5ELGA

The structure of dhar1 from arabidopsis thaliana
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
ALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSEHALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHVHNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase DHAR1, mitochondrial
publication title Arabidopsis thaliana DHAR1 apo structure
rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 1.8.5.1: Glutathione dehydrogenase (ascorbate).
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5elgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5elgA01
1Z6NA 4PUFC 2B5EA 1HD2A 1ZYEA 5J3RA 3UVTA 1ZZYA 4BVYA 1SYXA 5KN1A 1AC1A 4F82A 2KOKA 3L78A 5EPFA 2H75A 4O92A 3R2QA 1X5EA 3BCKA 1JFUA 4OWYA 1K0DA 1CQGA 4J57E 1ZL9A 2LTKA 4HU9A 2CT6A 3CMIA 2CZ2A 1YEPA 4F0CA 2X8HA 1V98A 1R4WA 4GXZA 16GSA 1AXDA 2X8CA 2LRTA 1USBA 3CTFA 4JBBA 4ISDA 4X1UA 2WS2A 3HY2A 3HVSA 4MH2A 3PINA 4HJMA 3BD2A 3Q6OA 3GRXA 2QSIA 3Q74A 1SKSB 2A2SA 1XCCA 2H66A 1JHBA 3TKSC 4BWSA 4IVFA 5DCHA 4ZL7A 4MZWA 10GSA 4ZBBA 4TR1A 4ECIA 5CO3A 2FLSA 3RHBA 1XZOA 3CTGA 1J08A 2RLIA 3WT2A 3P2AA 4WETA 3A2WA 1AUCA 1R7HA 1EEJA 3QPMA 1BEDA 4EVMA 3VPQA 4L5OA 4TR4A 4BA7A 4PURA 4JZQA 3QAWA 1MEKA 3UIWA 5J5NA 1K0OA 3M0FA 4V2MA 1VRSD 2E7PA 2LJKA 4N0VA 2VL9A 4TW5A 1SL2B 2G0FA 5A5KA 1G7EA 2O87A 5IOXA 5BMUA 1S3AA 4RI7A 3A2VA 5J41A 3W6GA 2VCQA 1X9MB 4IP1A 2AV4A 2PUKC 1EV9A 5ECMB 2V6KA 3L9VA 3VFIA 2HNLA 2PVQA 1DE2A 4XS4A 2P5QA 5IPHA 2FA8A 4K7IA 5H5SA 1GL8A 1M7TA 5ECNB 2XBQA 1PD21 2PMTA 1TRSA 2YANA 3F3QA 6GSTA 4KCEA 1K0CA 5IQYA 1JZRA 3VPTA 3IE3A 3P8WA 5CNWA 4PQIA 4WR5A 4G0IA 4N10A 3ZMLA 1PKWA 3KTLA 3FR6A 2PN8A 1M2AA 1FVJA 3RAZA 3LFLA 2GVPA 4GQFA 1Z7PA 3ZVJA 4YAVA 1QMVA 2VAFA 1XWAA 2OE0A 2OACA 5IIZA 3GA4A 2KP2A 4K7OA 3IHQA 4BVXA 2V32A 1F2EA 3ZYWA 1EGOA 5F06A 1CQHA 2O85A 3IBHA 2IMIA 4KDXA 3M9JA 1V9WA 1SL0B 5CP1A 3UBLA 2X8GA 5FHIA 1OYJA 3GFKA 2FD3A 2IMEA 1O73A 4K7NA 1U87A 1SYRA 3HHVA 5ID2B 2L6DA 1XVQA 2VCZA 5DQSA 1EEMA 4EUYA 1AW9A 4EO3A 1G7OA 2JSYA 2VIMA 1R5AA 3LGCA 1H4OA 2H76A 2HLSA 3L0HA 1GTUA 2CX4A 3GUSA 4ZBDA 1GH2A 3ERFA 5HFKA 1AQWA 2NTOA 22GSA 3TJJA 4IJ3A 3TOUA 1QGVA 2HI7A 4MJBA 5IO2A 3G7JA 1SENA 1VF3A 4HQSA 3OR5A 3E9JB 2HXKA 1Z9HA 5DDLA 1XWGA 4LA1A 8GSSA 2A4VA 2E2GA 1X0RA 3C1RA 5IMZA 1GWCA 4O7HA 1TJDA 1YKAA 2VL2A 2J9HA 1HYUA 2L6CA 2IN3A 3IDVA 3FZ9A 1FO5A 3ZVJD 4AJ6A 4IELA 4KX4A 4ZB9A 5JCGA 3F4SA 4EXJA 2H73A 3CYNA 3EURA 2WDUA 1TI3A 1BQ7A 1XOBA 3HKRA 1EOHA 2ZNMA 1F9MA 1JZDA 1HNAA 3Q19A 1ACVA 1S3DA 1ZCPA 5EVOA 3FEUA 4GRFA 5KN3A 1BG5A 1PGTA 1XFLA 5HR3A 2OA7A 1OC9B 5G30A 4IN0A 1TRWA 5H5QA 5ENUA 1K3YA 2YWOA 2A2RA 4NHWA 1GLPA 1F3BA 6GSUA 4TR3A 4MH3A 4I8BA 1S3CA 3VLNA 3UEMA 3QAVA 3O6TA 1XIYA 2MMOA 2H01A 12GSA 2KP1A 3H4KA 2FY6A 1GNWA 2HFDA 5KEJA 4J2FA 1GTIA 3IAM2 2NBSA 3QDNA 1RQMA 1MDIA 3M3MA 1XVWA 1MD3A 4JE1A 3I43A 4MPGA 4ML6A 5INYA 1JLWA 3FZ4A 5JWOB 2OE1A 2H6XA 2HRKB 1UVZA 1A0RP 4K9ZA 3KP9A 2B1KA 1VGLA 2DJJA 2PGTA 1DSBA 2VUPA 4ACSA 2GZYA 1PL2A 3D22A 3AY8A 1FOVA 2RUEA 4XHMA 2YWNA 3LXTA 3JCML 2YZHA 1TW9A 2H70A 2B7JA 4PNFA 1GLQA 3TKSA 2R3XA 4USSA 1UN2A 4G9HA 1F3AA 3GKXA 3KH7A 5F07A 3TCOA 2HQTA 2KUCA 2AB6A 4MP4A 1XWKA 1ZGNA 2H19A 4X43A 1LU4A 3IOSA 2OKAA 4FYCA 2OBIA 1PKZA 3O3TA 2R5GA 4XRDA 3ZITA 2PBJA 2JACA 3PH9A 2PPTA 4KSOA 1JLVA 2JZSA 2VL3A 1O8WA 1TK5B 1OC8A 1EP8A 3F6DA 4V1Ag 1TOFA 4KAEA 5IMDA 4CHSA 3ZZXA 2FGXA 1R26A 2L5OA 1TDIA 3GKNA 3GIXA 2V41A 3KGKA 2TIRA 2XBIA 2I4AA 4HEA2 5AN1A 1HNCA 3QD9A 3FZAA 3GH9A 5ID2A 3F0IA 5ECHB 1AIUA 5IM9A 3VK9A 2LNTA 2YWIA 20GSA 2YJ7A 1XBSA 4DEJA 3FRCA 3LJRA 3KMNA 2HSNB 3IK7A 4NWYA 3GH6A 5EL8A 2C0GA 2B7KA 6GSSA 4FIWA 4RQXA 3TJBA 4ZXGA 1V2AA 3RPPA 4MF7A 3HVXA 4ZBAA 3QOUA 1XW5A 2VCWA 3KXOA 5A4VA 1A23A 1TXXA 4IGJA 4GLTA 2F3MA 2EC4A 4ZL9A 3TDGA 5G2ZA 1WJKA 2H71A 2P31A 3ED3A 4K8MA 1I9DA 2N5BA 1LJRA 4MZCA 1KNGA 2YNXA 2IMFA 1WMJA 3MSZA 2JSZA 5ECIB 3EWLA 1OKTA 2VCXA 2GTUA 2L5LA 3P90A 2CVDA 1GSUA 5ECKB 3H1NA 2BMXA 3LYPA 2ON7A 4OFMA 3HJMA 1IYIA 2HT9A 2LEGA 4EC0A 2H30A 3HJPA 4YQMA 2G2QA 2DJ0A 3GV1A 2QKEA 4F2IA 1T7PB 5H5RA 2WCIA 4V2NA 2C3NA 1GNEA 5B6MA 2PWJA 3HA9A 4KNDA 1B4PA 3F63A 1OC9A 5IMAA 1I5GA 1Y25A 1GSFA 3G9BA 1UA5A 3D21A 2L4QA 4OMVA 4K1FA 2QGVA 1GTBA 4HU7A 2ZUPA 4JR4A 4OD7A 5ECLB 1PL1A 4E8HA 1NW2A 1SJIA 4N11A 4MPFA 1KBNA 1WE0A 1EGRA 4POLA 2WJUA 5B7CA 3GX8A 1ERVA 3EMXA 3F8UA 1YEXA 5B8BA 5HQPA 3IR4A 5CYYA 1X9SB 1EOGA 1TK8B 3KMOA 2N5AA 2IFQA 2CA8A 4XS1A 2TRCP 13GSA 1DBYA 4K0NA 2HRKA 4XS6A 4RQRA 3CBUA 2ZCTA 4PX1A 1M2BA 2C3TA 2GT6A 4HJ2A 4WF4A 1GSSA 2C0FA 2RUFA 4XRAA 2VLUA 3S9FA 1F37A 4N30A 4MA9A 1XW9A 4PGTA 4OO5A 2L57A 5KN0A 2YJHA 4WXTA 4GSSA 4OFNA 3I69A 1LBKA 3UMAA 3IPZA 3DVXA 2B5XA 2Z9SA 1ML6A 1ST9A 3IV4A 5ECQB 2C1YA 4TR0A 1VF4A 1PRXA 3KCMA 2CV4A 1HQOA 4E8EA 5D8IA 1O8XA 1SKRB 4OCFA 2FWGA 4ZB8A 1H75A 2QC7A 1VF2A 4F0BA 3CSHA 2CX3A 4XTSA 3NIVA 6GSYA 1O81A 5DJMA 2NPBA 3D6IA 2WB9A 3EC3A 1JZOA 2LRNA 1IYHA 1YKCA 2DC5A 4GTUA 2HZFA 2MBTA 3CRUA 2H6ZA 2H0IA 5AGYA 3DKSA 4HUAA 4ZB6A 5D9TA 5D9VA 1GSYA 4DSSB 3DXBA 4DSRA 2FWHA 2IMKA 1NM3A 1FG4A 3HYPA 2DJ2A 4KDUA 3HJOA 4YH2A 2YOIA 4DVCA 2C0EA 2JADA 4BL7B 4GF0A 3TJFA 1K3OA 1N2AA 1Q98A 4JRRA 1M0UA 4HZ4A 3VI7A 3TJKA 4YQVA 2B6MA 5LD0A 1YDKA 4KGIA 1FHEA 1TTZA 1DE1A 4AJ8A 2I9HA 2RM5A 3KD0A 5F0GA 1GRXA 4GCIA 1PQNA 1TU8A 3MDKA 5G1LA 3NZNA 4WEYA 4PQ1A 3I6AA 5J4UA 3H8QA 1GUKA 4HOJA 5LCZA 1XPVA 2PVOC 2HZEB 3ERWA 5FWGA 3PR8A 4G10A 2H1DA 1Z5YE 3EU4A 3QFBC 2VLTA 3C1SA 5J9BA 1AAZA 3M9KA 2X64A 2E0QA 2J23A 3VWVA 4OO4A 1ZMAA 3LEFA 3VWWA 2CVBA 4ULXA 1OE8A 2KHPA 2NVLA 2CAQA 3RPNA 2C80A 1AQVA 3SWLA 2DJ3A 3QFAC 4RUVA 2VD1A 3F4TA 2AHEA 1K0AA 4TVEA 4I5QA 2YP6A 1R5PA 1TRVA 3RHCA 2FHEA 1XWBA 1QUWA 5L71A 4IQ1A 2I81A 3C73A 4QL9A 3E3EA 4TXVA 5G5EA 3L9UA 2FCHA 1GSQA 2HRNA 2OBKA 4O32A 4TKYA 5ELAA 1ERWA 1SD9A 3CRTA 2GT5A 4ID0A 1EP7A 4MCUA 3ZL5A 4WF5A 2VCTA 3VURA 3TJGA 1ON4A 2VO4A 3HZ8A 5D9XA 5ECPB 5IMCA 2GLRA 6GSXA 3WGEA 2V2GA 1WIKA 4L0WA 1K0BA 2BTOT 3CSIA 5CRDA 3WD6A 1NHOA 2GS3A 2H0HA 3C71A 4TOPA 3DEXA 4ILFA 3ZREA 1TK0B 5IMFA 2XC2A 3RDWA 3EU3A 3D4MA 1SJZA 3APQA 3TRPA 2GQMA 1TRUA 5C04A 2MMAA 2K6VA 5HR1A 4QL7A 1BAYA 3FYGA 2DIZA 3GYKA 3A2XA 2I3YA 1TI1A 4KA0A 2MZCA 1A8LA 2FA4A 1YF0A 4I2TA 4CDOA 1A8YA 1Y6EA 4YQUA 1J0FA 2DMLA 3DGQA 2M72A 2WGRA 4MLYA 4JR6A 2LUSA 1W4VA 3N9JA 1PX6A 1TP9A 5GSTA 1X5DA 5GAPD 3QMXA 3ZMKA 1KEBA 2O89A 3QCPA 2OADA 3UJ1A 2F9SA 4YAPA 5ECRB 1QQ2A 5G5FA 3FW2A 2GZPA 3DWVA 4G2EA 2M46A 2YV9A 1M2DA 4G0KA 1O7UA 4GWRA 2KLXA 1WRYA 4H86A 1ZOFA 2ON5A 1MDKA 1G0TA 1G6YA 2HSHA 2LRCA 2B3SA 3CSJA 2K8SA 17GSA 2FWFA 3UARA 3WT1A 3KH9A 2GQLA 1J9BA 4NV2A 4KE3A 4IQAA 4DSSA 3N5OA 2JU5A 1YQ1A 5C00A 4MF5A 3IRAA 3EVIA 4I2UA 3C7MA 3HCZA 1T00A 2OJLA 1GUMA 2AUVA 3IAS2 4BL7A 2R4VA 3TKSE 1PMTA 4TN8A 3L4NA 3EE2A 1YY7A 1GP1A 3TKQA 2VM1A 3KIJA 2C8UA 4KH7A 2K18A 5J9CA 1SU9A 3RBTA 3VWUA 2JL4A 1SD8A 2D2ZA 2F8FA 11GSA 3ZTLA 4HI7A 1BX9A 4HDEA 2JZTA 4NPBA 2WRTA 2R2JA 3FHKA 3WGXA 5A4WA 2TRXA 5JCWA 5D9WA 3MNGA 1F6MC 3GTUB 4KUNA 1BYEA 2VM2A 4MZBA 3NOFA 3BJ5A 2B1LA 3KEBA 5B6NA 3M1GA 3GHAA 1HNBA 2HZEA 3UL3A 4O5RA 3PGTA 4PQHA 2K8VA 5E4WA 4XIHA 4Z7XA 4QQ7A 1U3IA 4LL4B 2P5RA 4POKA 5DQYA 3TGZA 1QXHA 2WZ9A 4IW9A 1RW1A 2R6KA 5G31A 3GKKA 2YWMA 5ELGA 2DBCA 3HDCA 2GQKA 2H72A 2HRFA 4N0ZA 2MYGA 4KDYA 4DSQA 2CVKA 6GSVA 3FR9A 4CW9A 4ECBA 3BOAA 1Q4JA 4LL1B 3QR6A 5DAKB 1MTCA 2P0GA 3G7YA 5JWQB 1AQXA 5DVBA 5CRGA 3GL3A 3W8JA 3DMLA 2K9FA 4FYBA 1SK2A 3ERGA 1MD4A 2YN1A 2AJQB 3UVHA 2O8VB 3TKRA 1T3BA 3DIEA 2I1UA 3D4TA 2RIIA 2X99A 4MMMA 4EDYA 2LS5A 1V58A 2WFCA 4G0LA 1JZWA 2IIYA 3R3EA 3L9SA 4BPYA 4KB3A 1OE7A 1OAZA 3FY7A 5JWRB 2CAIA 1WP0A 4F9ZA 3DVWA 2IJYA 1SL1B 2GZZA 3G7IA 3HZ4A 3F4RA 3ZIJA 3HD5A 1FVKA 2MMNA 3KM6A 3FKFA 3H79A 2F51A 1QFNA 1YF1A 1K3LA 1PSQA 4GQCA 4ML1A 1Z7RA 1U88A 5D96A 4NMUA 1B8XA 1B9XC 1E6BA 1FW1A 1SK1A 4POMA 5CRHA 2OE3A 3UAPA 2L59A 3APOA 4PTSA 3MWHA 3LWAA 1X5CA 3J7Yk 3ME7A 4TXOB 5EY6A 5DALB 3D5JA 4XCSA 5KN2A 3HXSA 3WGDA 2H1AA 3GNJA 4WR4A 1A2LA 4OCEA 4MABA 1GUHA 4EDZA 3ME8A 1GTAA 2LKUA 3A3TA 3BCIA 2RM6A 1OKDA 4K6XA 5AIXA 3GSSA 4D73B 2PERA 1SKWB 4L5LA 4Q5FA 4KCAA 1T8EB 4KW6A 2N5FA 3VI5A 4Q5RA 5D93A 4HQZA 2LJAA 3E0UA 3ZIVA 4MDCA 5AISA 2MMZA 2F8AA 3K8NA 5HR2A 1SJ6A 4Q5NA 5B8AA 3GX0A 1PA3A 4OFTA 2DLXA 3TRQA 4L8EA 1EWXA 1SK0A 5DCGA 1Z3EA 2CZ3A 4PXOA 4L0UA 4X0XA 1BJXA 4MJCA 4JU5A 4V2LA 4EKZA 2AYTA 2C4JA 1THOA 2YCDA 2FUG2 1TKDB 14GSA 1KTEA 3FR3A 3GSTA 3TKPA 3ZRDA 5JCUA 3KP8A 3WYWA 2HSMB 1G6WA 1C72A 4ZIJA 4IBPA 4LMWA 1EZKA 5GAND 5CRWA 4F03A 2H74A 3Q18A 2EIOA 4ZILA 3ZFBA 2HRAA 2VD0A 3LXZA 1TU7A 4RI6A 3LYKA 2NDOA 1FB0A 5F05A 3TRXA 2HE3A 1DUGA 1THXA 2V6OA 1V40A 3GKMA 4BVYB 2R37A 4J56E 1T1VA 2LV3A 4WKWA 4Q5QA 3TOTA 1U3AA 3LORA 5E59A 3IXRA 1N8JA 2VLVA 2YPMA 2EIRA 2HSYA 4GSNA 2IWTA 3QAGA 3GTUA 5IPGA 3EINA 2GDRA 1UC7A 3I9V2 2BJXA 4MF6A 4ECCA 1O6JA 3BBYA 1B48A 5IMVA 2C0DA 1ZYQB 1K0NA 3MAKA 3TB2A 2IMDA 2H1GA 3F6FA 5ECSA 2DIYA 3KJYA 2AAWA 2CQ9A 4G19A 1ILOA 1RK4A 1NHYA 2IL3A 4KF9A 2DJKA 3DYRA 4FQUA 2IPAA 3IK9A 3O76A 1WPIA 5G1KA 1K0MA 1M9BA 5D73A 3IC8A 1ERUA 2H0GA 2LQQA 2DSAA 3GN3A 4K2DA 3UBKA 2L4CA 4ECJA 2C3QA 1GSDA 5AIVA 5HFGA 1V57A 3V1WA 3DRNA 4KSMA 1XWCA 3HVVA 3GMFA 3US3A 2O7KA 2PU9C 1U6TA 2WULA 2MBSA 4I97A 4EE0A 2ALBA 4BWQA 1A24A 5DAKA 4V1Ap 5ECOB 1PX7A 7GSSA 4AGSA 4TR1B 4GSTA 5FT3A 1T4ZA 5HR0A 5F8BA 3FK8A 1M9AA 2EIQA 5HFIA 1A2MA 3J7Yb 1VF1A 3M8NA 2H6YA 3IC4A 1WWJA 1URMA 3SBCA 3F3RA 3EMPA 5A4UA 1FB6A 4PNGA 2LSTA 2GGTA 1OVNA 4PUAA 5CAXA 1E2YA 4LMVA 1PN9A 1YJ6A 1MDJA 3FZ5A 2XPDA 18GSA 3CXGA 1T4YA 4P3YB 2LNSA 2IFQB 3D0ZA 5COHA 2XHFA 4HS1A 2GSRA 1B4QA 1A0FA 2VCVA 4AF2A 2VOCA 3PPUA 3EYTA 3C8EA 2GSQA 1A2JA 5ABRA 4IP6A 1W89A 3U6VA 4TXOA 4XS4B 5DALA 4IKHA 4IS0A 2GSTA 2YV7A 3DD3A 4MJAA 2YZUA 4HZ2A 2H8LA 4LLRA 4EF0A 1XXUA 2B5YA 4NHZA 1XW6A 5DJLA 3A5WA 1GSEA 3GURA 3TUEA 3ZLPA 4NV5A 5DBQA 1X9WB 4D73A 4WBRD 4EL1A 2M80A 2REMA 4POBA 4MJEA 6GSWA 3APSA 1XOAA 4ZL8A 1EV4A 5CREA 3U5RE 3VWXA 1O85A 2VL2C 3P7XA 5IO0A 19GSA 4IHUA 2UZ8A 1FAAA 3KZQA 4FH8A 4FO5A 3KTBA 4BVXB 3W8SA 1ERTA 3ZFLA 2H1BA 1WOUA 3IA1A 2DJ1A 3H93A 1YZXA 4I6XA 3F9UA 1GULA 4WBJA 2FWEA 4FYUA 2LJRA 4AJ7A 2GSSA 3LQ7A 9GSSA 1Z6MA 1QK8A 2HYXA 3UOMA 1NSWA 2HSMA 4K0GA 2V1MA 3GL5A 2ES7A 1M99A 4JEDA 4TRXA 5GZZB 4IJIA 2DMMA 3LSZA 2LQOA 1ABAA 3ISOA 2FNOA 4NXIA 4NAXA 2E2MA 5IOWA 4MK3A 1OC3A 2JZRA 2XPEA 1B9YC 5LNKe 5GSSA 3LG6A
