2O7K A;  2N5B A;  3LJR A;  4RUV A;  2YWM A;  3KJY A;  3PR8 A;  2LRT A;  1TP9 A;  3IC4 A;  5A1N A;  4H86 A;  3EVI A;  5A34 B;  1BED A;  3FRC A;  5A4W A;  2O87 A;  5F07 A;  5CRE A;  5H5Q A;  4TR1 A;  1TK5 B;  2GDR A;  2DJ1 A;  5JWO B;  13GS A;  1FHE A;  3Q74 A;  4BVY B;  2HFD A;  2O5V A;  4OMV A;  1OAZ A;  2K9F A;  2LV3 A;  2AV4 A;  3EU4 A;  1A2L A;  1WE0 A;  3G7J A;  5A34 A;  2XPE A;  4WR5 A;  5F0G A;  4G10 A;  5AN1 A;  1OC8 A;  2A2S A;  2JAD A;  1ILO A;  2NPB A;  3VWX A;  1K0C A;  5HR2 A;  2R0C A;  4EXJ A;  2CT6 A;  3F6D A;  4D73 B;  2LJR A;  4ECI A;  4TVE A;  2R0G A;  5CRH A;  4I2T A;  4YQU A;  4ICY A;  1GUK A;  1KEB A;  6GST A;  5AIS A;  2QA2 A;  3DWV A;  4O5Q A;  1F9M A;  3NOF A;  1KBN A;  3ME7 A;  5J9C A;  4D73 A;  3GKX A;  5B8B A;  2M72 A;  1OE8 A;  4YAV A;  3R2Q A;  1VF1 A;  4L5L A;  4K8M A;  2N5A A;  4JR4 A;  2F8A A;  3M1G A;  4ZXG A;  2FA8 A;  3RPP A;  4O92 A;  3GNJ A;  5IMZ A;  4KF9 A;  3KTL A;  1DBY A;  4KW6 A;  3QAV A;  3TJG A;  3P8W A;  3F3Q A;  1UC7 A;  1WP0 A;  3KIJ A;  4TKY A;  5KN1 A;  3ZRD A;  3C8E A;  4EC0 A;  4ECB A;  2OKA A;  1T8E B;  1GTB A;  2O89 A;  4O5R A;  5B6M A;  3IHQ A;  2FA4 A;  1AC1 A;  5ABR A;  1O7U A;  2EIR A;  3LXT A;  1S3C A;  2B5X A;  2EFH A;  2GTU A;  2X99 A;  4EDZ A;  3FZA A;  2JU5 A;  1G7E A;  4EO3 A;  3C71 A;  3FYG A;  4JED A;  2YWI A;  6GSY A;  1SVO A;  3GUR A;  4G19 A;  1ERT A;  2YJ7 A;  4TXV A;  2V6O A;  2LST A;  3HMJ G;  2DKI A;  1AQX A;  3KCM A;  1WPI A;  2HXK A;  4FYC A;  5D9T A;  2HT9 A;  2HNL A;  4MH3 A;  2K8V A;  4QL9 A;  3HKR A;  5J47 A;  1AIU A;  2HRK B;  3TJF A;  2ON5 A;  3HVX A;  2VL2 A;  1THX A;  3CTF A;  5HQP A;  3L78 A;  2A2P A;  2OAD A;  1YKC A;  4AKX B;  5AIX A;  2YP6 A;  2LJK A;  1DE1 A;  1MTC A;  5KN3 A;  5CAX A;  4IVF A;  1A24 A;  4MZB A;  5GAN D;  1A0R P;  2HRK A;  1G7O A;  2YWO A;  1TDI A;  3DRN A;  4XIH A;  4HU9 A;  5F8B A;  2OA7 A;  1EP8 A;  3HHV A;  2R0P A;  3O76 A;  3QOU A;  1PX6 A;  5KN2 A;  2EFE A;  4Q5F A;  4RI7 A;  4JBB A;  2IFQ B;  1XFL A;  4POM A;  4JU5 A;  1OE7 A;  4KCE A;  3IRA A;  2CX3 A;  2H0I A;  1HNC A;  4K7N A;  4PQ1 A;  2JZT A;  2GQL A;  1TKD B;  2B6M A;  2L4C A;  3KD0 A;  2HE3 A;  3HYP A;  3L0H A;  3L9S A;  1BF5 A;  4CY8 A;  4DEJ A;  1M99 A;  3HXS A;  1FOH A;  3QR6 A;  1SK0 A;  2IFQ A;  2VAF A;  1SJ6 A;  2A4V A;  2A4H A;  3WT1 A;  