chains in the Genus database with same CATH superfamily
1Z6NA 4PUFC 2B5EA 1HD2A 1ZYEA 5J3RA 3UVTA 1ZZYA 4BVYA 2WVXB 1SYXA 5KN1A 1AC1A 4F82A 2KOKA 4QMKA 3L78A 5EPFA 2H75A 4O92A 3R2QA 1X5EA 3BCKA 1JFUA 4OWYA 1K0DA 1CQGA 4J57E 1ZL9A 4AKHA 2LTKA 4HU9A 2CT6A 3CMIA 2H1LA 2CZ2A 1YEPA 4F0CA 2X8HA 1V98A 1R4WA 4GXZA 16GSA 1AXDA 4MNNA 2X8CA 2LRTA 1USBA 3CTFA 4JBBA 4ISDA 4X1UA 2WS2A 3HY2A 3HVSA 4MH2A 3PINA 4HJMA 3BD2A 3Q6OA 3GRXA 2DKIA 2QSIA 3Q74A 1SKSB 2A2SA 1XCCA 2H66A 1JHBA 3TKSC 4BWSA 4IVFA 5DCHA 4ZL7A 4MZWA 10GSA 2WW0A 4ZBBA 4TR1A 4ECIA 5CO3A 2FLSA 3RHBA 1XZOA 3CTGA 1J08A 2RLIA 3WT2A 3P2AA 4WETA 3A2WA 1AUCA 1R7HA 2QA2A 1EEJA 3QPMA 1BEDA 4EVMA 3VPQA 4L5OA 4TR4A 4BA7A 4PURA 4ICYA 4JZQA 3QAWA 1MEKA 3UIWA 5J5NA 1K0OA 3M0FA 4V2MA 1VRSD 4FXYP 2E7PA 2LJKA 4N0VA 2VL9A 4TW5A 4AI6A 1TXUA 1SL2B 2G0FA 5A5KA 1G7EA 2O87A 5IOXA 5BMUA 1S3AA 4RI7A 3A2VA 5J41A 3W6GA 2VCQA 1X9MB 4IP1A 2AV4A 2PUKC 1EV9A 5ECMB 2V6KA 3L9VA 3VFIA 2HNLA 2PVQA 1DE2A 4XS4A 2P5QA 5IPHA 2FA8A 4K7IA 5H5SA 1GL8A 1M7TA 5ECNB 2O5VA 3RGBC 1PD21 2PMTA 2XBQA 1TRSA 2YANA 3F3QA 6GSTA 1K0CA 4KCEA 5IQYA 1JZRA 3VPTA 3IE3A 3P8WA 5CNWA 4PQIA 4WR5A 4G0IA 4N10A 3ZMLA 1PKWA 3KTLA 1ZYPA 3FR6A 2PN8A 1M2AA 1FVJA 3RAZA 3LFLA 1M3JA 2GVPA 4GQFA 1Z7PA 3ZVJA 4YAVA 1QMVA 2VAFA 4O5UA 1XWAA 2OE0A 2OACA 5IIZA 4PI2C 3GA4A 2KP2A 4K7OA 3IHQA 4BVXA 2V32A 1F2EA 3ZYWA 1EGOA 5F06A 1CQHA 1SVMA 2O85A 3IBHA 2IMIA 4KDXA 3M9JA 1V9WA 1SL0B 5CP1A 3UBLA 2X8GA 5FHIA 1OYJA 3GFKA 4K5RA 2FD3A 2IMEA 1O73A 4K7NA 1U87A 1SYRA 3HHVA 5ID2B 4PI0C 2L6DA 1XVQA 2VCZA 5DQSA 1EEMA 4EUYA 1AW9A 4EO3A 1G7OA 2JSYA 2VIMA 1R5AA 3LGCA 5KOWA 1H4OA 2H76A 2HLSA 3L0HA 1GTUA 2CX4A 3GUSA 4ZBDA 1GH2A 3ERFA 5HFKA 1AQWA 2NTOA 22GSA 3TJJA 4IJ3A 3TOUA 1QGVA 2HI7A 4MJBA 5IO2A 3G7JA 1SENA 1VF3A 4HQSA 3OR5A 3E9JB 2HXKA 1Z9HA 5DDLA 1XWGA 4LA1A 2WVXA 8GSSA 2A4VA 2E2GA 1X0RA 3C1RA 5IMZA 1GWCA 4O7HA 3IHGA 1TJDA 1YKAA 2VL2A 2J9HA 1HYUA 2L6CA 2IN3A 3IDVA 3FZ9A 1FO5A 3ZVJD 4AJ6A 4IELA 4KX4A 4ZB9A 5JCGA 3F4SA 4EXJA 2H73A 3CYNA 3EURA 2WDUA 1TI3A 1BQ7A 1XOBA 3HKRA 1EOHA 2ZNMA 1F9MA 3FMWA 4YKFA 1JZDA 1HNAA 3Q19A 1ACVA 1S3DA 1ZCPA 5EVOA 3FEUA 4GRFA 5KN3A 1BG5A 2R0GA 1PGTA 1XFLA 5HR3A 2OA7A 1OC9B 5G30A 4IN0A 4AKXB 1TRWA 4AKGA 5H5QA 5ENUA 1K3YA 2YWOA 2A2RA 4NHWA 2UV8G 1GLPA 1F3BA 6GSUA 5A1NA 4TR3A 4MH3A 4I8BA 1S3CA 3VLNA 3UEMA 3QAVA 4K5SA 3O6TA 1XIYA 2MMOA 2EFHA 2H01A 12GSA 2KP1A 2O36A 3H4KA 2FY6A 1GNWA 2HFDA 5KEJA 4J2FA 1GTIA 3IAM2 3MYDA 2NBSA 3QDNA 1RQMA 1MDIA 3M3MA 1XVWA 1MD3A 4JE1A 3I43A 4MPGA 4ML6A 5INYA 1JLWA 3FZ4A 5JWOB 2OE1A 2H6XA 2HRKB 1UVZA 1A0RP 4K9ZA 3KP9A 2B1KA 1VGLA 2DJJA 2PGTA 1DSBA 2VUPA 4ACSA 2GZYA 1PL2A 3D22A 3AY8A 1FOVA 2RUEA 4XHMA 2YWNA 3LXTA 3JCML 2YZHA 3EPTA 1TW9A 2H70A 2B7JA 4PNFA 1GLQA 3TKSA 2R3XA 4USSA 5J40A 1UN2A 4G9HA 1F3AA 3GKXA 3KH7A 5F07A 3TCOA 2HQTA 4BIKA 2KUCA 2AB6A 4MP4A 1XWKA 1ZGNA 2H19A 4X43A 1LU4A 3IOSA 2OKAA 4FYCA 2OBIA 1PKZA 3O3TA 2R5GA 4XRDA 3ZITA 2PBJA 2JACA 1YVLA 3PH9A 2PPTA 4KSOA 1JLVA 2JZSA 2VL3A 1O8WA 1TK5B 1OC8A 1EP8A 3F6DA 2WW1A 4V1Ag 1TOFA 4KAEA 5IMDA 4Z2UA 4CHSA 3ZZXA 2FGXA 1R26A 3CWGA 2L5OA 1TDIA 3GKNA 3GIXA 2V41A 3KGKA 2TIRA 2XBIA 2I4AA 4HEA2 5AN1A 1HNCA 3QD9A 3FZAA 3GH9A 5ID2A 3F0IA 5ECHB 1AIUA 5IM9A 3VK9A 2LNTA 2YWIA 20GSA 2YJ7A 1XBSA 4DEJA 3FRCA 3LJRA 3KMNA 2HSNB 3IK7A 4NWYA 3GH6A 5EL8A 2C0GA 2B7KA 6GSSA 4FIWA 4RQXA 3TJBA 4ZXGA 1V2AA 3RPPA 4MF7A 3HVXA 4ZBAA 3QOUA 1XW5A 2VCWA 3KXOA 5A4VA 3RFRC 1A23A 2QA1A 1TXXA 4IGJA 4GLTA 2F3MA 2EC4A 4ZL9A 3TDGA 5G2ZA 1WJKA 2H71A 2P31A 3ED3A 4K8MA 1I9DA 2N5BA 1LJRA 4MZCA 1KNGA 2YNXA 2IMFA 1WMJA 3MSZA 2JSZA 5ECIB 3EWLA 1OKTA 2VCXA 4YKGA 2GTUA 2L5LA 3P90A 2CVDA 1GSUA 5ECKB 3H1NA 2BMXA 3LYPA 2ON7A 4OFMA 3HJMA 1IYIA 2HT9A 2LEGA 4EC0A 2H30A 3HJPA 2X4AA 4YQMA 2G2QA 2DJ0A 3GV1A 2QKEA 4F2IA 1T7PB 5H5RA 2WCIA 4V2NA 2C3NA 1GNEA 5B6MA 2PWJA 3HA9A 4KNDA 1B4PA 3F63A 1OC9A 5IMAA 1I5GA 1Y25A 1GSFA 3G9BA 1UA5A 3D21A 2L4QA 4OMVA 4K1FA 2VKZG 2QGVA 1GTBA 4HU7A 2ZUPA 4JR4A 4OD7A 5ECLB 1PL1A 4E8HA 1NW2A 1SJIA 4N11A 4MPFA 1KBNA 1WE0A 1EGRA 4POLA 2WJUA 5B7CA 3GX8A 1ERVA 3EMXA 3F8UA 1YEXA 4K2XA 5B8BA 5HQPA 3IR4A 1ZYNA 5CYYA 1X9SB 1EOGA 1TK8B 3KMOA 2N5AA 2IFQA 2CA8A 4XS1A 2TRCP 13GSA 1DBYA 4K0NA 2HRKA 4XS6A 4RQRA 3CBUA 2ZCTA 4PX1A 1M2BA 2C3TA 2GT6A 4HJ2A 4WF4A 1GSSA 2C0FA 2RUFA 4XRAA 2VLUA 5A5HA 3S9FA 1F37A 4N30A 4MA9A 1XW9A 4PGTA 4OO5A 2L57A 5KN0A 2YJHA 4WXTA 4GSSA 4OFNA 3I69A 1LBKA 3UMAA 3IPZA 3DVXA 2B5XA 2Z9SA 1ML6A 1ST9A 3IV4A 5ECQB 2C1YA 4TR0A 1VF4A 1PRXA 3KCMA 2CV4A 1HQOA 4E8EA 5D8IA 1O8XA 1SKRB 4OCFA 2FWGA 4ZB8A 1H75A 2QC7A 1VF2A 4F0BA 3CSHA 2CX3A 4XTSA 3NIVA 6GSYA 1O81A 5DJMA 2NPBA 5A34B 3D6IA 2WB9A 3EC3A 1JZOA 2LRNA 1IYHA 1YKCA 2DC5A 4GTUA 2HZFA 2MBTA 3CRUA 2H6ZA 2H0IA 5AGYA 3DKSA 4HUAA 4G01A 4ZB6A 5D9TA 5D9VA 1GSYA 4DSSB 3DXBA 4DSRA 2FWHA 2IMKA 1NM3A 1FG4A 3HYPA 2DJ2A 4KDUA 3HJOA 4YH2A 2YOIA 4DVCA 2C0EA 2JADA 4BL7B 4GF0A 3TJFA 1K3OA 1N2AA 1Q98A 4JRRA 2HSNA 1M0UA 4HZ4A 3VI7A 3TJKA 4YQVA 2B6MA 5LD0A 1YDKA 4KGIA 1FHEA 1TTZA 1DE1A 4AJ8A 2I9HA 2RM5A 3KD0A 5F0GA 1GRXA 4GCIA 1PQNA 1TU8A 3MDKA 1M3IA 5G1LA 3NZNA 4WEYA 4PQ1A 3I6AA 5J4UA 3H8QA 1GUKA 4HOJA 5LCZA 4ZB7A 1XPVA 2PVOC 2HZEB 3ERWA 2EFDA 5FWGA 3PR8A 4G10A 4GDFA 2H1DA 1Z5YE 2R0PA 3EU4A 3QFBC 2VLTA 3C1SA 5J9BA 1AAZA 3M9KA 2X64A 2E0QA 2J23A 3VWVA 4OO4A 1ZMAA 3LEFA 1PN0A 3VWWA 2CVBA 4ULXA 1OE8A 2KHPA 2NVLA 2CAQA 3RPNA 2C80A 1AQVA 3SWLA 1FOHA 2DJ3A 3QFAC 4RUVA 2VD1A 3F4TA 2AHEA 1K0AA 4TVEA 4I5QA 2YP6A 1R5PA 1TRVA 3RHCA 2FHEA 1XWBA 1QUWA 5L71A 4IQ1A 2I81A 3C73A 4QL9A 3E3EA 4TXVA 5G5EA 3L9UA 2FCHA 1GSQA 2HRNA 2OBKA 4O32A 4TKYA 5ELAA 1ERWA 1SD9A 3CRTA 2GT5A 4ID0A 1EP7A 4MCUA 3ZL5A 4WF5A 2VCTA 3VURA 3TJGA 1ON4A 2VO4A 3HZ8A 5D9XA 5ECPB 5IMCA 1Y1UA 2GLRA 6GSXA 3WGEA 2V2GA 1WIKA 4L0WA 1K0BA 2BTOT 3CSIA 5CRDA 3WD6A 1NHOA 2GS3A 2H0HA 3C71A 4TOPA 3DEXA 4ILFA 3ZREA 4CY6A 1TK0B 5IMFA 2XC2A 3RDWA 3EU3A 3D4MA 1SJZA 3APQA 3TRPA 2GQMA 1TRUA 5C04A 2MMAA 2K6VA 5HR1A 2WVYA 4QL7A 1BAYA 3FYGA 2DIZA 3GYKA 3A2XA 2I3YA 1TI1A 5J4VA 4KA0A 2MZCA 1A8LA 2FA4A 1YF0A 4I2TA 4CDOA 3CHXC 1A8YA 1Y6EA 4YQUA 1J0FA 2DMLA 3DGQA 2M72A 2WGRA 4MLYA 4JR6A 2LUSA 3TU3B 1W4VA 3N9JA 1PX6A 1TP9A 5GSTA 1X5DA 5GAPD 3QMXA 3ZMKA 1KEBA 2O89A 3QCPA 2OADA 3UJ1A 2F9SA 4YAPA 5ECRB 1QQ2A 5G5FA 3FW2A 2GZPA 3DWVA 4G2EA 2M46A 2YV9A 1M2DA 1N25A 4G0KA 5J47A 1O7UA 4N3ZA 4GWRA 2KLXA 1WRYA 4H86A 1ZOFA 2ON5A 1MDKA 5A34A 1G0TA 1G6YA 2HSHA 2LRCA 2B3SA 3CSJA 2K8SA 17GSA 2FWFA 3UARA 3WT1A 4AKIA 3KH9A 2GQLA 1J9BA 4NV2A 4KE3A 4IQAA 4DSSA 3N5OA 2JU5A 1YQ1A 5C00A 4MF5A 3IRAA 2O3EA 3EVIA 4I2UA 3C7MA 1S3RA 3HCZA 1T00A 2OJLA 1GUMA 2AUVA 3IAS2 4BL7A 2R4VA 1BF5A 3TKSE 1PMTA 4TN8A 3L4NA 3EE2A 1YY7A 1GP1A 3TKQA 2VM1A 3KIJA 2C8UA 4KH7A 2K18A 5J9CA 1SU9A 3RBTA 3VWUA 2JL4A 1SD8A 2D2ZA 2F8FA 11GSA 3ZTLA 4HI7A 1SVLA 1BX9A 4HDEA 2JZTA 4NPBA 2WRTA 2R2JA 3FHKA 3WGXA 5A4WA 2TRXA 5JCWA 5D9WA 3MNGA 1F6MC 3GTUB 4KUNA 1BYEA 2VM2A 4MZBA 3NOFA 3BJ5A 2B1LA 3KEBA 5B6NA 3M1GA 3GHAA 1HNBA 2HZEA 3UL3A 4O5RA 3PGTA 4PQHA 2K8VA 5E4WA 4XIHA 2WVZA 4Z7XA 4QQ7A 1U3IA 1XG8A 4LL4B 2P5RA 4POKA 5DQYA 3TGZA 1QXHA 2WZ9A 4IW9A 4X4JA 1RW1A 2R6KA 5G31A 3GKKA 2YWMA 5ELGA 2DBCA 3HMJG 3HDCA 2GQKA 2H72A 2HRFA 4N0ZA 2MYGA 4KDYA 4DSQA 2CVKA 6GSVA 3FR9A 4CW9A 4EIPA 2OT3A 4ECBA 3A5IA 3BOAA 1Q4JA 4LL1B 3QR6A 5DAKB 1MTCA 2P0GA 3G7YA 5JWQB 1AQXA 5DVBA 5CRGA 3GL3A 3W8JA 3DMLA 2K9FA 4FYBA 1SK2A 3ERGA 1MD4A 2YN1A 2AJQB 3UVHA 3LW9A 2O8VB 5A1NB 3TKRA 1T3BA 3DIEA 2I1UA 3D4TA 1I1IP 2RIIA 2X99A 4MMMA 4EDYA 2LS5A 1V58A 2WFCA 4G0LA 1JZWA 2IIYA 3HVNA 3R3EA 3L9SA 4BPYA 4KB3A 1OE7A 1OAZA 3FY7A 5JWRB 2CAIA 1WP0A 4F9ZA 3DVWA 2IJYA 1SL1B 2GZZA 3G7IA 3HZ4A 3F4RA 3ZIJA 3HD5A 1FVKA 2MMNA 3KM6A 3FKFA 3H79A 2F51A 1QFNA 1YF1A 1K3LA 1PSQA 4GQCA 4ML1A 1Z7RA 2R0CA 4Z2TA 1U88A 5D96A 4NMUA 1B8XA 1B9XC 1E6BA 1FW1A 1SK1A 4POMA 3MIXA 5CRHA 2OE3A 3UAPA 2L59A 3APOA 4PTSA 3MWHA 3LWAA 1X5CA 3J7Yk 3ME7A 4TXOB 5EY6A 5DALB 2DKHA 3D5JA 4XCSA 5KN2A 3HXSA 3WGDA 2H1AA 3GNJA 4WR4A 1A2LA 4OCEA 4MABA 1GUHA 4EDZA 3ME8A 1GTAA 2LKUA 3A3TA 3BCIA 2RM6A 1OKDA 4EIQA 4K6XA 5AIXA 4PHZC 3GSSA 4D73B 2PERA 1SKWB 4L5LA 4Q5FA 4KCAA 1T8EB 4KW6A 2N5FA 3VI5A 4Q5RA 5D93A 4HQZA 2LJAA 5J4YA 3E0UA 3ZIVA 4MDCA 5AISA 2MMZA 2F8AA 3K8NA 5HR2A 1SJ6A 4Q5NA 5B8AA 3GX0A 1PA3A 4OFTA 2DLXA 3TRQA 4L8EA 1EWXA 1SK0A 5DCGA 1Z3EA 2CZ3A 4PXOA 4L0UA 4X0XA 1YEWC 1BJXA 4MJCA 4JU5A 4V2LA 4EKZA 2AYTA 5KOXA 2C4JA 1THOA 2YCDA 2FUG2 1TKDB 14GSA 1KTEA 3FR3A 3GSTA 3TKPA 3ZRDA 5JCUA 3KP8A 3WYWA 2HSMB 1G6WA 1C72A 4ZIJA 4IBPA 2A2PA 4LMWA 1EZKA 5GAND 5CRWA 4F03A 2H74A 3Q18A 2EIOA 4ZILA 2EFEA 3ZFBA 2HRAA 2VD0A 3LXZA 1TU7A 4RI6A 3LYKA 2NDOA 1FB0A 5F05A 3TRXA 2HE3A 1DUGA 1THXA 2V6OA 2WW2A 1V40A 3GKMA 4BVYB 2R37A 4J56E 1T1VA 2LV3A 4WKWA 4Q5QA 3TOTA 1U3AA 3LORA 5E59A 3IXRA 1N8JA 2VLVA 2YPMA 2EIRA 2HSYA 4GSNA 2IWTA 3QAGA 3GTUA 5IPGA 3EINA 1PFOA 2GDRA 1UC7A 3I9V2 2BJXA 4MF6A 4ECCA 1O6JA 3BBYA 1B48A 5IMVA 2C0DA 1ZYQB 1K0NA 1S4BP 3MAKA 3TB2A 2IMDA 2H1GA 3F6FA 5ECSA 2DIYA 3KJYA 2AAWA 2CQ9A 4G19A 1ILOA 1RK4A 1NHYA 2IL3A 4KF9A 2DJKA 3DYRA 4FQUA 2IPAA 3IK9A 3O76A 1WPIA 5G1KA 1K0MA 1M9BA 5D73A 3IC8A 1ERUA 2H0GA 2LQQA 2DSAA 3GN3A 5BRTA 4K2DA 3UBKA 2L4CA 4ECJA 2C3QA 1GSDA 5AIVA 5HFGA 1V57A 3V1WA 3DRNA 4KSMA 1XWCA 3HVVA 3GMFA 3US3A 2O7KA 2PU9C 1U6TA 2WULA 2MBSA 4I97A 4EE0A 2ALBA 4BWQA 1A24A 5DAKA 4V1Ap 5ECOB 1PX7A 7GSSA 4AGSA 4TR1B 4GSTA 2WW3A 5FT3A 1T4ZA 5HR0A 5F8BA 1SVOA 3FK8A 1M9AA 2EIQA 5HFIA 2X49A 1A2MA 3J7Yb 1VF1A 3M8NA 2H6YA 2A4HA 2WZSA 1WWJA 3IC4A 1URMA 3SBCA 3F3RA 3EMPA 5A4UA 1FB6A 4PNGA 2LSTA 2GGTA 1OVNA 4PUAA 5CAXA 4O5QA 1E2YA 4LMVA 1PN9A 1YJ6A 1MDJA 3FZ5A 2XPDA 18GSA 3CXGA 1T4YA 4P3YB 2LNSA 2IFQB 3D0ZA 5COHA 2XHFA 4HS1A 2GSRA 1B4QA 2EFCA 1A0FA 2VCVA 4AF2A 5BMUB 2VOCA 3PPUA 3EYTA 3C8EA 2GSQA 1A2JA 5ABRA 4IP6A 1W89A 3U6VA 4TXOA 4XS4B 5DALA 5A5HB 4IKHA 4IS0A 2GSTA 2YV7A 3DD3A 4MJAA 2YZUA 4HZ2A 2H8LA 4LLRA 4EF0A 1XXUA 2B5YA 4NHZA 1XW6A 5DJLA 3A5WA 1GSEA 3GURA 3TUEA 3ZLPA 4NV5A 5DBQA 1X9WB 4D73A 4WBRD 4EL1A 2M80A 2REMA 4POBA 4MJEA 6GSWA 3APSA 1XOAA 4ZL8A 1EV4A 5CREA 3U5RE 3VWXA 1O85A 2VL2C 4A5PA 3P7XA 5IO0A 19GSA 4IHUA 2UZ8A 1FAAA 3KZQA 4FH8A 4FO5A 3KTBA 4BVXB 3W8SA 1ERTA 4W66A 3ZFLA 2H1BA 3IA1A 1WOUA 2DJ1A 4HSCX 3H93A 1YZXA 4I6XA 3F9UA 1GULA 4WBJA 4CY8A 2FWEA 4FYUA 2LJRA 4AJ7A 2GSSA 3LQ7A 9GSSA 1Z6MA 1QK8A 2HYXA 3UOMA 1NSWA 2HSMA 4K0GA 1BG1A 2V1MA 3GL5A 2ES7A 1M99A 4JEDA 4TRXA 5GZZB 4IJIA 2DMMA 3CQFA 3LSZA 2LQOA 1ABAA 4Z2RA 4E68A 3ISOA 2FNOA 4NXIA 4NAXA 2E2MA 5IOWA 4MK3A 1OC3A 2JZRA 2XPEA 1B9YC 5LNKe 5GSSA 3LG6A
chains in the Genus database with same CATH topology
1Z6NA 4PUFC 2B5EA 1HD2A 1ZYEA 5J3RA 3UVTA 1ZZYA 4BVYA 1SYXA 5KN1A 1AC1A 4F82A 2KOKA 4QMKA 3L78A 5EPFA 2H75A 4O92A 3R2QA 1X5EA 3BCKA 1JFUA 4OWYA 1K0DA 1CQGA 4J57E 1ZL9A 4AKHA 2LTKA 4HU9A 2CT6A 3CMIA 2H1LA 2CZ2A 1YEPA 4F0CA 2X8HA 1V98A 1R4WA 4GXZA 16GSA 1AXDA 4MNNA 2X8CA 2LRTA 1USBA 3CTFA 4JBBA 4ISDA 4X1UA 2WS2A 3HY2A 3HVSA 4MH2A 3PINA 4HJMA 3BD2A 3Q6OA 3GRXA 2DKIA 2QSIA 3Q74A 1SKSB 2A2SA 1XCCA 2H66A 1JHBA 3TKSC 4BWSA 4IVFA 5DCHA 4ZL7A 4MZWA 10GSA 4ZBBA 4TR1A 4ECIA 5CO3A 2FLSA 3RHBA 1XZOA 3CTGA 1J08A 2RLIA 3WT2A 3P2AA 4WETA 3A2WA 1AUCA 1R7HA 2QA2A 1EEJA 3QPMA 1BEDA 4EVMA 3VPQA 4L5OA 4TR4A 4BA7A 4PURA 4ICYA 4JZQA 3QAWA 1MEKA 3UIWA 5J5NA 1K0OA 3M0FA 4V2MA 1VRSD 2E7PA 2LJKA 4N0VA 2VL9A 4TW5A 4AI6A 1TXUA 1SL2B 2G0FA 5A5KA 1G7EA 2O87A 5IOXA 5BMUA 1S3AA 4RI7A 3A2VA 5J41A 3W6GA 2VCQA 1X9MB 4IP1A 2AV4A 2PUKC 1EV9A 5ECMB 2V6KA 3L9VA 3VFIA 2HNLA 2PVQA 1DE2A 4XS4A 2P5QA 5IPHA 2FA8A 4K7IA 5H5SA 1GL8A 1M7TA 5ECNB 2O5VA 2XBQA 1PD21 2PMTA 1TRSA 2YANA 3F3QA 6GSTA 1K0CA 4KCEA 5IQYA 1JZRA 3VPTA 3IE3A 3P8WA 5CNWA 4PQIA 4WR5A 4G0IA 4N10A 3ZMLA 1PKWA 3KTLA 1ZYPA 3FR6A 2PN8A 1M2AA 1FVJA 3RAZA 3LFLA 2GVPA 4GQFA 1Z7PA 3ZVJA 4YAVA 1QMVA 2VAFA 4O5UA 1XWAA 2OE0A 2OACA 5IIZA 3GA4A 2KP2A 4K7OA 3IHQA 4BVXA 2V32A 1F2EA 3ZYWA 1EGOA 5F06A 1CQHA 1SVMA 2O85A 3IBHA 2IMIA 4KDXA 3M9JA 1V9WA 1SL0B 5CP1A 3UBLA 2X8GA 5FHIA 1OYJA 3GFKA 4K5RA 2FD3A 2IMEA 1O73A 4K7NA 1U87A 1SYRA 3HHVA 5ID2B 2L6DA 1XVQA 2VCZA 5DQSA 1EEMA 4EUYA 1AW9A 4EO3A 1G7OA 2JSYA 2VIMA 1R5AA 3LGCA 5KOWA 1H4OA 2H76A 2HLSA 3L0HA 1GTUA 2CX4A 3GUSA 4ZBDA 1GH2A 3ERFA 5HFKA 1AQWA 2NTOA 22GSA 3TJJA 4IJ3A 3TOUA 1QGVA 2HI7A 4MJBA 5IO2A 3G7JA 1SENA 1VF3A 4HQSA 3OR5A 3E9JB 2HXKA 1Z9HA 5DDLA 1XWGA 4LA1A 8GSSA 2A4VA 2E2GA 1X0RA 3C1RA 5IMZA 1GWCA 4O7HA 3IHGA 1TJDA 1YKAA 2VL2A 2J9HA 1HYUA 2L6CA 2IN3A 3IDVA 3FZ9A 1FO5A 3ZVJD 4AJ6A 4IELA 4KX4A 4ZB9A 5JCGA 3F4SA 4EXJA 2H73A 3CYNA 3EURA 2WDUA 1TI3A 1BQ7A 1XOBA 3HKRA 1EOHA 2ZNMA 1F9MA 3FMWA 4YKFA 1JZDA 1HNAA 3Q19A 1ACVA 1S3DA 1ZCPA 5EVOA 3FEUA 4GRFA 5KN3A 1BG5A 2R0GA 1PGTA 1XFLA 5HR3A 2OA7A 1OC9B 5G30A 4IN0A 4AKXB 1TRWA 4AKGA 5H5QA 5ENUA 1K3YA 2YWOA 2A2RA 4NHWA 2UV8G 1GLPA 1F3BA 6GSUA 5A1NA 4TR3A 4MH3A 4I8BA 1S3CA 3VLNA 3UEMA 3QAVA 4K5SA 3O6TA 1XIYA 2MMOA 2EFHA 2H01A 12GSA 2KP1A 3H4KA 2FY6A 1GNWA 2HFDA 5KEJA 4J2FA 1GTIA 3IAM2 3MYDA 2NBSA 3QDNA 1RQMA 1MDIA 3M3MA 1XVWA 1MD3A 4JE1A 3I43A 4MPGA 4ML6A 5INYA 1JLWA 3FZ4A 5JWOB 2OE1A 2H6XA 2HRKB 1UVZA 1A0RP 4K9ZA 3KP9A 2B1KA 1VGLA 2DJJA 2PGTA 1DSBA 2VUPA 4ACSA 2GZYA 1PL2A 3D22A 3AY8A 1FOVA 2RUEA 4XHMA 2YWNA 3LXTA 3JCML 2YZHA 3EPTA 1TW9A 2H70A 2B7JA 4PNFA 1GLQA 3TKSA 2R3XA 4USSA 5J40A 1UN2A 4G9HA 1F3AA 3GKXA 3KH7A 5F07A 3TCOA 2HQTA 2KUCA 2AB6A 4MP4A 1XWKA 1ZGNA 2H19A 4X43A 1LU4A 3IOSA 2OKAA 4FYCA 2OBIA 1PKZA 3O3TA 2R5GA 4XRDA 3ZITA 2PBJA 2JACA 1YVLA 3PH9A 2PPTA 4KSOA 1JLVA 2JZSA 2VL3A 1O8WA 1TK5B 1OC8A 1EP8A 3F6DA 4V1Ag 1TOFA 4KAEA 5IMDA 4Z2UA 4CHSA 3ZZXA 2FGXA 1R26A 3CWGA 2L5OA 1TDIA 3GKNA 3GIXA 2V41A 3KGKA 2TIRA 2XBIA 2I4AA 4HEA2 5AN1A 1HNCA 3QD9A 3FZAA 3GH9A 5ID2A 3F0IA 5ECHB 1AIUA 5IM9A 3VK9A 2LNTA 2YWIA 20GSA 2YJ7A 1XBSA 4DEJA 3FRCA 3LJRA 3KMNA 2HSNB 3IK7A 4NWYA 3GH6A 5EL8A 2C0GA 2B7KA 6GSSA 4FIWA 4RQXA 3TJBA 4ZXGA 1V2AA 3RPPA 4MF7A 3HVXA 4ZBAA 3QOUA 1XW5A 2VCWA 3KXOA 5A4VA 1A23A 2QA1A 1TXXA 4IGJA 4GLTA 2F3MA 2EC4A 4ZL9A 3TDGA 5G2ZA 1WJKA 2H71A 2P31A 3ED3A 4K8MA 1I9DA 2N5BA 1LJRA 4MZCA 1KNGA 2YNXA 2IMFA 1WMJA 3MSZA 2JSZA 5ECIB 3EWLA 1OKTA 2VCXA 4YKGA 2GTUA 2L5LA 3P90A 2CVDA 1GSUA 5ECKB 3H1NA 2BMXA 3LYPA 2ON7A 4OFMA 3HJMA 1IYIA 2HT9A 2LEGA 4EC0A 2H30A 3HJPA 2X4AA 4YQMA 2G2QA 2DJ0A 3GV1A 2QKEA 4F2IA 1T7PB 5H5RA 2WCIA 4V2NA 2C3NA 1GNEA 5B6MA 2PWJA 3HA9A 4KNDA 1B4PA 3F63A 1OC9A 5IMAA 1I5GA 1Y25A 1GSFA 3G9BA 1UA5A 3D21A 2L4QA 4OMVA 4K1FA 2VKZG 2QGVA 1GTBA 4HU7A 2ZUPA 4JR4A 4OD7A 5ECLB 1PL1A 4E8HA 1NW2A 1SJIA 4N11A 4MPFA 1KBNA 1WE0A 1EGRA 4POLA 2WJUA 5B7CA 3GX8A 1ERVA 3EMXA 3F8UA 1YEXA 4K2XA 5B8BA 5HQPA 3IR4A 1ZYNA 5CYYA 1X9SB 1EOGA 1TK8B 3KMOA 2N5AA 2IFQA 2CA8A 4XS1A 2TRCP 13GSA 1DBYA 4K0NA 2HRKA 4XS6A 4RQRA 3CBUA 2ZCTA 4PX1A 1M2BA 2C3TA 2GT6A 4HJ2A 4WF4A 1GSSA 2C0FA 2RUFA 4XRAA 2VLUA 5A5HA 3S9FA 1F37A 4N30A 4MA9A 1XW9A 4PGTA 4OO5A 2L57A 5KN0A 2YJHA 4WXTA 4GSSA 4OFNA 3I69A 1LBKA 3UMAA 3IPZA 3DVXA 2B5XA 2Z9SA 1ML6A 1ST9A 3IV4A 5ECQB 2C1YA 4TR0A 1VF4A 1PRXA 3KCMA 2CV4A 1HQOA 4E8EA 5D8IA 1O8XA 1SKRB 4OCFA 2FWGA 4ZB8A 1H75A 2QC7A 1VF2A 4F0BA 3CSHA 2CX3A 4XTSA 3NIVA 6GSYA 1O81A 5DJMA 2NPBA 5A34B 3D6IA 2WB9A 3EC3A 1JZOA 2LRNA 1IYHA 1YKCA 2DC5A 4GTUA 2HZFA 2MBTA 3CRUA 2H6ZA 2H0IA 5AGYA 3DKSA 4HUAA 4G01A 4ZB6A 5D9TA 5D9VA 1GSYA 4DSSB 3DXBA 4DSRA 2FWHA 2IMKA 1NM3A 1FG4A 3HYPA 2DJ2A 4KDUA 3HJOA 4YH2A 2YOIA 4DVCA 2C0EA 2JADA 4BL7B 4GF0A 3TJFA 1K3OA 1N2AA 1Q98A 4JRRA 2HSNA 1M0UA 4HZ4A 3VI7A 3TJKA 4YQVA 2B6MA 5LD0A 1YDKA 4KGIA 1FHEA 1TTZA 1DE1A 4AJ8A 2I9HA 2RM5A 3KD0A 5F0GA 1GRXA 4GCIA 1PQNA 1TU8A 3MDKA 5G1LA 3NZNA 4WEYA 4PQ1A 3I6AA 5J4UA 3H8QA 1GUKA 4HOJA 5LCZA 4ZB7A 1XPVA 2PVOC 2HZEB 3ERWA 2EFDA 5FWGA 3PR8A 4G10A 4GDFA 2H1DA 1Z5YE 2R0PA 3EU4A 3QFBC 2VLTA 3C1SA 5J9BA 1AAZA 3M9KA 2X64A 2E0QA 2J23A 3VWVA 4OO4A 1ZMAA 3LEFA 1PN0A 3VWWA 2CVBA 4ULXA 1OE8A 2KHPA 2NVLA 2CAQA 3RPNA 2C80A 1AQVA 3SWLA 1FOHA 2DJ3A 3QFAC 4RUVA 2VD1A 3F4TA 2AHEA 1K0AA 4TVEA 4I5QA 2YP6A 1R5PA 1TRVA 3RHCA 2FHEA 1XWBA 1QUWA 5L71A 4IQ1A 2I81A 3C73A 4QL9A 3E3EA 4TXVA 5G5EA 3L9UA 2FCHA 1GSQA 2HRNA 2OBKA 4O32A 4TKYA 5ELAA 1ERWA 1SD9A 3CRTA 2GT5A 4ID0A 1EP7A 4MCUA 3ZL5A 4WF5A 2VCTA 3VURA 3TJGA 1ON4A 2VO4A 3HZ8A 5D9XA 5ECPB 5IMCA 1Y1UA 2GLRA 6GSXA 3WGEA 2V2GA 1WIKA 4L0WA 1K0BA 2BTOT 3CSIA 5CRDA 3WD6A 1NHOA 2GS3A 2H0HA 3C71A 4TOPA 3DEXA 4ILFA 3ZREA 4CY6A 1TK0B 5IMFA 2XC2A 3RDWA 3EU3A 3D4MA 1SJZA 3APQA 3TRPA 2GQMA 1TRUA 5C04A 2MMAA 2K6VA 5HR1A 4QL7A 1BAYA 3FYGA 2DIZA 3GYKA 3A2XA 2I3YA 1TI1A 5J4VA 4KA0A 2MZCA 1A8LA 2FA4A 1YF0A 4I2TA 4CDOA 1A8YA 1Y6EA 4YQUA 1J0FA 2DMLA 3DGQA 2M72A 2WGRA 4MLYA 4JR6A 2LUSA 3TU3B 1W4VA 3N9JA 1PX6A 1TP9A 5GSTA 1X5DA 5GAPD 3QMXA 3ZMKA 1KEBA 2O89A 3QCPA 2OADA 3UJ1A 2F9SA 4YAPA 5ECRB 1QQ2A 5G5FA 3FW2A 2GZPA 3DWVA 4G2EA 2M46A 2YV9A 1M2DA 1N25A 4G0KA 5J47A 1O7UA 4N3ZA 4GWRA 2KLXA 1WRYA 4H86A 1ZOFA 2ON5A 1MDKA 5A34A 1G0TA 1G6YA 2HSHA 2LRCA 2B3SA 3CSJA 2K8SA 17GSA 2FWFA 3UARA 3WT1A 4AKIA 3KH9A 2GQLA 1J9BA 4NV2A 4KE3A 4IQAA 4DSSA 3N5OA 2JU5A 1YQ1A 5C00A 4MF5A 3IRAA 3EVIA 4I2UA 3C7MA 3HCZA 1T00A 2OJLA 1GUMA 2AUVA 3IAS2 4BL7A 2R4VA 1BF5A 3TKSE 1PMTA 4TN8A 3L4NA 3EE2A 1YY7A 1GP1A 3TKQA 2VM1A 3KIJA 2C8UA 4KH7A 2K18A 5J9CA 1SU9A 3RBTA 3VWUA 2JL4A 1SD8A 2D2ZA 2F8FA 11GSA 