4IS0 A;  1XWG A;  2I4A A;  1WIK A;  3TCO A;  1FO5 A;  3HVS A;  2PVQ A;  4XTS A;  4ML1 A;  3SWL A;  1O85 A;  5IPG A;  1TXU A;  3E9J B;  3UAR A;  4JRR A;  3F4S A;  3WD6 A;  3MAK A;  2GZP A;  4HS1 A;  4YKG A;  4WF5 A;  3FK8 A;  1LJR A;  4DVC A;  2V2G A;  3KH7 A;  4KGI A;  4NPB A;  4AKG A;  3WT2 A;  2YV9 A;  3H93 A;  4K5S A;  1YKA A;  4MA9 A;  4L5O A;  2O85 A;  1M2D A;  3PPU A;  1X9S B;  1O8W A;  1SEN A;  3FR9 A;  5G5E A;  3GX8 A;  2QC7 A;  5IMC A;  2KP2 A;  5IMF A;  2H72 A;  1YF1 A;  2LRC A;  1N2A A;  4K7O A;  1XPV A;  2QKE A;  4V2N A;  5GZZ B;  5IMD A;  1GRX A;  2C3N A;  4IJI A;  4IP6 A;  4EVM A;  3CRU A;  3LYP A;  3MNG A;  2WFC A;  2PN8 A;  1EWX A;  3UOM A;  3EUR A;  2C1Y A;  3EIN A;  5IPH A;  3PGT A;  4LL4 B;  5ECR B;  4YAP A;  1QUW A;  3QCP A;  3HZ8 A;  3MIX A;  1FG4 A;  2OBI A;  3GIX A;  2BTO T;  3TDG A;  3M8N A;  2VL3 A;  2LKU A;  5LD0 A;  3W8J A;  2JSY A;  4MDC A;  1NM3 A;  1FAA A;  1PMT A;  3U5R E;  20GS A;  2QGV A;  2YWN A;  4MF5 A;  1K3O A;  5CRW A;  1S3A A;  2IN3 A;  2IMK A;  2H71 A;  3MYD A;  3GYK A;  3DML A;  2ZUP A;  5G1K A;  3DYR A;  5IQY A;  5A5K A;  3LW9 A;  3FKF A;  1U88 A;  4ID0 A;  2E2M A;  2IPA A;  5CO3 A;  1GSD A;  4GSS A;  4PUA A;  5BMU B;  4OO5 A;  2B5Y A;  4E8H A;  2LQO A;  5ELA A;  1XOA A;  1X9M B;  5ECP B;  3ZML A;  12GS A;  4GWR A;  2C8U A;  1FB0 A;  4GQC A;  2YJH A;  4FQU A;  5FWG A;  1YF0 A;  2OBK A;  4POB A;  1EP7 A;  2C4J A;  3VI7 A;  5BMU A;  3CTG A;  4GRF A;  2CVK A;  4HZ4 A;  1OC3 A;  1K0D A;  1TI3 A;  4WF4 A;  2EIQ A;  1V58 A;  2IIY A;  3ZRE A;  2H74 A;  5J4Y A;  3F4R A;  6GSV A;  5FHI A;  4MMM A;  1CQG A;  3FMW A;  5ECQ B;  1ON4 A;  4MF6 A;  2WRT A;  2K18 A;  2WCI A;  3CYN A;  1NHY A;  3ZL5 A;  1V40 A;  3HA9 A;  4RQX A;  3AY8 A;  4NV2 A;  2YN1 A;  4KUN A;  3H4K A;  3C7M A;  2VCW A;  2LNS A;  3DVX A;  3WGX A;  2H6Y A;  1X5C A;  2REM A;  4JR6 A;  2UV8 G;  2VCQ A;  3DD3 A;  2GLR A;  3LYK A;  2VL2 C;  1N25 A;  5ECH B;  4ILF A;  4DSS B;  4LMW A;  2TRX A;  5DAK B;  1BQ7 A;  5ENU A;  2FGX A;  1JFU A;  1ZL9 A;  2KUC A;  4GST A;  1U87 A;  1PN0 A;  5DQY A;  2HSH A;  1GNW A;  2AYT A;  1T4Y A;  1Y25 A;  6GSS A;  3I43 A;  3L9V A;  1A23 A;  4IW9 A;  4DSS A;  4BA7 A;  1U3A A;  2F3M A;  5DAK A;  1F6M C;  3BCK A;  5JWR B;  3D4M A;  2CVB A;  1J08 A;  2L5L A;  3F4T A;  2OE0 A;  1LBK A;  2HZE B;  2WUL A;  4ULX A;  1SYR A;  1SK2 A;  1R5A A;  5DCG A;  4KND A;  3UBK A;  1WWJ A;  1Q98 A;  2KP1 A;  1XBS A;  2H01 A;  4Q5N A;  1HYU A;  2E2G A;  2FWH A;  1SL2 B;  2X8G A;  5JWQ B;  4WBR D;  1TK0 B;  5IMV A;  4J57 E;  1PN9 A;  1X5D A;  3IE3 A;  2HZE A;  4Z7X A;  2H1G A;  18GS A;  4KH7 A;  3TOT A;  3ME8 A;  3KMO A;  2LNT A;  5FT3 A;  4IN0 A;  2GSQ A;  1K0O A;  1U6T A;  2HQT A;  1Z6M A;  5ELG A;  4NHZ A;  4HUA A;  4YQM A;  1XWA A;  1SYX A;  4MJB A;  4ZB9 A;  4BVY A;  2MMA A;  1MEK A;  4OFN A;  3D21 A;  2PU9 C;  3U6V A;  1O73 A;  3VWV A;  2GSR A;  1WRY A;  4EL1 A;  1USB A;  1J9B A;  5C04 A;  1V57 A;  3GA4 A;  3GL3 A;  4X0X A;  1AXD A;  4HI7 A;  4EDY A;  3NIV A;  1R26 A;  2L4Q A;  1S3D A;  1U3I A;  2GQK A;  1RK4 A;  3ZIV A;  4YH2 A;  3TRQ A;  4O32 A;  2D2Z A;  4ECC A;  5LNK e;  2NTO A;  1VRS D;  4RI6 A;  3KZQ A;  2EFD A;  2WS2 A;  2G2Q A;  5F05 A;  2R37 A;  2H70 A;  4TRX A;  1QMV A;  2GZY A;  5C00 A;  2RUF A;  3TKS A;  3ZZX A;  5D9V A;  2DMM A;  2VD1 A;  1SJZ A;  4N30 A;  1EZK A;  1K0A A;  2IL3 A;  1EOH A;  3IC8 A;  2R3X A;  1XVW A;  3Q19 A;  3FZ5 A;  1PKW A;  5G5F A;  3VI5 A;  2DJK A;  1YVL A;  1GLQ A;  4BVX B;  1Z7P A;  3E3E A;  4MP4 A;  2IMI A;  2BJX A;  1X9W B;  4MNN A;  3EMX A;  1V9W A;  4ZIJ A;  1O8X A;  5COH A;  3NZN A;  2AJQ B;  1M9B A;  1YY7 A;  4OO4 A;  4G2E A;  1GNE A;  1B4Q A;  4GLT A;  3W6G A;  5B8A A;  3TRX A;  4F82 A;  1SKS B;  3ZMK A;  1Z3E A;  3TB2 A;  5HFG A;  1RQM A;  4IHU A;  4CDO A;  1X5E A;  4AGS A;  1HNA A;  1XWK A;  4KSM A;  1EGR A;  1K3L A;  3UAP A;  1B9Y C;  4EIP A;  1T00 A;  4V1A p;  4ZIL A;  3ZFB A;  3GHA A;  5DBQ A;  1TTZ A;  2V41 A;  3FR3 A;  4F0B A;  4MZW A;  3QFB C;  4DSQ A;  4PQI A;  1AAZ A;  3QAW A;  1TXX A;  4GXZ A;  2LS5 A;  5AIV A;  1JLV A;  2JZS A;  3IOS A;  2GST A;  2H1D A;  3ERG A;  4XRA A;  5ECI B;  2ALB A;  3CRT A;  2O8V B;  1J0F A;  4AKH A;  4Z2T A;  2P0G A;  1ZYN A;  2GQM A;  4YQV A;  5A4U A;  1IYH A;  4GF0 A;  3UL3 A;  6GSX A;  4PXO A;  1PA3 A;  8GSS A;  2XBQ A;  3GKN A;  5B7C A;  2LUS A;  1MDI A;  3EYT A;  4LA1 A;  4MJA A;  3LWA A;  2DBC A;  2ES7 A;  1BYE A;  4IQ1 A;  3ERF A;  2TRC P;  4LL1 B;  2VLT A;  3KXO A;  2DJ2 A;  2MBS A;  5J40 A;  4V1A g;  2CV4 A;  4KCA A;  4QMK A;  4K0N A;  3HD5 A;  2B1K A;  4XCS A;  4MAB A;  1HD2 A;  1X0R A;  14GS A;  1E2Y A;  3H1N A;  1K0M