3ZTLA 4HI7A 1SVLA 1BX9A 4HDEA 2JZTA 4NPBA 2WRTA 2R2JA 3FHKA 3WGXA 5A4WA 2TRXA 5JCWA 5D9WA 3MNGA 1F6MC 3GTUB 4KUNA 1BYEA 2VM2A 4MZBA 3NOFA 3BJ5A 2B1LA 3KEBA 5B6NA 3M1GA 3GHAA 1HNBA 2HZEA 3UL3A 4O5RA 3PGTA 4PQHA 2K8VA 5E4WA 4XIHA 4Z7XA 4QQ7A 1U3IA 4LL4B 2P5RA 4POKA 5DQYA 3TGZA 1QXHA 2WZ9A 4IW9A 4X4JA 1RW1A 2R6KA 5G31A 3GKKA 2YWMA 5ELGA 2DBCA 3HMJG 3HDCA 2GQKA 2H72A 2HRFA 4N0ZA 2MYGA 4KDYA 4DSQA 2CVKA 6GSVA 3FR9A 4CW9A 4EIPA 2OT3A 4ECBA 3A5IA 3BOAA 1Q4JA 4LL1B 3QR6A 5DAKB 1MTCA 2P0GA 3G7YA 5JWQB 1AQXA 5DVBA 5CRGA 3GL3A 3W8JA 3DMLA 2K9FA 4FYBA 1SK2A 3ERGA 1MD4A 2YN1A 2AJQB 3UVHA 3LW9A 2O8VB 5A1NB 3TKRA 1T3BA 3DIEA 2I1UA 3D4TA 2RIIA 2X99A 4MMMA 4EDYA 2LS5A 1V58A 2WFCA 4G0LA 1JZWA 2IIYA 3R3EA 3L9SA 4BPYA 4KB3A 1OE7A 1OAZA 3FY7A 5JWRB 2CAIA 1WP0A 4F9ZA 3DVWA 2IJYA 1SL1B 2GZZA 3G7IA 3HZ4A 3F4RA 3ZIJA 3HD5A 1FVKA 2MMNA 3KM6A 3FKFA 3H79A 2F51A 1QFNA 1YF1A 1K3LA 1PSQA 4GQCA 4ML1A 1Z7RA 2R0CA 4Z2TA 1U88A 5D96A 4NMUA 1B8XA 1B9XC 1E6BA 1FW1A 1SK1A 4POMA 3MIXA 5CRHA 2OE3A 3UAPA 2L59A 3APOA 4PTSA 3MWHA 3LWAA 1X5CA 3J7Yk 3ME7A 4TXOB 5EY6A 5DALB 2DKHA 3D5JA 4XCSA 5KN2A 3HXSA 3WGDA 2H1AA 3GNJA 4WR4A 1A2LA 4OCEA 4MABA 1GUHA 4EDZA 3ME8A 1GTAA 2LKUA 3A3TA 3BCIA 2RM6A 1OKDA 4EIQA 4K6XA 5AIXA 3GSSA 4D73B 2PERA 1SKWB 4L5LA 4Q5FA 4KCAA 1T8EB 4KW6A 2N5FA 3VI5A 4Q5RA 5D93A 4HQZA 2LJAA 5J4YA 3E0UA 3ZIVA 4MDCA 5AISA 2MMZA 2F8AA 3K8NA 5HR2A 1SJ6A 4Q5NA 5B8AA 3GX0A 1PA3A 4OFTA 2DLXA 3TRQA 4L8EA 1EWXA 1SK0A 5DCGA 1Z3EA 2CZ3A 4PXOA 4L0UA 4X0XA 1BJXA 4MJCA 4JU5A 4V2LA 4EKZA 2AYTA 5KOXA 2C4JA 1THOA 2YCDA 2FUG2 1TKDB 14GSA 1KTEA 3FR3A 3GSTA 3TKPA 3ZRDA 5JCUA 3KP8A 3WYWA 2HSMB 1G6WA 1C72A 4ZIJA 4IBPA 2A2PA 4LMWA 1EZKA 5GAND 5CRWA 4F03A 2H74A 3Q18A 2EIOA 4ZILA 2EFEA 3ZFBA 2HRAA 2VD0A 3LXZA 1TU7A 4RI6A 3LYKA 2NDOA 1FB0A 5F05A 3TRXA 2HE3A 1DUGA 1THXA 2V6OA 1V40A 3GKMA 4BVYB 2R37A 4J56E 1T1VA 2LV3A 4WKWA 4Q5QA 3TOTA 1U3AA 3LORA 5E59A 3IXRA 1N8JA 2VLVA 2YPMA 2EIRA 2HSYA 4GSNA 2IWTA 3QAGA 3GTUA 5IPGA 3EINA 2GDRA 1UC7A 3I9V2 2BJXA 4MF6A 4ECCA 1O6JA 3BBYA 1B48A 5IMVA 2C0DA 1ZYQB 1K0NA 3MAKA 3TB2A 2IMDA 2H1GA 3F6FA 5ECSA 2DIYA 3KJYA 2AAWA 2CQ9A 4G19A 1ILOA 1RK4A 1NHYA 2IL3A 4KF9A 2DJKA 3DYRA 4FQUA 2IPAA 3IK9A 3O76A 1WPIA 5G1KA 1K0MA 1M9BA 5D73A 3IC8A 1ERUA 2H0GA 2LQQA 2DSAA 3GN3A 5BRTA 4K2DA 3UBKA 2L4CA 4ECJA 2C3QA 1GSDA 5AIVA 5HFGA 1V57A 3V1WA 3DRNA 4KSMA 1XWCA 3HVVA 3GMFA 3US3A 2O7KA 2PU9C 1U6TA 2WULA 2MBSA 4I97A 4EE0A 2ALBA 4BWQA 1A24A 5DAKA 4V1Ap 5ECOB 1PX7A 7GSSA 4AGSA 4TR1B 4GSTA 5FT3A 1T4ZA 5HR0A 5F8BA 1SVOA 3FK8A 1M9AA 2EIQA 5HFIA 2X49A 1A2MA 3J7Yb 1VF1A 3M8NA 2H6YA 2A4HA 3IC4A 1WWJA 1URMA 3SBCA 3F3RA 3EMPA 5A4UA 1FB6A 4PNGA 2LSTA 2GGTA 1OVNA 4PUAA 5CAXA 4O5QA 1E2YA 4LMVA 1PN9A 1YJ6A 1MDJA 3FZ5A 2XPDA 18GSA 3CXGA 1T4YA 4P3YB 2LNSA 2IFQB 3D0ZA 5COHA 2XHFA 4HS1A 2GSRA 1B4QA 2EFCA 1A0FA 2VCVA 4AF2A 5BMUB 2VOCA 3PPUA 3EYTA 3C8EA 2GSQA 1A2JA 5ABRA 4IP6A 1W89A 3U6VA 4TXOA 4XS4B 5DALA 5A5HB 4IKHA 4IS0A 2GSTA 2YV7A 3DD3A 4MJAA 2YZUA 4HZ2A 2H8LA 4LLRA 4EF0A 1XXUA 2B5YA 4NHZA 1XW6A 5DJLA 3A5WA 1GSEA 3GURA 3TUEA 3ZLPA 4NV5A 5DBQA 1X9WB 4D73A 4WBRD 4EL1A 2M80A 2REMA 4POBA 4MJEA 6GSWA 3APSA 1XOAA 4ZL8A 1EV4A 5CREA 3U5RE 3VWXA 1O85A 2VL2C 4A5PA 3P7XA 5IO0A 19GSA 4IHUA 2UZ8A 1FAAA 3KZQA 4FH8A 4FO5A 3KTBA 4BVXB 3W8SA 1ERTA 4W66A 3ZFLA 2H1BA 3IA1A 1WOUA 2DJ1A 3H93A 1YZXA 4I6XA 3F9UA 1GULA 4WBJA 4CY8A 2FWEA 4FYUA 2LJRA 4AJ7A 2GSSA 3LQ7A 9GSSA 1Z6MA 1QK8A 2HYXA 3UOMA 1NSWA 2HSMA 4K0GA 1BG1A 2V1MA 3GL5A 2ES7A 1M99A 4JEDA 4TRXA 5GZZB 4IJIA 2DMMA 3LSZA 2LQOA 1ABAA 4Z2RA 4E68A 3ISOA 2FNOA 4NXIA 4NAXA 2E2MA 5IOWA 4MK3A 1OC3A 2JZRA 2XPEA 1B9YC 5LNKe 5GSSA 3LG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6N A;  4PUF C;  2B5E A;  1HD2 A;  1ZYE A;  5J3R A;  3UVT A;  1ZZY A;  4BVY A;  1SYX A;  5KN1 A;  1AC1 A;  4F82 A;  2KOK A;  3L78 A;  5EPF A;  2H75 A;  4O92 A;  3R2Q A;  1X5E A;  3BCK A;  1JFU A;  4OWY A;  1K0D A;  1CQG A;  4J57 E;  1ZL9 A;  2LTK A;  4HU9 A;  2CT6 A;  3CMI A;  2CZ2 A;  1YEP A;  4F0C A;  2X8H A;  1V98 A;  1R4W A;  4GXZ A;  16GS A;  1AXD A;  2X8C A;  2LRT A;  1USB A;  3CTF A;  4JBB A;  4ISD A;  4X1U A;  2WS2 A;  3HY2 A;  3HVS A;  4MH2 A;  3PIN A;  4HJM A;  3BD2 A;  3Q6O A;  3GRX A;  2QSI A;  3Q74 A;  1SKS B;  2A2S A;  1XCC A;  2H66 A;  1JHB A;  3TKS C;  4BWS A;  4IVF A;  5DCH A;  4ZL7 A;  4MZW A;  10GS A;  4ZBB A;  4TR1 A;  4ECI A;  5CO3 A;  2FLS A;  3RHB A;  1XZO A;  3CTG A;  1J08 A;  2RLI A;  3WT2 A;  3P2A A;  4WET A;  3A2W A;  1AUC A;  1R7H A;  1EEJ A;  3QPM A;  1BED A;  4EVM A;  3VPQ A;  4L5O A;  4TR4 A;  4BA7 A;  4PUR A;  4JZQ A;  3QAW A;  1MEK A;  3UIW A;  5J5N A;  1K0O A;  3M0F A;  4V2M A;  1VRS D;  2E7P A;  2LJK A;  4N0V A;  2VL9 A;  4TW5 A;  1SL2 B;  2G0F A;  5A5K A;  1G7E A;  2O87 A;  5IOX A;  5BMU A;  1S3A A;  4RI7 A;  3A2V A;  5J41 A;  3W6G A;  2VCQ A;  1X9M B;  4IP1 A;  2AV4 A;  2PUK C;  1EV9 A;  5ECM B;  2V6K A;  3L9V A;  3VFI A;  2HNL A;  2PVQ A;  1DE2 A;  4XS4 A;  2P5Q A;  5IPH A;  2FA8 A;  4K7I A;  5H5S A;  1GL8 A;  1M7T A;  5ECN B;  2XBQ A;  1PD2 1;  2PMT A;  1TRS A;  2YAN A;  3F3Q A;  6GST A;  4KCE A;  1K0C A;  5IQY A;  1JZR A;  3VPT A;  3IE3 A;  3P8W A;  5CNW A;  4PQI A;  4WR5 A;  4G0I A;  4N10 A;  3ZML A;  1PKW A;  3KTL A;  3FR6 A;  2PN8 A;  1M2A A;  1FVJ A;  3RAZ A;  3LFL A;  2GVP A;  4GQF A;  1Z7P A;  3ZVJ A;  4YAV A;  1QMV A;  2VAF A;  1XWA A;  2OE0 A;  2OAC A;  5IIZ A;  3GA4 A;  2KP2 A;  4K7O A;  3IHQ A;  4BVX A;  2V32 A;  1F2E A;  3ZYW A;  1EGO A;  5F06 A;  1CQH A;  2O85 A;  3IBH A;  2IMI A;  4KDX A;  3M9J A;  1V9W A;  1SL0 B;  5CP1 A;  3UBL A;  2X8G A;  5FHI A;  1OYJ A;  3GFK A;  2FD3 A;  2IME A;  1O73 A;  4K7N A;  1U87 A;  1SYR A;  3HHV A;  5ID2 B;  2L6D A;  1XVQ A;  2VCZ A;  5DQS A;  1EEM A;  4EUY A;  1AW9 A;  4EO3 A;  1G7O A;  2JSY A;  2VIM A;  1R5A A;  3LGC A;  1H4O A;  2H76 A;  2HLS A;  3L0H A;  1GTU A;  2CX4 A;  3GUS A;  4ZBD A;  1GH2 A;  3ERF A;  5HFK A;  1AQW A;  2NTO A;  22GS A;  3TJJ A;  4IJ3 A;  3TOU A;  1QGV A;  2HI7 A;  4MJB A;  5IO2 A;  3G7J A;  1SEN A;  1VF3 A;  4HQS A;  3OR5 A;  3E9J B;  2HXK A;  1Z9H A;  5DDL A;  1XWG A;  4LA1 A;  8GSS A;  2A4V A;  2E2G A;  1X0R A;  3C1R A;  5IMZ A;  1GWC A;  4O7H A;  1TJD A;  1YKA A;  2VL2 A;  2J9H A;  1HYU A;  2L6C A;  2IN3 A;  3IDV A;  3FZ9 A;  1FO5 A;  3ZVJ D;  4AJ6 A;  4IEL A;  4KX4 A;  4ZB9 A;  5JCG A;  3F4S A;  4EXJ A;  2H73 A;  3CYN A;  3EUR A;  2WDU A;  1TI3 A;  1BQ7 A;  1XOB A;  3HKR A;  1EOH A;  2ZNM A;  1F9M A;  1JZD A;  1HNA A;  3Q19 A;  1ACV A;  1S3D A;  1ZCP A;  5EVO A;  3FEU A;  4GRF A;  5KN3 A;  1BG5 A;  1PGT A;  1XFL A;  5HR3 A;  2OA7 A;  1OC9 B;  5G30 A;  4IN0 A;  1TRW A;  5H5Q A;  5ENU A;  1K3Y A;  2YWO A;  2A2R A;  4NHW A;  1GLP A;  1F3B A;  6GSU A;  4TR3 A;  4MH3 A;  4I8B A;  1S3C A;  3VLN A;  3UEM A;  3QAV A;  3O6T A;  1XIY A;  2MMO A;  2H01 A;  12GS A;  2KP1 A;  3H4K A;  2FY6 A;  1GNW A;  2HFD A;  5KEJ A;  4J2F A;  1GTI A;  3IAM 2;  2NBS A;  3QDN A;  1RQM A;  1MDI A;  3M3M A;  1XVW A;  1MD3 A;  4JE1 A;  3I43 A;  4MPG A;  4ML6 A;  5INY A;  1JLW A;  3FZ4 A;  5JWO B;  2OE1 A;  2H6X A;  2HRK B;  1UVZ A;  1A0R P;  4K9Z A;  3KP9 A;  2B1K A;  1VGL A;  2DJJ A;  2PGT A;  1DSB A;  2VUP A;  4ACS A;  2GZY A;  1PL2 A;  3D22 A;  3AY8 A;  1FOV A;  2RUE A;  4XHM A;  2YWN A;  3LXT A;  3JCM L;  2YZH A;  1TW9 A;  2H70 A;  2B7J A;  4PNF A;  1GLQ A;  3TKS A;  2R3X A;  4USS A;  1UN2 A;  4G9H A;  1F3A A;  3GKX A;  3KH7 A;  5F07 A;  3TCO A;  2HQT A;  2KUC A;  2AB6 A;  4MP4 A;  1XWK A;  1ZGN A;  2H19 A;  4X43 A;  1LU4 A;  3IOS A;  2OKA A;  4FYC A;  2OBI A;  1PKZ A;  3O3T A;  2R5G A;  4XRD A;  3ZIT A;  2PBJ A;  2JAC A;  3PH9 A;  2PPT A;  4KSO A;  1JLV A;  2JZS A;  2VL3 A;  1O8W A;  1TK5 B;  1OC8 A;  1EP8 A;  3F6D A;  4V1A g;  1TOF A;  4KAE A;  5IMD A;  4CHS A;  3ZZX A;  2FGX A;  1R26 A;  2L5O A;  1TDI A;  3GKN A;  3GIX A;  2V41 A;  3KGK A;  2TIR A;  2XBI A;  2I4A A;  4HEA 2;  5AN1 A;  1HNC A;  3QD9 A;  3FZA A;  3GH9 A;  5ID2 A;  3F0I A;  5ECH B;  1AIU A;  5IM9 A;  3VK9 A;  2LNT A;  2YWI A;  20GS A;  2YJ7 A;  1XBS A;  4DEJ A;  3FRC A;  3LJR A;  3KMN A;  2HSN B;  3IK7 A;  4NWY A;  3GH6 A;  5EL8 A;  2C0G A;  2B7K A;  6GSS A;  4FIW A;  4RQX A;  3TJB A;  4ZXG A;  1V2A A;  3RPP A;  4MF7 A;  3HVX A;  4ZBA A;  3QOU A;  1XW5 A;  2VCW A;  3KXO A;  5A4V A;  1A23 A;  1TXX A;  4IGJ A;  4GLT A;  2F3M A;  2EC4 A;  4ZL9 A;  3TDG A;  5G2Z A;  1WJK A;  2H71 A;  2P31 A;  3ED3 A;  4K8M A;  1I9D A;  2N5B A;  1LJR A;  4MZC A;  1KNG A;  2YNX A;  2IMF A;  1WMJ A;  3MSZ A;  2JSZ A;  5ECI B;  3EWL A;  1OKT A;  2VCX A;  2GTU A;  2L5L A;  3P90 A;  2CVD A;  1GSU A;  5ECK B;  3H1N A;  2BMX A;  3LYP A;  2ON7 A;  4OFM A;  3HJM A;  1IYI A;  2HT9 A;  2LEG A;  4EC0 A;  2H30 A;  3HJP A;  4YQM A;  2G2Q A;  2DJ0 A;  3GV1 A;  2QKE A;  4F2I A;  1T7P B;  5H5R A;  2WCI A;  4V2N A;  2C3N A;  1GNE A;  5B6M A;  2PWJ A;  3HA9 A;  4KND A;  1B4P A;  3F63 A;  1OC9 A;  5IMA A;  1I5G A;  1Y25 A;  1GSF A;  3G9B A;  1UA5 A;  3D21 A;  2L4Q A;  4OMV A;  4K1F A;  2QGV A;  1GTB A;  4HU7 A;  2ZUP A;  4JR4 A;  4OD7 A;  5ECL B;  1PL1 A;  4E8H A;  1NW2 A;  1SJI A;  4N11 A;  4MPF A;  1KBN A;  1WE0 A;  1EGR A;  4POL A;  2WJU A;  5B7C A;  3GX8 A;  1ERV A;  3EMX A;  3F8U A;  1YEX A;  5B8B A;  5HQP A;  3IR4 A;  5CYY A;  1X9S B;  1EOG A;  1TK8 B;  3KMO A;  2N5A A;  2IFQ A;  2CA8 A;  4XS1 A;  2TRC P;  13GS A;  1DBY A;  4K0N A;  2HRK A;  4XS6 A;  4RQR A;  3CBU A;  2ZCT A;  4PX1 A;  1M2B A;  2C3T A;  2GT6 A;  4HJ2 A;  4WF4 A;  1GSS A;  2C0F A;  2RUF A;  4XRA A;  2VLU A;  3S9F A;  1F37 A;  4N30 A;  4MA9 A;  1XW9 A;  4PGT A;  4OO5 A;  2L57 A;  5KN0 A;  2YJH A;  4WXT A;  4GSS A;  4OFN A;  3I69 A;  1LBK A;  3UMA A;  3IPZ A;  3DVX A;  2B5X A;  2Z9S A;  1ML6 A;  1ST9 A;  3IV4 A;  5ECQ B;  2C1Y A;  4TR0 A;  1VF4 A;  1PRX A;  3KCM A;  2CV4 A;  1HQO A;  4E8E A;  5D8I A;  1O8X A;  1SKR B;  4OCF A;  2FWG A;  4ZB8 A;  1H75 A;  2QC7 A;  1VF2 A;  4F0B A;  3CSH A;  2CX3 A;  4XTS A;  3NIV A;  6GSY A;  1O81 A;  5DJM A;  2NPB A;  3D6I A;  2WB9 A;  3EC3 A;  1JZO A;  2LRN A;  1IYH A;  1YKC A;  2DC5 A;  4GTU A;  2HZF A;  2MBT A;  3CRU A;  2H6Z A;  2H0I A;  5AGY A;  3DKS A;  4HUA A;  4ZB6 A;  5D9T A;  5D9V A;  1GSY A;  4DSS B;  3DXB A;  4DSR A;  2FWH A;  2IMK A;  1NM3 A;  1FG4 A;  3HYP A;  2DJ2 A;  4KDU A;  3HJO A;  4YH2 A;  2YOI A;  4DVC A;  2C0E A;  2JAD A;  4BL7 B;  4GF0 A;  3TJF A;  1K3O A;  1N2A A;  1Q98 A;  4JRR A;  1M0U A;  4HZ4 A;  3VI7 A;  3TJK A;  4YQV A;  2B6M A;  5LD0 A;  1YDK A;  4KGI A;  1FHE A;  1TTZ A;  1DE1 A;  4AJ8 A;  2I9H A;  2RM5 A;  3KD0 A;  5F0G A;  1GRX A;  4GCI A;  1PQN A;  1TU8 A;  3MDK A;  5G1L A;  3NZN A;  4WEY A;  4PQ1 A;  3I6A A;  5J4U A;  3H8Q A;  1GUK A;  4HOJ A;  5LCZ A;  1XPV A;  2PVO C;  2HZE B;  3ERW A;  5FWG A;  3PR8 A;  4G10 A;  2H1D A;  1Z5Y E;  3EU4 A;  3QFB C;  2VLT A;  3C1S A;  5J9B A;  1AAZ A;  3M9K A;  2X64 A;  2E0Q A;  2J23 A;  3VWV A;  4OO4 A;  1ZMA A;  3LEF A;  3VWW A;  2CVB A;  4ULX A;  1OE8 A;  2KHP A;  2NVL A;  2CAQ A;  3RPN A;  2C80 A;  1AQV A;  3SWL A;  2DJ3 A;  3QFA C;  4RUV A;  2VD1 A;  3F4T A;  2AHE A;  1K0A A;  4TVE A;  4I5Q A;  2YP6 A;  1R5P A;  1TRV A;  3RHC A;  2FHE A;  1XWB A;  1QUW A;  5L71 A;  4IQ1 A;  2I81 A;  3C73 A;  4QL9 A;  3E3E A;  4TXV A;  5G5E A;  3L9U A;  2FCH A;  1GSQ A;  2HRN A;  2OBK A;  4O32 A;  4TKY A;  5ELA A;  1ERW A;  1SD9 A;  3CRT A;  2GT5 A;  4ID0 A;  1EP7 A;  4MCU A;  3ZL5 A;  4WF5 A;  2VCT A;  3VUR A;  3TJG A;  1ON4 A;  2VO4 A;  3HZ8 A;  5D9X A;  5ECP B;  5IMC A;  2GLR A;  6GSX A;  3WGE A;  2V2G A;  1WIK A;  4L0W A;  1K0B A;  2BTO T;  3CSI A;  5CRD A;  3WD6 A;  1NHO A;  2GS3 A;  2H0H A;  3C71 A;  4TOP A;  3DEX A;  4ILF A;  3ZRE A;  1TK0 B;  5IMF A;  2XC2 A;  3RDW A;  3EU3 A;  3D4M A;  1SJZ A;  3APQ A;  3TRP A;  2GQM A;  1TRU A;  5C04 A;  2MMA A;  2K6V A;  5HR1 A;  4QL7 A;  1BAY A;  3FYG A;  2DIZ A;  3GYK A;  3A2X A;  2I3Y A;  1TI1 A;  4KA0 A;  2MZC A;  1A8L A;  2FA4 A;  1YF0 A;  4I2T A;  4CDO A;  1A8Y A;  1Y6E A;  4YQU A;  1J0F A;  2DML A;  3DGQ A;  2M72 A;  2WGR A;  4MLY A;  4JR6 A;  2LUS A;  1W4V A;  3N9J A;  1PX6 A;  1TP9 A;  5GST A;  1X5D A;  5GAP D;  3QMX A;  3ZMK A;  1KEB A;  2O89 A;  3QCP A;  2OAD A;  3UJ1 A;  2F9S A;  4YAP A;  5ECR B;  1QQ2 A;  5G5F A;  3FW2 A;  2GZP A;  3DWV A;  4G2E A;  2M46 A;  2YV9 A;  1M2D A;  4G0K A;  1O7U A;  4GWR A;  2KLX A;  1WRY A;  4H86 A;  1ZOF A;  2ON5 A;  1MDK A;  1G0T A;  1G6Y A;  2HSH A;  2LRC A;  2B3S A;  3CSJ A;  2K8S A;  17GS A;  2FWF A;  3UAR A;  3WT1 A;  3KH9 A;  2GQL A;  1J9B A;  4NV2 A;  4KE3 A;  4IQA A;  4DSS A;  3N5O A;  2JU5 A;  1YQ1 A;  5C00 A;  4MF5 A;  3IRA A;  3EVI A;  4I2U A;  3C7M A;  3HCZ A;  1T00 A;  2OJL A;  1GUM A;  2AUV A;  3IAS 2;  4BL7 A;  2R4V A;  3TKS E;  1PMT A;  4TN8 A;  3L4N A;  3EE2 A;  1YY7 A;  1GP1 A;  3TKQ A;  2VM1 A;  3KIJ A;  2C8U A;  4KH7 A;  2K18 A;  5J9C A;  1SU9 A;  3RBT A;  3VWU A;  2JL4 A;  1SD8 A;  2D2Z A;  2F8F A;  11GS A;  3ZTL A;  4HI7 A;  1BX9 A;  4HDE A;  2JZT A;  4NPB A;  2WRT A;  2R2J A;  3FHK A;  3WGX A;  5A4W A;  2TRX A;  5JCW A;  5D9W A;  3MNG A;  1F6M C;  3GTU B;  4KUN A;  1BYE A;  2VM2 A;  4MZB A;  3NOF A;  3BJ5 A;  2B1L A;  3KEB A;  5B6N A;  3M1G A;  3GHA A;  1HNB A;  2HZE A;  3UL3 A;  4O5R A;  3PGT A;  4PQH A;  2K8V A;  5E4W A;  4XIH A;  4Z7X A;  4QQ7 A;  1U3I A;  4LL4 B;  2P5R A;  4POK A;  5DQY A;  3TGZ A;  1QXH A;  2WZ9 A;  4IW9 A;  1RW1 A;  2R6K A;  5G31 A;  3GKK A;  2YWM A;  5ELG A;  2DBC A;  3HDC A;  2GQK A;  2H72 A;  2HRF A;  4N0Z A;  2MYG A;  4KDY A;  4DSQ A;  2CVK A;  6GSV A;  3FR9 A;  4CW9 A;  4ECB A;  3BOA A;  1Q4J A;  4LL1 B;  3QR6 A;  5DAK B;  1MTC A;  2P0G A;  3G7Y A;  5JWQ B;  1AQX A;  5DVB A;  5CRG A;  3GL3 A;  3W8J A;  3DML A;  2K9F A;  4FYB A;  1SK2 A;  3ERG A;  1MD4 A;  2YN1 A;  2AJQ B;  3UVH A;  2O8V B;  3TKR A;  1T3B A;  3DIE A;  2I1U A;  3D4T A;  2RII A;  2X99 A;  4MMM A;  4EDY A;  2LS5 A;  1V58 A;  2WFC A;  4G0L A;  1JZW A;  2IIY A;  3R3E A;  3L9S A;  4BPY A;  4KB3 A;  1OE7 A;  1OAZ A;  3FY7 A;  5JWR B;  2CAI A;  1WP0 A;  4F9Z A;  3DVW A;  2IJY A;  1SL1 B;  2GZZ A;  3G7I A;  3HZ4 A;  3F4R A;  3ZIJ A;  3HD5 A;  1FVK A;  2MMN A;  3KM6 A;  3FKF A;  3H79 A;  2F51 A;  1QFN A;  1YF1 A;  1K3L A;  1PSQ A;  4GQC A;  4ML1 A;  1Z7R A;  1U88 A;  5D96 A;  4NMU A;  1B8X A;  1B9X C;  1E6B A;  1FW1 A;  1SK1 A;  4POM A;  5CRH A;  2OE3 A;  3UAP A;  2L59 A;  3APO A;  4PTS A;  3MWH A;  3LWA A;  1X5C A;  3J7Y k;  3ME7 A;  4TXO B;  5EY6 A;  5DAL B;  3D5J A;  4XCS A;  5KN2 A;  3HXS A;  3WGD A;  2H1A A;  3GNJ A;  4WR4 A;  1A2L A;  4OCE A;  4MAB A;  1GUH A;  4EDZ A;  3ME8 A;  1GTA A;  2LKU A;  3A3T A;  3BCI A;  2RM6 A;  1OKD A;  4K6X A;  5AIX A;  3GSS A;  4D73 B;  2PER A;  1SKW B;  4L5L A;  4Q5F A;  4KCA A;  1T8E B;  4KW6 A;  2N5F A;  3VI5 A;  4Q5R A;  5D93 A;  4HQZ A;  2LJA A;  3E0U A;  3ZIV A;  4MDC A;  5AIS A;  2MMZ A;  2F8A A;  3K8N A;  5HR2 A;  1SJ6 A;  4Q5N A;  5B8A A;  3GX0 A;  1PA3 A;  4OFT A;  2DLX A;  3TRQ A;  4L8E A;  1EWX A;  1SK0 A;  5DCG A;  1Z3E A;  2CZ3 A;  4PXO A;  4L0U A;  4X0X A;  1BJX A;  4MJC A;  4JU5 A;  4V2L A;  4EKZ A;  2AYT A;  2C4J A;  1THO A;  2YCD A;  2FUG 2;  1TKD B;  14GS A;  1KTE A;  3FR3 A;  3GST A;  3TKP A;  3ZRD A;  5JCU A;  3KP8 A;  3WYW A;  2HSM B;  1G6W A;  1C72 A;  4ZIJ A;  4IBP A;  4LMW A;  1EZK A;  5GAN D;  5CRW A;  4F03 A;  2H74 A;  3Q18 A;  2EIO A;  4ZIL A;  3ZFB A;  2HRA A;  2VD0 A;  3LXZ A;  1TU7 A;  4RI6 A;  3LYK A;  2NDO A;  1FB0 A;  5F05 A;  3TRX A;  2HE3 A;  1DUG A;  1THX A;  2V6O A;  1V40 A;  3GKM A;  4BVY B;  2R37 A;  4J56 E;  1T1V A;  2LV3 A;  4WKW A;  4Q5Q A;  3TOT A;  1U3A A;  3LOR A;  5E59 A;  3IXR A;  1N8J A;  2VLV A;  2YPM A;  2EIR A;  2HSY A;  4GSN A;  2IWT A;  3QAG A;  3GTU A;  5IPG A;  3EIN A;  2GDR A;  1UC7 A;  3I9V 2;  2BJX A;  4MF6 A;  4ECC A;  1O6J A;  3BBY A;  1B48 A;  5IMV A;  2C0D A;  1ZYQ B;  1K0N A;  3MAK A;  3TB2 A;  2IMD A;  2H1G A;  3F6F A;  5ECS A;  2DIY A;  3KJY A;  2AAW A;  2CQ9 A;  4G19 A;  1ILO A;  1RK4 A;  1NHY A;  2IL3 A;  4KF9 A;  2DJK A;  3DYR A;  4FQU A;  2IPA A;  3IK9 A;  3O76 A;  1WPI A;  5G1K A;  1K0M A;  1M9B A;  5D73 A;  3IC8 A;  1ERU A;  2H0G A;  2LQQ A;  2DSA A;  3GN3 A;  4K2D A;  3UBK A;  2L4C A;  4ECJ A;  2C3Q A;  1GSD A;  5AIV A;  5HFG A;  1V57 A;  3V1W A;  3DRN A;  4KSM A;  1XWC A;  3HVV A;  3GMF A;  3US3 A;  2O7K A;  2PU9 C;  1U6T A;  2WUL A;  2MBS A;  4I97 A;  4EE0 A;  2ALB A;  4BWQ A;  1A24 A;  5DAK A;  4V1A p;  5ECO B;  1PX7 A;  7GSS A;  4AGS A;  4TR1 B;  4GST A;  5FT3 A;  1T4Z A;  5HR0 A;  5F8B A;  3FK8 A;  1M9A A;  2EIQ A;  5HFI A;  1A2M A;  3J7Y b;  1VF1 A;  3M8N A;  2H6Y A;  3IC4 A;  1WWJ A;  1URM A;  3SBC A;  3F3R A;  3EMP A;  5A4U A;  1FB6 A;  4PNG A;  2LST A;  2GGT A;  1OVN A;  4PUA A;  5CAX A;  1E2Y A;  4LMV A;  1PN9 A;  1YJ6 A;  1MDJ A;  3FZ5 A;  2XPD A;  18GS A;  3CXG A;  1T4Y A;  4P3Y B;  2LNS A;  2IFQ B;  3D0Z A;  5COH A;  2XHF A;  4HS1 A;  2GSR A;  1B4Q A;  1A0F A;  2VCV A;  4AF2 A;  2VOC A;  3PPU A;  3EYT A;  3C8E A;  2GSQ A;  1A2J A;  5ABR A;  4IP6 A;  1W89 A;  3U6V A;  4TXO A;  4XS4 B;  5DAL A;  4IKH A;  4IS0 A;  2GST A;  2YV7 A;  3DD3 A;  4MJA A;  2YZU A;  4HZ2 A;  2H8L A;  4LLR A;  4EF0 A;  1XXU A;  2B5Y A;  4NHZ A;  1XW6 A;  5DJL A;  3A5W A;  1GSE A;  3GUR A;  3TUE A;  3ZLP A;  4NV5 A;  5DBQ A;  1X9W B;  4D73 A;  4WBR D;  4EL1 A;  2M80 A;  2REM A;  4POB A;  4MJE A;  6GSW A;  3APS A;  1XOA A;  4ZL8 A;  1EV4 A;  5CRE A;  3U5R E;  3VWX A;  1O85 A;  2VL2 C;  3P7X A;  5IO0 A;  19GS A;  4IHU A;  2UZ8 A;  1FAA A;  3KZQ A;  4FH8 A;  4FO5 A;  3KTB A;  4BVX B;  3W8S A;  1ERT A;  3ZFL A;  2H1B A;  1WOU A;  3IA1 A;  2DJ1 A;  3H93 A;  1YZX A;  4I6X A;  3F9U A;  1GUL A;  4WBJ A;  2FWE A;  4FYU A;  2LJR A;  4AJ7 A;  2GSS A;  3LQ7 A;  9GSS A;  1Z6M A;  1QK8 A;  2HYX A;  3UOM A;  1NSW A;  2HSM A;  4K0G A;  2V1M A;  3GL5 A;  2ES7 A;  1M99 A;  4JED A;  4TRX A;  5GZZ B;  4IJI A;  2DMM A;  3LSZ A;  2LQO A;  1ABA A;  3ISO A;  2FNO A;  4NXI A;  4NAX A;  2E2M A;  5IOW A;  4MK3 A;  1OC3 A;  2JZR A;  2XPE A;  1B9Y C;  5LNK e;  5GSS A;  3LG6 A; 
#chains in the Genus database with same CATH topology