A;  3Q18 A;  1F3B A;  4WKW A;  2RM5 A;  3CSH A;  3GST A;  4J56 E;  1M2B A;  1HQO A;  2X8C A;  4HZ2 A;  2P5Q A;  4I8B A;  1ZYE A;  2CAI A;  4KDU A;  3GV1 A;  1XZO A;  2FCH A;  5KOW A;  3RHC A;  4JZQ A;  3D0Z A;  2C0F A;  4O5U A;  2IJY A;  6GSU A;  4L0U A;  2PGT A;  2PUK C;  2NDO A;  1YZX A;  2UZ8 A;  2VM1 A;  1QFN A;  4MJE A;  3HY2 A;  2V6K A;  1XOB A;  3UEM A;  1TRS A;  4OFM A;  3KP8 A;  1BAY A;  5GAP D;  3V1W A;  4N0Z A;  1THO A;  2DIZ A;  2H6Z A;  4N0V A;  1QQ2 A;  1TOF A;  1TRW A;  4K2X A;  1GTU A;  1SL0 B;  3DKS A;  4TXO B;  3TKR A;  2OE3 A;  2Z9S A;  5HR3 A;  3TRP A;  4OCE A;  2C0E A;  3BCI A;  5DJL A;  1N8J A;  4ZBB A;  3UVH A;  5CP1 A;  3QD9 A;  3GH6 A;  3RBT A;  2A2R A;  5IO2 A;  4K6X A;  4WXT A;  2XHF A;  2GSS A;  2YV7 A;  2CZ2 A;  3BD2 A;  4TXO A;  1XXU A;  5IO0 A;  4ZL7 A;  4IGJ A;  2L6D A;  3RDW A;  3US3 A;  2TIR A;  3VUR A;  4WET A;  2WZ9 A;  2L5O A;  2YAN A;  1SK1 A;  2E0Q A;  2FLS A;  2V1M A;  3LFL A;  1BG1 A;  1FVK A;  4FYB A;  4MH2 A;  2MMN A;  5AGY A;  1PKZ A;  1MD3 A;  2FWG A;  4F0C A;  3ZVJ D;  2GS3 A;  3IAS 2;  2R2J A;  1FW1 A;  3APQ A;  3ZIJ A;  1ZYQ B;  2DLX A;  3ZTL A;  4EE0 A;  4NWY A;  1HNB A;  1SJI A;  3FR6 A;  2PBJ A;  1JHB A;  1ERU A;  3GKK A;  4ZBD A;  3J7Y k;  3EE2 A;  3L9U A;  4X1U A;  3QFA C;  1FB6 A;  4KDY A;  2VCZ A;  1TK8 B;  1M9A A;  3UVT A;  3BBY A;  2MYG A;  3DEX A;  4CW9 A;  2GZZ A;  3TKP A;  2FD3 A;  3QDN A;  4E68 A;  2DSA A;  3HJP A;  2H0G A;  1G0T A;  5BRT A;  4FYU A;  2B7K A;  1TW9 A;  1XW9 A;  2X8H A;  1VF3 A;  2JSZ A;  3CBU A;  4OCF A;  2AAW A;  4HQZ A;  4NXI A;  2KLX A;  3KGK A;  3O3T A;  1B9X C;  1BX9 A;  1QXH A;  3IA1 A;  3TJJ A;  3KH9 A;  5DJM A;  2C0G A;  5CRD A;  2QSI A;  4MK3 A;  3A5W A;  4YKF A;  4ECJ A;  2HSN B;  3FY7 A;  4XS6 A;  2KOK A;  2H6X A;  2LRN A;  22GS A;  1LU4 A;  5IM9 A;  3LSZ A;  2B3S A;  1ACV A;  5ECM B;  3WGE A;  3ZFL A;  4ZL9 A;  4AKI A;  3P2A A;  9GSS A;  5CRG A;  2P5R A;  3DVW A;  3FHK A;  4PNF A;  3EWL A;  5EY6 A;  1GSU A;  1DUG A;  2HSN A;  2YPM A;  5GSS A;  2XPD A;  2YNX A;  3EMP A;  1QGV A;  4Z2U A;  4BWS A;  3FZ4 A;  5J41 A;  4AJ8 A;  2H73 A;  3VFI A;  4HU7 A;  4USS A;  4OD7 A;  1GL8 A;  1BG5 A;  3IAM 2;  4GDF A;  1JZO A;  4KE3 A;  4G0L A;  4HDE A;  4V2L A;  3TKQ A;  3M0F A;  1R7H A;  1ST9 A;  3WGD A;  1ABA A;  2E7P A;  2F9S A;  5JCG