 1Z6N A;  4PUF C;  2B5E A;  1HD2 A;  1ZYE A;  5J3R A;  3UVT A;  1ZZY A;  4BVY A;  2WVX B;  1SYX A;  5KN1 A;  1AC1 A;  4F82 A;  2KOK A;  4QMK A;  3L78 A;  5EPF A;  2H75 A;  4O92 A;  3R2Q A;  1X5E A;  3BCK A;  1JFU A;  4OWY A;  1K0D A;  1CQG A;  4J57 E;  1ZL9 A;  4AKH A;  2LTK A;  4HU9 A;  2CT6 A;  3CMI A;  2H1L A;  2CZ2 A;  1YEP A;  4F0C A;  2X8H A;  1V98 A;  1R4W A;  4GXZ A;  16GS A;  1AXD A;  4MNN A;  2X8C A;  2LRT A;  1USB A;  3CTF A;  4JBB A;  4ISD A;  4X1U A;  2WS2 A;  3HY2 A;  3HVS A;  4MH2 A;  3PIN A;  4HJM A;  3BD2 A;  3Q6O A;  3GRX A;  2DKI A;  2QSI A;  3Q74 A;  1SKS B;  2A2S A;  1XCC A;  2H66 A;  1JHB A;  3TKS C;  4BWS A;  4IVF A;  5DCH A;  4ZL7 A;  4MZW A;  10GS A;  2WW0 A;  4ZBB A;  4TR1 A;  4ECI A;  5CO3 A;  2FLS A;  3RHB A;  1XZO A;  3CTG A;  1J08 A;  2RLI A;  3WT2 A;  3P2A A;  4WET A;  3A2W A;  1AUC A;  1R7H A;  2QA2 A;  1EEJ A;  3QPM A;  1BED A;  4EVM A;  3VPQ A;  4L5O A;  4TR4 A;  4BA7 A;  4PUR A;  4ICY A;  4JZQ A;  3QAW A;  1MEK A;  3UIW A;  5J5N A;  1K0O A;  3M0F A;  4V2M A;  1VRS D;  4FXY P;  2E7P A;  2LJK A;  4N0V A;  2VL9 A;  4TW5 A;  4AI6 A;  1TXU A;  1SL2 B;  2G0F A;  5A5K A;  1G7E A;  2O87 A;  5IOX A;  5BMU A;  1S3A A;  4RI7 A;  3A2V A;  5J41 A;  3W6G A;  2VCQ A;  1X9M B;  4IP1 A;  2AV4 A;  2PUK C;  1EV9 A;  5ECM B;  2V6K A;  3L9V A;  3VFI A;  2HNL A;  2PVQ A;  1DE2 A;  4XS4 A;  2P5Q A;  5IPH A;  2FA8 A;  4K7I A;  5H5S A;  1GL8 A;  1M7T A;  5ECN B;  2O5V A;  3RGB C;  1PD2 1;  2PMT A;  2XBQ A;  1TRS A;  2YAN A;  3F3Q A;  6GST A;  1K0C A;  4KCE A;  5IQY A;  1JZR A;  3VPT A;  3IE3 A;  3P8W A;  5CNW A;  4PQI A;  4WR5 A;  4G0I A;  4N10 A;  3ZML A;  1PKW A;  3KTL A;  1ZYP A;  3FR6 A;  2PN8 A;  1M2A A;  1FVJ A;  3RAZ A;  3LFL A;  1M3J A;  2GVP A;  4GQF A;  1Z7P A;  3ZVJ A;  4YAV A;  1QMV A;  2VAF A;  4O5U A;  1XWA A;  2OE0 A;  2OAC A;  5IIZ A;  4PI2 C;  3GA4 A;  2KP2 A;  4K7O A;  3IHQ A;  4BVX A;  2V32 A;  1F2E A;  3ZYW A;  1EGO A;  5F06 A;  1CQH A;  1SVM A;  2O85 A;  3IBH A;  2IMI A;  4KDX A;  3M9J A;  1V9W A;  1SL0 B;  5CP1 A;  3UBL A;  2X8G A;  5FHI A;  1OYJ A;  3GFK A;  4K5R A;  2FD3 A;  2IME A;  1O73 A;  4K7N A;  1U87 A;  1SYR A;  3HHV A;  5ID2 B;  4PI0 C;  2L6D A;  1XVQ A;  2VCZ A;  5DQS A;  1EEM A;  4EUY A;  1AW9 A;  4EO3 A;  1G7O A;  2JSY A;  2VIM A;  1R5A A;  3LGC A;  5KOW A;  1H4O A;  2H76 A;  2HLS A;  3L0H A;  1GTU A;  2CX4 A;  3GUS A;  4ZBD A;  1GH2 A;  3ERF A;  5HFK A;  1AQW A;  2NTO A;  22GS A;  3TJJ A;  4IJ3 A;  3TOU A;  1QGV A;  2HI7 A;  4MJB A;  5IO2 A;  3G7J A;  1SEN A;  1VF3 A;  4HQS A;  3OR5 A;  3E9J B;  2HXK A;  1Z9H A;  5DDL A;  1XWG A;  4LA1 A;  2WVX A;  8GSS A;  2A4V A;  2E2G A;  1X0R A;  3C1R A;  5IMZ A;  1GWC A;  4O7H A;  3IHG A;  1TJD A;  1YKA A;  2VL2 A;  2J9H A;  1HYU A;  2L6C A;  2IN3 A;  3IDV A;  3FZ9 A;  1FO5 A;  3ZVJ D;  4AJ6 A;  4IEL A;  4KX4 A;  4ZB9 A;  5JCG A;  3F4S A;  4EXJ A;  2H73 A;  3CYN A;  3EUR A;  2WDU A;  1TI3 A;  1BQ7 A;  1XOB A;  3HKR A;  1EOH A;  2ZNM A;  1F9M A;  3FMW A;  4YKF A;  1JZD A;  1HNA A;  3Q19 A;  1ACV A;  1S3D A;  1ZCP A;  5EVO A;  3FEU A;  4GRF A;  5KN3 A;  1BG5 A;  2R0G A;  1PGT A;  1XFL A;  5HR3 A;  2OA7 A;  1OC9 B;  5G30 A;  4IN0 A;  4AKX B;  1TRW A;  4AKG A;  5H5Q A;  5ENU A;  1K3Y A;  2YWO A;  2A2R A;  4NHW A;  2UV8 G;  1GLP A;  1F3B A;  6GSU A;  5A1N A;  4TR3 A;  4MH3 A;  4I8B A;  1S3C A;  3VLN A;  3UEM A;  3QAV A;  4K5S A;  3O6T A;  1XIY A;  2MMO A;  2EFH A;  2H01 A;  12GS A;  2KP1 A;  2O36 A;  3H4K A;  2FY6 A;  1GNW A;  2HFD A;  5KEJ A;  4J2F A;  1GTI A;  3IAM 2;  3MYD A;  2NBS A;  3QDN A;  1RQM A;  1MDI A;  3M3M A;  1XVW A;  1MD3 A;  4JE1 A;  3I43 A;  4MPG A;  4ML6 A;  5INY A;  1JLW A;  3FZ4 A;  5JWO B;  2OE1 A;  2H6X A;  2HRK B;  1UVZ A;  1A0R P;  4K9Z A;  3KP9 A;  2B1K A;  1VGL A;  2DJJ A;  2PGT A;  1DSB A;  2VUP A;  4ACS A;  2GZY A;  1PL2 A;  3D22 A;  3AY8 A;  1FOV A;  2RUE A;  4XHM A;  2YWN A;  3LXT A;  3JCM L;  2YZH A;  3EPT A;  1TW9 A;  2H70 A;  2B7J A;  4PNF A;  1GLQ A;  3TKS A;  2R3X A;  4USS A;  5J40 A;  1UN2 A;  4G9H A;  1F3A A;  3GKX A;  3KH7 A;  5F07 A;  3TCO A;  2HQT A;  4BIK A;  2KUC A;  2AB6 A;  4MP4 A;  1XWK A;  1ZGN A;  2H19 A;  4X43 A;  1LU4 A;  3IOS A;  2OKA A;  4FYC A;  2OBI A;  1PKZ A;  3O3T A;  2R5G A;  4XRD A;  3ZIT A;  2PBJ A;  2JAC A;  1YVL A;  3PH9 A;  2PPT A;  4KSO A;  1JLV A;  2JZS A;  2VL3 A;  1O8W A;  1TK5 B;  1OC8 A;  1EP8 A;  3F6D A;  2WW1 A;  4V1A g;  1TOF A;  4KAE A;  5IMD A;  4Z2U A;  4CHS A;  3ZZX A;  2FGX A;  1R26 A;  3CWG A;  2L5O A;  1TDI A;  3GKN A;  3GIX A;  2V41 A;  3KGK A;  2TIR A;  2XBI A;  2I4A A;  4HEA 2;  5AN1 A;  1HNC A;  3QD9 A;  3FZA A;  3GH9 A;  5ID2 A;  3F0I A;  5ECH B;  1AIU A;  5IM9 A;  3VK9 A;  2LNT A;  2YWI A;  20GS A;  2YJ7 A;  1XBS A;  4DEJ A;  3FRC A;  3LJR A;  3KMN A;  2HSN B;  3IK7 A;  4NWY A;  3GH6 A;  5EL8 A;  2C0G A;  2B7K A;  6GSS A;  4FIW A;  4RQX A;  3TJB A;  4ZXG A;  1V2A A;  3RPP A;  4MF7 A;  3HVX A;  4ZBA A;  3QOU A;  1XW5 A;  2VCW A;  3KXO A;  5A4V A;  3RFR C;  1A23 A;  2QA1 A;  1TXX A;  4IGJ A;  4GLT A;  2F3M A;  2EC4 A;  4ZL9 A;  3TDG A;  5G2Z A;  1WJK A;  2H71 A;  2P31 A;  3ED3 A;  4K8M A;  1I9D A;  2N5B A;  1LJR A;  4MZC A;  1KNG A;  2YNX A;  2IMF A;  1WMJ A;  3MSZ A;  2JSZ A;  5ECI B;  3EWL A;  1OKT A;  2VCX A;  4YKG A;  2GTU A;  2L5L A;  3P90 A;  2CVD A;  1GSU A;  5ECK B;  3H1N A;  2BMX A;  3LYP A;  2ON7 A;  4OFM A;  3HJM A;  1IYI A;  2HT9 A;  2LEG A;  4EC0 A;  2H30 A;  3HJP A;  2X4A A;  4YQM A;  2G2Q A;  2DJ0 A;  3GV1 A;  2QKE A;  4F2I A;  1T7P B;  5H5R A;  2WCI A;  4V2N A;  2C3N A;  1GNE A;  5B6M A;  2PWJ A;  3HA9 A;  4KND A;  1B4P A;  3F63 A;  1OC9 A;  5IMA A;  1I5G A;  1Y25 A;  1GSF A;  3G9B A;  1UA5 A;  3D21 A;  2L4Q A;  4OMV A;  4K1F A;  2VKZ G;  2QGV A;  1GTB A;  4HU7 A;  2ZUP A;  4JR4 A;  4OD7 A;  5ECL B;  1PL1 A;  4E8H A;  1NW2 A;  1SJI A;  4N11 A;  4MPF A;  1KBN A;  1WE0 A;  1EGR A;  4POL A;  2WJU A;  5B7C A;  3GX8 A;  1ERV A;  3EMX A;  3F8U A;  1YEX A;  4K2X A;  5B8B A;  5HQP A;  3IR4 A;  1ZYN A;  5CYY A;  1X9S B;  1EOG A;  1TK8 B;  3KMO A;  2N5A A;  2IFQ A;  2CA8 A;  4XS1 A;  2TRC P;  13GS A;  1DBY A;  4K0N A;  2HRK A;  4XS6 A;  4RQR A;  3CBU A;  2ZCT A;  4PX1 A;  1M2B A;  2C3T A;  2GT6 A;  4HJ2 A;  4WF4 A;  1GSS A;  2C0F A;  2RUF A;  4XRA A;  2VLU A;  5A5H A;  3S9F A;  1F37 A;  4N30 A;  4MA9 A;  1XW9 A;  4PGT A;  4OO5 A;  2L57 A;  5KN0 A;  2YJH A;  4WXT A;  4GSS A;  4OFN A;  3I69 A;  1LBK A;  3UMA A;  3IPZ A;  3DVX A;  2B5X A;  2Z9S A;  1ML6 A;  1ST9 A;  3IV4 A;  5ECQ B;  2C1Y A;  4TR0 A;  1VF4 A;  1PRX A;  3KCM A;  2CV4 A;  1HQO A;  4E8E A;  5D8I A;  1O8X A;  1SKR B;  4OCF A;  2FWG A;  4ZB8 A;  1H75 A;  2QC7 A;  1VF2 A;  4F0B A;  3CSH A;  2CX3 A;  4XTS A;  3NIV A;  6GSY A;  1O81 A;  5DJM A;  2NPB A;  5A34 B;  3D6I A;  2WB9 A;  3EC3 A;  1JZO A;  2LRN A;  1IYH A;  1YKC A;  2DC5 A;  4GTU A;  2HZF A;  2MBT A;  3CRU A;  2H6Z A;  2H0I A;  5AGY A;  3DKS A;  4HUA A;  4G01 A;  4ZB6 A;  5D9T A;  5D9V A;  1GSY A;  4DSS B;  3DXB A;  4DSR A;  2FWH A;  2IMK A;  1NM3 A;  1FG4 A;  3HYP A;  2DJ2 A;  4KDU A;  3HJO A;  4YH2 A;  2YOI A;  4DVC A;  2C0E A;  2JAD A;  4BL7 B;  4GF0 A;  3TJF A;  1K3O A;  1N2A A;  1Q98 A;  4JRR A;  2HSN A;  1M0U A;  4HZ4 A;  3VI7 A;  3TJK A;  4YQV A;  2B6M A;  5LD0 A;  1YDK A;  4KGI A;  1FHE A;  1TTZ A;  1DE1 A;  4AJ8 A;  2I9H A;  2RM5 A;  3KD0 A;  5F0G A;  1GRX A;  4GCI A;  1PQN A;  1TU8 A;  3MDK A;  1M3I A;  5G1L A;  3NZN A;  4WEY A;  4PQ1 A;  3I6A A;  5J4U A;  3H8Q A;  1GUK A;  4HOJ A;  5LCZ A;  4ZB7 A;  1XPV A;  2PVO C;  2HZE B;  3ERW A;  2EFD A;  5FWG A;  3PR8 A;  4G10 A;  4GDF A;  2H1D A;  1Z5Y E;  2R0P A;  3EU4 A;  3QFB C;  2VLT A;  3C1S A;  5J9B A;  1AAZ A;  3M9K A;  2X64 A;  2E0Q A;  2J23 A;  3VWV A;  4OO4 A;  1ZMA A;  3LEF A;  1PN0 A;  3VWW A;  2CVB A;  4ULX A;  1OE8 A;  2KHP A;  2NVL A;  2CAQ A;  3RPN A;  2C80 A;  1AQV A;  3SWL A;  1FOH A;  2DJ3 A;  3QFA C;  4RUV A;  2VD1 A;  3F4T A;  2AHE A;  1K0A A;  4TVE A;  4I5Q A;  2YP6 A;  1R5P A;  1TRV A;  3RHC A;  2FHE A;  1XWB A;  1QUW A;  5L71 A;  4IQ1 A;  2I81 A;  3C73 A;  4QL9 A;  3E3E A;  4TXV A;  5G5E A;  3L9U A;  2FCH A;  1GSQ A;  2HRN A;  2OBK A;  4O32 A;  4TKY A;  5ELA A;  1ERW A;  1SD9 A;  3CRT A;  2GT5 A;  4ID0 A;  1EP7 A;  4MCU A;  3ZL5 A;  4WF5 A;  2VCT A;  3VUR A;  3TJG A;  1ON4 A;  2VO4 A;  3HZ8 A;  5D9X A;  5ECP B;  5IMC A;  1Y1U A;  2GLR A;  6GSX A;  3WGE A;  2V2G A;  1WIK A;  4L0W A;  1K0B A;  2BTO T;  3CSI A;  5CRD A;  3WD6 A;  1NHO A;  2GS3 A;  2H0H A;  3C71 A;  4TOP A;  3DEX A;  4ILF A;  3ZRE A;  4CY6 A;  1TK0 B;  5IMF A;  2XC2 A;  3RDW A;  3EU3 A;  3D4M A;  1SJZ A;  3APQ A;  3TRP A;  2GQM A;  1TRU A;  5C04 A;  2MMA A;  2K6V A;  5HR1 A;  2WVY A;  4QL7 A;  1BAY A;  3FYG A;  2DIZ A;  3GYK A;  3A2X A;  2I3Y A;  1TI1 A;  5J4V A;  4KA0 A;  2MZC A;  1A8L A;  2FA4 A;  1YF0 A;  4I2T A;  4CDO A;  3CHX C;  1A8Y A;  1Y6E A;  4YQU A;  1J0F A;  2DML A;  3DGQ A;  2M72 A;  2WGR A;  4MLY A;  4JR6 A;  2LUS A;  3TU3 B;  1W4V A;  3N9J A;  1PX6 A;  1TP9 A;  5GST A;  1X5D A;  5GAP D;  3QMX A;  3ZMK A;  1KEB A;  2O89 A;  3QCP A;  2OAD A;  3UJ1 A;  2F9S A;  4YAP A;  5ECR B;  1QQ2 A;  5G5F A;  3FW2 A;  2GZP A;  3DWV A;  4G2E A;  2M46 A;  2YV9 A;  1M2D A;  1N25 A;  4G0K A;  5J47 A;  1O7U A;  4N3Z A;  4GWR A;  2KLX A;  1WRY A;  4H86 A;  1ZOF A;  2ON5 A;  1MDK A;  5A34 A;  1G0T A;  1G6Y A;  2HSH A;  2LRC A;  2B3S A;  3CSJ A;  2K8S A;  17GS A;  2FWF A;  3UAR A;  3WT1 A;  4AKI A;  3KH9 A;  2GQL A;  1J9B A;  4NV2 A;  4KE3 A;  4IQA A;  4DSS A;  3N5O A;  2JU5 A;  1YQ1 A;  5C00 A;  4MF5 A;  3IRA A;  2O3E A;  3EVI A;  4I2U A;  3C7M A;  1S3R A;  3HCZ A;  1T00 A;  2OJL A;  1GUM A;  2AUV A;  3IAS 2;  4BL7 A;  2R4V A;  1BF5 A;  3TKS E;  1PMT A;  4TN8 A;  3L4N A;  3EE2 A;  1YY7 A;  1GP1 A;  3TKQ A;  2VM1 A;  3KIJ A;  2C8U A;  4KH7 A;  2K18 A;  5J9C A;  1SU9 A;  3RBT A;  3VWU A;  2JL4 A;  1SD8 A;  2D2Z A;  2F8F A;  11GS A;  3ZTL A;  4HI7 A;  1SVL A;  1BX9 A;  4HDE A;  2JZT A;  4NPB A;  2WRT A;  2R2J A;  3FHK A;  3WGX A;  5A4W A;  2TRX A;  5JCW A;  5D9W A;  3MNG A;  1F6M C;  3GTU B;  4KUN A;  1BYE A;  2VM2 A;  4MZB A;  3NOF A;  3BJ5 A;  2B1L A;  3KEB A;  5B6N A;  3M1G A;  3GHA A;  1HNB A;  2HZE A;  3UL3 A;  4O5R A;  3PGT A;  4PQH A;  2K8V A;  5E4W A;  4XIH A;  2WVZ A;  4Z7X A;  4QQ7 A;  1U3I A;  1XG8 A;  4LL4 B;  2P5R A;  4POK A;  5DQY A;  3TGZ A;  1QXH A;  2WZ9 A;  4IW9 A;  4X4J A;  1RW1 A;  2R6K A;  5G31 A;  3GKK A;  2YWM A;  5ELG A;  2DBC A;  3HMJ G;  3HDC A;  2GQK A;  2H72 A;  2HRF A;  4N0Z A;  2MYG A;  4KDY A;  4DSQ A;  2CVK A;  6GSV A;  3FR9 A;  4CW9 A;  4EIP A;  2OT3 A;  4ECB A;  3A5I A;  3BOA A;  1Q4J A;  4LL1 B;  3QR6 A;  5DAK B;  1MTC A;  2P0G A;  3G7Y A;  5JWQ B;  1AQX A;  5DVB A;  5CRG A;  3GL3 A;  3W8J A;  3DML A;  2K9F A;  4FYB A;  1SK2 A;  3ERG A;  1MD4 A;  2YN1 A;  2AJQ B;  3UVH A;  3LW9 A;  2O8V B;  5A1N B;  3TKR A;  1T3B A;  3DIE A;  2I1U A;  3D4T A;  1I1I P;  2RII A;  2X99 A;  4MMM A;  4EDY A;  2LS5 A;  1V58 A;  2WFC A;  4G0L A;  1JZW A;  2IIY A;  3HVN A;  3R3E A;  3L9S A;  4BPY A;  4KB3 A;  1OE7 A;  1OAZ A;  3FY7 A;  5JWR B;  2CAI A;  1WP0 A;  4F9Z A;  3DVW A;  2IJY A;  1SL1 B;  2GZZ A;  3G7I A;  3HZ4 A;  3F4R A;  3ZIJ A;  3HD5 A;  1FVK A;  2MMN A;  3KM6 A;  3FKF A;  3H79 A;  2F51 A;  1QFN A;  1YF1 A;  1K3L A;  1PSQ A;  4GQC A;  4ML1 A;  1Z7R A;  2R0C A;  4Z2T A;  1U88 A;  5D96 A;  4NMU A;  1B8X A;  1B9X C;  1E6B A;  1FW1 A;  1SK1 A;  4POM A;  3MIX A;  5CRH A;  2OE3 A;  3UAP A;  2L59 A;  3APO A;  4PTS A;  3MWH A;  3LWA A;  1X5C A;  3J7Y k;  3ME7 A;  4TXO B;  5EY6 A;  5DAL B;  2DKH A;  3D5J A;  4XCS A;  5KN2 A;  3HXS A;  3WGD A;  2H1A A;  3GNJ A;  4WR4 A;  1A2L A;  4OCE A;  4MAB A;  1GUH A;  4EDZ A;  3ME8 A;  1GTA A;  2LKU A;  3A3T A;  3BCI A;  2RM6 A;  1OKD A;  4EIQ A;  4K6X A;  5AIX A;  4PHZ C;  3GSS A;  4D73 B;  2PER A;  1SKW B;  4L5L A;  4Q5F A;  4KCA A;  1T8E B;  4KW6 A;  2N5F A;  3VI5 A;  4Q5R A;  5D93 A;  4HQZ A;  2LJA A;  5J4Y A;  3E0U A;  3ZIV A;  4MDC A;  5AIS A;  2MMZ A;  2F8A A;  3K8N A;  5HR2 A;  1SJ6 A;  4Q5N A;  5B8A A;  3GX0 A;  1PA3 A;  4OFT A;  2DLX A;  3TRQ A;  4L8E A;  1EWX A;  1SK0 A;  5DCG A;  1Z3E A;  2CZ3 A;  4PXO A;  4L0U A;  4X0X A;  1YEW C;  1BJX A;  4MJC A;  4JU5 A;  4V2L A;  4EKZ A;  2AYT A;  5KOX A;  2C4J A;  1THO A;  2YCD A;  2FUG 2;  1TKD B;  14GS A;  1KTE A;  3FR3 A;  3GST A;  3TKP A;  3ZRD A;  5JCU A;  3KP8 A;  3WYW A;  2HSM B;  1G6W A;  1C72 A;  4ZIJ A;  4IBP A;  2A2P A;  4LMW A;  1EZK A;  5GAN D;  5CRW A;  4F03 A;  2H74 A;  3Q18 A;  2EIO A;  4ZIL A;  2EFE A;  3ZFB A;  2HRA A;  2VD0 A;  3LXZ A;  1TU7 A;  4RI6 A;  3LYK A;  2NDO A;  1FB0 A;  5F05 A;  3TRX A;  2HE3 A;  1DUG A;  1THX A;  2V6O A;  2WW2 A;  1V40 A;  3GKM A;  4BVY B;  2R37 A;  4J56 E;  1T1V A;  2LV3 A;  4WKW A;  4Q5Q A;  3TOT A;  1U3A A;  3LOR A;  5E59 A;  3IXR A;  1N8J A;  2VLV A;  2YPM A;  2EIR A;  2HSY A;  4GSN A;  2IWT A;  3QAG A;  3GTU A;  5IPG A;  3EIN A;  1PFO A;  2GDR A;  1UC7 A;  3I9V 2;  2BJX A;  4MF6 A;  4ECC A;  1O6J A;  3BBY A;  1B48 A;  5IMV A;  2C0D A;  1ZYQ B;  1K0N A;  1S4B P;  3MAK A;  3TB2 A;  2IMD A;  2H1G A;  3F6F A;  5ECS A;  2DIY A;  3KJY A;  2AAW A;  2CQ9 A;  4G19 A;  1ILO A;  1RK4 A;  1NHY A;  2IL3 A;  4KF9 A;  2DJK A;  3DYR A;  4FQU A;  2IPA A;  3IK9 A;  3O76 A;  1WPI A;  5G1K A;  1K0M A;  1M9B A;  5D73 A;  3IC8 A;  1ERU A;  2H0G A;  2LQQ A;  2DSA A;  3GN3 A;  5BRT A;  4K2D A;  3UBK A;  2L4C A;  4ECJ A;  2C3Q A;  1GSD A;  5AIV A;  5HFG A;  1V57 A;  3V1W A;  3DRN A;  4KSM A;  1XWC A;  3HVV A;  3GMF A;  3US3 A;  2O7K A;  2PU9 C;  1U6T A;  2WUL A;  2MBS A;  4I97 A;  4EE0 A;  2ALB A;  4BWQ A;  1A24 A;  5DAK A;  4V1A p;  5ECO B;  1PX7 A;  7GSS A;  4AGS A;  4TR1 B;  4GST A;  2WW3 A;  5FT3 A;  1T4Z A;  5HR0 A;  5F8B A;  1SVO A;  3FK8 A;  1M9A A;  2EIQ A;  5HFI A;  2X49 A;  1A2M A;  3J7Y b;  1VF1 A;  3M8N A;  2H6Y A;  2A4H A;  2WZS A;  1WWJ A;  3IC4 A;  1URM A;  3SBC A;  3F3R A;  3EMP A;  5A4U A;  1FB6 A;  4PNG A;  2LST A;  2GGT A;  1OVN A;  4PUA A;  5CAX A;  4O5Q A;  1E2Y A;  4LMV A;  1PN9 A;  1YJ6 A;  1MDJ A;  3FZ5 A;  2XPD A;  18GS A;  3CXG A;  1T4Y A;  4P3Y B;  2LNS A;  2IFQ B;  3D0Z A;  5COH A;  2XHF A;  4HS1 A;  2GSR A;  1B4Q A;  2EFC A;  1A0F A;  2VCV A;  4AF2 A;  5BMU B;  2VOC A;  3PPU A;  3EYT A;  3C8E A;  2GSQ A;  1A2J A;  5ABR A;  4IP6 A;  1W89 A;  3U6V A;  4TXO A;  4XS4 B;  5DAL A;  5A5H B;  4IKH A;  4IS0 A;  2GST A;  2YV7 A;  3DD3 A;  4MJA A;  2YZU A;  4HZ2 A;  2H8L A;  4LLR A;  4EF0 A;  1XXU A;  2B5Y A;  4NHZ A;  1XW6 A;  5DJL A;  3A5W A;  1GSE A;  3GUR A;  3TUE A;  3ZLP A;  4NV5 A;  5DBQ A;  1X9W B;  4D73 A;  4WBR D;  4EL1 A;  2M80 A;  2REM A;  4POB A;  4MJE A;  6GSW A;  3APS A;  1XOA A;  4ZL8 A;  1EV4 A;  5CRE A;  3U5R E;  3VWX A;  1O85 A;  2VL2 C;  4A5P A;  3P7X A;  5IO0 A;  19GS A;  4IHU A;  2UZ8 A;  1FAA A;  3KZQ A;  4FH8 A;  4FO5 A;  3KTB A;  4BVX B;  3W8S A;  1ERT A;  4W66 A;  3ZFL A;  2H1B A;  3IA1 A;  1WOU A;  2DJ1 A;  4HSC X;  3H93 A;  1YZX A;  4I6X A;  3F9U A;  1GUL A;  4WBJ A;  4CY8 A;  2FWE A;  4FYU A;  2LJR A;  4AJ7 A;  2GSS A;  3LQ7 A;  9GSS A;  1Z6M A;  1QK8 A;  2HYX A;  3UOM A;  1NSW A;  2HSM A;  4K0G A;  1BG1 A;  2V1M A;  3GL5 A;  2ES7 A;  1M99 A;  4JED A;  4TRX A;  5GZZ B;  4IJI A;  2DMM A;  3CQF A;  3LSZ A;  2LQO A;  1ABA A;  4Z2R A;  4E68 A;  3ISO A;  2FNO A;  4NXI A;  4NAX A;  2E2M A;  5IOW A;  4MK3 A;  1OC3 A;  2JZR A;  2XPE A;  1B9Y C;  5LNK e;  5GSS A;  3LG6 A; 
#chains in the Genus database with same CATH homology
 1Z6N A;  4PUF C;  2B5E A;  1HD2 A;  1ZYE A;  5J3R A;  3UVT A;  1ZZY A;  4BVY A;  1SYX A;  5KN1 A;  1AC1 A;  4F82 A;  2KOK A;  4QMK A;  3L78 A;  5EPF A;  2H75 A;  4O92 A;  3R2Q A;  1X5E A;  3BCK A;  1JFU A;  4OWY A;  1K0D A;  1CQG A;  4J57 E;  1ZL9 A;  4AKH A;  2LTK A;  4HU9 A;  2CT6 A;  3CMI A;  2H1L A;  2CZ2 A;  1YEP A;  4F0C A;  2X8H A;  1V98 A;  1R4W A;  4GXZ A;  16GS A;  1AXD A;  4MNN A;  2X8C A;  2LRT A;  1USB A;  3CTF A;  4JBB A;  4ISD A;  4X1U A;  2WS2 A;  3HY2 A;  3HVS A;  4MH2 A;  3PIN A;  4HJM A;  3BD2 A;  3Q6O A;  3GRX A;  2DKI A;  2QSI A;  3Q74 A;  1SKS B;  2A2S A;  1XCC A;  2H66 A;  1JHB A;  3TKS C;  4BWS A;  4IVF A;  5DCH A;  4ZL7 A;  4MZW A;  10GS A;  4ZBB A;  4TR1 A;  4ECI A;  5CO3 A;  2FLS A;  3RHB A;  1XZO A;  3CTG A;  1J08 A;  2RLI A;  3WT2 A;  3P2A A;  4WET A;  3A2W A;  1AUC A;  1R7H A;  2QA2 A;  1EEJ A;  3QPM A;  1BED A;  4EVM A;  3VPQ A;  4L5O A;  4TR4 A;  4BA7 A;  4PUR A;  4ICY A;  4JZQ A;  3QAW A;  1MEK A;  3UIW A;  5J5N A;  1K0O A;  3M0F A;  4V2M A;  1VRS D;  2E7P A;  2LJK A;  4N0V A;  2VL9 A;  4TW5 A;  4AI6 A;  1TXU A;  1SL2 B;  2G0F A;  5A5K A;  1G7E A;  2O87 A;  5IOX A;  5BMU A;  1S3A A;  4RI7 A;  3A2V A;  5J41 A;  3W6G A;  2VCQ A;  1X9M B;  4IP1 A;  2AV4 A;  2PUK C;  1EV9 A;  5ECM B;  2V6K A;  3L9V A;  3VFI A;  2HNL A;  2PVQ A;  1DE2 A;  4XS4 A;  2P5Q A;  5IPH A;  2FA8 A;  4K7I A;  5H5S A;  1GL8 A;  1M7T A;  5ECN B;  2O5V A;  2XBQ A;  1PD2 1;  2PMT A;  1TRS A;  2YAN A;  3F3Q A;  6GST A;  1K0C A;  4KCE A;  5IQY A;  1JZR A;  3VPT A;  3IE3 A;  3P8W A;  5CNW A;  4PQI A;  4WR5 A;  4G0I A;  4N10 A;  3ZML A;  1PKW A;  3KTL A;  1ZYP A;  3FR6 A;  2PN8 A;  1M2A A;  1FVJ A;  3RAZ A;  3LFL A;  2GVP A;  4GQF A;  1Z7P A;  3ZVJ A;  4YAV A;  1QMV A;  2VAF A;  4O5U A;  1XWA A;  2OE0 A;  2OAC A;  5IIZ A;  3GA4 A;  2KP2 A;  4K7O A;  3IHQ A;  4BVX A;  2V32 A;  1F2E A;  3ZYW A;  1EGO A;  5F06 A;  1CQH A;  1SVM A;  2O85 A;  3IBH A;  2IMI A;  4KDX A;  3M9J A;  1V9W A;  1SL0 B;  5CP1 A;  3UBL A;  2X8G A;  5FHI A;  1OYJ A;  3GFK A;  4K5R A;  2FD3 A;  2IME A;  1O73 A;  4K7N A;  1U87 A;  1SYR A;  3HHV A;  5ID2 B;  2L6D A;  1XVQ A;  2VCZ A;  5DQS A;  1EEM A;  4EUY A;  1AW9 A;  4EO3 A;  1G7O A;  2JSY A;  2VIM A;  1R5A A;  3LGC A;  5KOW A;  1H4O A;  2H76 A;  2HLS A;  3L0H A;  1GTU A;  2CX4 A;  3GUS A;  4ZBD A;  1GH2 A;  3ERF A;  5HFK A;  1AQW A;  2NTO A;  22GS A;  3TJJ A;  4IJ3 A;  3TOU A;  1QGV A;  2HI7 A;  4MJB A;  5IO2 A;  3G7J A;  1SEN A;  1VF3 A;  4HQS A;  3OR5 A;  3E9J B;  2HXK A;  1Z9H A;  5DDL A;  1XWG