A;  3GL5 A;  4PX1 A;  5G31 A;  3I6A A;  2L59 A;  3IHG A;  4Q5R A;  5A5H B;  2VLV A;  1V2A A;  3VPQ A;  3ED3 A;  2YZU A;  1GSE A;  2WGR A;  3VWU A;  1GP1 A;  5EVO A;  2X64 A;  3VPT A;  4BL7 B;  4LMV A;  4N3Z A;  3G9B A;  2HI7 A;  2V32 A;  2K8S A;  5D9X A;  3RPN A;  1Z9H A;  1V98 A;  3KTB A;  4GCI A;  4EF0 A;  3C1R A;  5KOX A;  4MZC A;  1TI1 A;  5A5H A;  3HCZ A;  3F6F A;  4ML6 A;  1PRX A;  3GN3 A;  1H4O A;  3WYW A;  1PSQ A;  4BL7 A;  2VCX A;  2OE1 A;  2H75 A;  5J9B A;  3ZIT A;  4EKZ A;  1GUH A;  4G0K A;  2GVP A;  1SKW B;  2FUG 2;  1JZR A;  1T4Z A;  1PX7 A;  4N10 A;  3A3T A;  2KHP A;  4MLY A;  1AQW A;  1ZOF A;  4ZB7 A;  3SBC A;  1B48 A;  1B8X A;  5ID2 B;  2MZC A;  4MCU A;  5KN0 A;  3IDV A;  2J9H A;  4MJC A;  3F8U A;  2HSY A;  2LJA A;  1WOU A;  5D96 A;  3F0I A;  3FEU A;  4DSR A;  4F03 A;  4IJ3 A;  3GKM A;  3KMN A;  2VUP A;  1Y1U A;  3TU3 B;  3J7Y b;  4PUF C;  3D6I A;  3P90 A;  5ID2 A;  3F63 A;  5G2Z A;  3IPZ A;  1C72 A;  3TGZ A;  2H76 A;  1QK8 A;  2F8F A;  3R3E A;  3UJ1 A;  1VF2 A;  4TOP A;  3CXG A;  17GS A;  4K1F A;  1SVL A;  3HDC A;  4OFT A;  1GSS A;  2OJL A;  3TJK A;  1YEP A;  4G9H A;  1FVJ A;  3A2W A;  1MD4 A;  1GUM A;  2H1B A;  2M80 A;  4NMU A;  1A2M A;  2H1L A;  5D9W A;  7GSS A;  1M7T A;  1RW1 A;  3MWH A;  1F3A A;  1EV4 A;  1XVQ A;  4TW5 A;  1OKD A;  4AJ6 A;  2DJ3 A;  4MF7 A;  4X4J A;  5ECO B;  4I6X A;  5LCZ A;  3HZ4 A;  5G30 A;  2PWJ A;  1GSQ A;  3IR4 A;  5CYY A;  3D22 A;  1OYJ A;  1Q4J A;  3CSI A;  3C1S A;  5INY A;  3CSJ A;  4LLR A;  2I3Y A;  4GTU A;  2VL9 A;  4TR3 A;  4EIQ A;  1SVM A;  2DIY A;  2YZH A;  1T3B A;  4K9Z A;  4IKH A;  4PQH A;  4MPF A;  2DML A;  1GWC A;  1GSF A;  1TRV A;  2ZNM A;  4XRD A;  4K2D A;  2HRN A;  1JLW A;  2L6C A;  1K0N A;  2DKH A;  5HFI A;  4FO5 A;  6GSW A;  5B6N A;  5GST A;  5EPF A;  2B1L A;  2DJJ A;  3QPM A;  3IBH A;  4XHM A;  2ON7 A;  4BVX A;  2JZR A;  1Z5Y E;  2YCD A;  2I9H A;  2IMD A;  2AB6 A;  3FZ9 A;  1TRU A;  5HFK A;  2XBI A;  2VLU A;  4QL7 A;  1SD8 A;  3M3M A;  3I9V 2;  1JZD A;  2AUV A;  2C0D A;  4BPY A;  4WEY A;  2I81 A;  3VK9 A;  2WJU A;  3LG6 A;  4PNG A;  3F9U A;  4ISD A;  1H75 A;  3APS A;  3L4N A;  3N5O A;  4HJM A;  4TR0 A;  1I5G A;  5IMA A;  5ECL B;  3ISO A;  3IV4 A;  2C80 A;  1K0B A;  2MMZ A;  3N9J A;  4HOJ A;  2DJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...