A;  4LA1 A;  8GSS A;  2A4V A;  2E2G A;  1X0R A;  3C1R A;  5IMZ A;  1GWC A;  4O7H A;  3IHG A;  1TJD A;  1YKA A;  2VL2 A;  2J9H A;  1HYU A;  2L6C A;  2IN3 A;  3IDV A;  3FZ9 A;  1FO5 A;  3ZVJ D;  4AJ6 A;  4IEL A;  4KX4 A;  4ZB9 A;  5JCG A;  3F4S A;  4EXJ A;  2H73 A;  3CYN A;  3EUR A;  2WDU A;  1TI3 A;  1BQ7 A;  1XOB A;  3HKR A;  1EOH A;  2ZNM A;  1F9M A;  3FMW A;  4YKF A;  1JZD A;  1HNA A;  3Q19 A;  1ACV A;  1S3D A;  1ZCP A;  5EVO A;  3FEU A;  4GRF A;  5KN3 A;  1BG5 A;  2R0G A;  1PGT A;  1XFL A;  5HR3 A;  2OA7 A;  1OC9 B;  5G30 A;  4IN0 A;  4AKX B;  1TRW A;  4AKG A;  5H5Q A;  5ENU A;  1K3Y A;  2YWO A;  2A2R A;  4NHW A;  2UV8 G;  1GLP A;  1F3B A;  6GSU A;  5A1N A;  4TR3 A;  4MH3 A;  4I8B A;  1S3C A;  3VLN A;  3UEM A;  3QAV A;  4K5S A;  3O6T A;  1XIY A;  2MMO A;  2EFH A;  2H01 A;  12GS A;  2KP1 A;  3H4K A;  2FY6 A;  1GNW A;  2HFD A;  5KEJ A;  4J2F A;  1GTI A;  3IAM 2;  3MYD A;  2NBS A;  3QDN A;  1RQM A;  1MDI A;  3M3M A;  1XVW A;  1MD3 A;  4JE1 A;  3I43 A;  4MPG A;  4ML6 A;  5INY A;  1JLW A;  3FZ4 A;  5JWO B;  2OE1 A;  2H6X A;  2HRK B;  1UVZ A;  1A0R P;  4K9Z A;  3KP9 A;  2B1K A;  1VGL A;  2DJJ A;  2PGT A;  1DSB A;  2VUP A;  4ACS A;  2GZY A;  1PL2 A;  3D22 A;  3AY8 A;  1FOV A;  2RUE A;  4XHM A;  2YWN A;  3LXT A;  3JCM L;  2YZH A;  3EPT A;  1TW9 A;  2H70 A;  2B7J A;  4PNF A;  1GLQ A;  3TKS A;  2R3X A;  4USS A;  5J40 A;  1UN2 A;  4G9H A;  1F3A A;  3GKX A;  3KH7 A;  5F07 A;  3TCO A;  2HQT A;  2KUC A;  2AB6 A;  4MP4 A;  1XWK A;  1ZGN A;  2H19 A;  4X43 A;  1LU4 A;  3IOS A;  2OKA A;  4FYC A;  2OBI A;  1PKZ A;  3O3T A;  2R5G A;  4XRD A;  3ZIT A;  2PBJ A;  2JAC A;  1YVL A;  3PH9 A;  2PPT A;  4KSO A;  1JLV A;  2JZS A;  2VL3 A;  1O8W A;  1TK5 B;  1OC8 A;  1EP8 A;  3F6D A;  4V1A g;  1TOF A;  4KAE A;  5IMD A;  4Z2U A;  4CHS A;  3ZZX A;  2FGX A;  1R26 A;  3CWG A;  2L5O A;  1TDI A;  3GKN A;  3GIX A;  2V41 A;  3KGK A;  2TIR A;  2XBI A;  2I4A A;  4HEA 2;  5AN1 A;  1HNC A;  3QD9 A;  3FZA A;  3GH9 A;  5ID2 A;  3F0I A;  5ECH B;  1AIU A;  5IM9 A;  3VK9 A;  2LNT A;  2YWI A;  20GS A;  2YJ7 A;  1XBS A;  4DEJ A;  3FRC A;  3LJR A;  3KMN A;  2HSN B;  3IK7 A;  4NWY A;  3GH6 A;  5EL8 A;  2C0G A;  2B7K A;  6GSS A;  4FIW A;  4RQX A;  3TJB A;  4ZXG A;  1V2A A;  3RPP A;  4MF7 A;  3HVX A;  4ZBA A;  3QOU A;  1XW5 A;  2VCW A;  3KXO A;  5A4V A;  1A23 A;  2QA1 A;  1TXX A;  4IGJ A;  4GLT A;  2F3M A;  2EC4 A;  4ZL9 A;  3TDG A;  5G2Z A;  1WJK A;  2H71 A;  2P31 A;  3ED3 A;  4K8M A;  1I9D A;  2N5B A;  1LJR A;  4MZC A;  1KNG A;  2YNX A;  2IMF A;  1WMJ A;  3MSZ A;  2JSZ A;  5ECI B;  3EWL A;  1OKT A;  2VCX A;  4YKG A;  2GTU A;  2L5L A;  3P90 A;  2CVD A;  1GSU A;  5ECK B;  3H1N A;  2BMX A;  3LYP A;  2ON7 A;  4OFM A;  3HJM A;  1IYI A;  2HT9 A;  2LEG A;  4EC0 A;  2H30 A;  3HJP A;  2X4A A;  4YQM A;  2G2Q A;  2DJ0 A;  3GV1 A;  2QKE A;  4F2I A;  1T7P B;  5H5R A;  2WCI A;  4V2N A;  2C3N A;  1GNE A;  5B6M A;  2PWJ A;  3HA9 A;  4KND A;  1B4P A;  3F63 A;  1OC9 A;  5IMA A;  1I5G A;  1Y25 A;  1GSF A;  3G9B A;  1UA5 A;  3D21 A;  2L4Q A;  4OMV A;  4K1F A;  2VKZ G;  2QGV A;  1GTB A;  4HU7 A;  2ZUP A;  4JR4 A;  4OD7 A;  5ECL B;  1PL1 A;  4E8H A;  1NW2 A;  1SJI A;  4N11 A;  4MPF A;  1KBN A;  1WE0 A;  1EGR A;  4POL A;  2WJU A;  5B7C A;  3GX8 A;  1ERV A;  3EMX A;  3F8U A;  1YEX A;  4K2X A;  5B8B A;  5HQP A;  3IR4 A;  1ZYN A;  5CYY A;  1X9S B;  1EOG A;  1TK8 B;  3KMO A;  2N5A A;  2IFQ A;  2CA8 A;  4XS1 A;  2TRC P;  13GS A;  1DBY A;  4K0N A;  2HRK A;  4XS6 A;  4RQR A;  3CBU A;  2ZCT A;  4PX1 A;  1M2B A;  2C3T A;  2GT6 A;  4HJ2 A;  4WF4 A;  1GSS A;  2C0F A;  2RUF A;  4XRA A;  2VLU A;  5A5H A;  3S9F A;  1F37 A;  4N30 A;  4MA9 A;  1XW9 A;  4PGT A;  4OO5 A;  2L57 A;  5KN0 A;  2YJH A;  4WXT A;  4GSS A;  4OFN A;  3I69 A;  1LBK A;  3UMA A;  3IPZ A;  3DVX A;  2B5X A;  2Z9S A;  1ML6 A;  1ST9 A;  3IV4 A;  5ECQ B;  2C1Y A;  4TR0 A;  1VF4 A;  1PRX A;  3KCM A;  2CV4 A;  1HQO A;  4E8E A;  5D8I A;  1O8X A;  1SKR B;  4OCF A;  2FWG A;  4ZB8 A;  1H75 A;  2QC7 A;  1VF2 A;  4F0B A;  3CSH A;  2CX3 A;  4XTS A;  3NIV A;  6GSY A;  1O81 A;  5DJM A;  2NPB A;  5A34 B;  3D6I A;  2WB9 A;  3EC3 A;  1JZO A;  2LRN A;  1IYH A;  1YKC A;  2DC5 A;  4GTU A;  2HZF A;  2MBT A;  3CRU A;  2H6Z A;  2H0I A;  5AGY A;  3DKS A;  4HUA A;  4G01 A;  4ZB6 A;  5D9T A;  5D9V A;  1GSY A;  4DSS B;  3DXB A;  4DSR A;  2FWH A;  2IMK A;  1NM3 A;  1FG4 A;  3HYP A;  2DJ2 A;  4KDU A;  3HJO A;  4YH2 A;  2YOI A;  4DVC A;  2C0E A;  2JAD A;  4BL7 B;  4GF0 A;  3TJF A;  1K3O A;  1N2A A;  1Q98 A;  4JRR A;  2HSN A;  1M0U A;  4HZ4 A;  3VI7 A;  3TJK A;  4YQV A;  2B6M A;  5LD0 A;  1YDK A;  4KGI A;  1FHE A;  1TTZ A;  1DE1 A;  4AJ8 A;  2I9H A;  2RM5 A;  3KD0 A;  5F0G A;  1GRX A;  4GCI A;  1PQN A;  1TU8 A;  3MDK A;  5G1L A;  3NZN A;  4WEY A;  4PQ1 A;  3I6A A;  5J4U A;  3H8Q A;  1GUK A;  4HOJ A;  5LCZ A;  4ZB7 A;  1XPV A;  2PVO C;  2HZE B;  3ERW A;  2EFD A;  5FWG A;  3PR8 A;  4G10 A;  4GDF A;  2H1D A;  1Z5Y E;  2R0P A;  3EU4 A;  3QFB C;  2VLT A;  3C1S A;  5J9B A;  1AAZ A;  3M9K A;  2X64 A;  2E0Q A;  2J23 A;  3VWV A;  4OO4 A;  1ZMA A;  3LEF A;  1PN0 A;  3VWW A;  2CVB A;  4ULX A;  1OE8 A;  2KHP A;  2NVL A;  2CAQ A;  3RPN A;  2C80 A;  1AQV A;  3SWL A;  1FOH A;  2DJ3 A;  3QFA C;  4RUV A;  2VD1 A;  3F4T A;  2AHE A;  1K0A A;  4TVE A;  4I5Q A;  2YP6 A;  1R5P A;  1TRV A;  3RHC A;  2FHE A;  1XWB A;  1QUW A;  5L71 A;  4IQ1 A;  2I81 A;  3C73 A;  4QL9 A;  3E3E A;  4TXV A;  5G5E A;  3L9U A;  2FCH A;  1GSQ A;  2HRN A;  2OBK A;  4O32 A;  4TKY A;  5ELA A;  1ERW A;  1SD9 A;  3CRT A;  2GT5 A;  4ID0 A;  1EP7 A;  4MCU A;  3ZL5 A;  4WF5 A;  2VCT A;  3VUR A;  3TJG A;  1ON4 A;  2VO4 A;  3HZ8 A;  5D9X A;  5ECP B;  5IMC A;  1Y1U A;  2GLR A;  6GSX A;  3WGE A;  2V2G A;  1WIK A;  4L0W A;  1K0B A;  2BTO T;  3CSI A;  5CRD A;  3WD6 A;  1NHO A;  2GS3 A;  2H0H A;  3C71 A;  4TOP A;  3DEX A;  4ILF A;  3ZRE A;  4CY6 A;  1TK0 B;  5IMF A;  2XC2 A;  3RDW A;  3EU3 A;  3D4M A;  1SJZ A;  3APQ A;  3TRP A;  2GQM A;  1TRU A;  5C04 A;  2MMA A;  2K6V A;  5HR1 A;  4QL7 A;  1BAY A;  3FYG A;  2DIZ A;  3GYK A;  3A2X A;  2I3Y A;  1TI1 A;  5J4V A;  4KA0 A;  2MZC A;  1A8L A;  2FA4 A;  1YF0 A;  4I2T A;  4CDO A;  1A8Y A;  1Y6E A;  4YQU A;  1J0F A;  2DML A;  3DGQ A;  2M72 A;  2WGR A;  4MLY A;  4JR6 A;  2LUS A;  3TU3 B;  1W4V A;  3N9J A;  1PX6 A;  1TP9 A;  5GST A;  1X5D A;  5GAP D;  3QMX A;  3ZMK A;  1KEB A;  2O89 A;  3QCP A;  2OAD A;  3UJ1 A;  2F9S A;  4YAP A;  5ECR B;  1QQ2 A;  5G5F A;  3FW2 A;  2GZP A;  3DWV A;  4G2E A;  2M46 A;  2YV9 A;  1M2D A;  1N25 A;  4G0K A;  5J47 A;  1O7U A;  4N3Z A;  4GWR A;  2KLX A;  1WRY A;  4H86 A;  1ZOF A;  2ON5 A;  1MDK A;  5A34 A;  1G0T A;  1G6Y A;  2HSH A;  2LRC A;  2B3S A;  3CSJ A;  2K8S A;  17GS A;  2FWF A;  3UAR A;  3WT1 A;  4AKI A;  3KH9 A;  2GQL A;  1J9B A;  4NV2 A;  4KE3 A;  4IQA A;  4DSS A;  3N5O A;  2JU5 A;  1YQ1 A;  5C00 A;  4MF5 A;  3IRA A;  3EVI A;  4I2U A;  3C7M A;  3HCZ A;  1T00 A;  2OJL A;  1GUM A;  2AUV A;  3IAS 2;  4BL7 A;  2R4V A;  1BF5 A;  3TKS E;  1PMT A;  4TN8 A;  3L4N A;  3EE2 A;  1YY7 A;  1GP1 A;  3TKQ A;  2VM1 A;  3KIJ A;  2C8U A;  4KH7 A;  2K18 A;  5J9C A;  1SU9 A;  3RBT A;  3VWU A;  2JL4 A;  1SD8 A;  2D2Z A;  2F8F A;  11GS A;  3ZTL A;  4HI7 A;  1SVL A;  1BX9 A;  4HDE A;  2JZT A;  4NPB A;  2WRT A;  2R2J A;  3FHK A;  3WGX A;  5A4W A;  2TRX A;  5JCW A;  5D9W A;  3MNG A;  1F6M C;  3GTU B;  4KUN A;  1BYE A;  2VM2 A;  4MZB A;  3NOF A;  3BJ5 A;  2B1L A;  3KEB A;  5B6N A;  3M1G A;  3GHA A;  1HNB A;  2HZE A;  3UL3 A;  4O5R A;  3PGT A;  4PQH A;  2K8V A;  5E4W A;  4XIH A;  4Z7X A;  4QQ7 A;  1U3I A;  4LL4 B;  2P5R A;  4POK A;  5DQY A;  3TGZ A;  1QXH A;  2WZ9 A;  4IW9 A;  4X4J A;  1RW1 A;  2R6K A;  5G31 A;  3GKK A;  2YWM A;  5ELG A;  2DBC A;  3HMJ G;  3HDC A;  2GQK A;  2H72 A;  2HRF A;  4N0Z A;  2MYG A;  4KDY A;  4DSQ A;  2CVK A;  6GSV A;  3FR9 A;  4CW9 A;  4EIP A;  2OT3 A;  4ECB A;  3A5I A;  3BOA A;  1Q4J A;  4LL1 B;  3QR6 A;  5DAK B;  1MTC A;  2P0G A;  3G7Y A;  5JWQ B;  1AQX A;  5DVB A;  5CRG A;  3GL3 A;  3W8J A;  3DML A;  2K9F A;  4FYB A;  1SK2 A;  3ERG A;  1MD4 A;  2YN1 A;  2AJQ B;  3UVH A;  3LW9 A;  2O8V B;  5A1N B;  3TKR A;  1T3B A;  3DIE A;  2I1U A;  3D4T A;  2RII A;  2X99 A;  4MMM A;  4EDY A;  2LS5 A;  1V58 A;  2WFC A;  4G0L A;  1JZW A;  2IIY A;  3R3E A;  3L9S A;  4BPY A;  4KB3 A;  1OE7 A;  1OAZ A;  3FY7 A;  5JWR B;  2CAI A;  1WP0 A;  4F9Z A;  3DVW A;  2IJY A;  1SL1 B;  2GZZ A;  3G7I A;  3HZ4 A;  3F4R A;  3ZIJ A;  3HD5 A;  1FVK A;  2MMN A;  3KM6 A;  3FKF A;  3H79 A;  2F51 A;  1QFN A;  1YF1 A;  1K3L A;  1PSQ A;  4GQC A;  4ML1 A;  1Z7R A;  2R0C A;  4Z2T A;  1U88 A;  5D96 A;  4NMU A;  1B8X A;  1B9X C;  1E6B A;  1FW1 A;  1SK1 A;  4POM A;  3MIX A;  5CRH A;  2OE3 A;  3UAP A;  2L59 A;  3APO A;  4PTS A;  3MWH A;  3LWA A;  1X5C A;  3J7Y k;  3ME7 A;  4TXO B;  5EY6 A;  5DAL B;  2DKH A;  3D5J A;  4XCS A;  5KN2 A;  3HXS A;  3WGD A;  2H1A A;  3GNJ A;  4WR4 A;  1A2L A;  4OCE A;  4MAB A;  1GUH A;  4EDZ A;  3ME8 A;  1GTA A;  2LKU A;  3A3T A;  3BCI A;  2RM6 A;  1OKD A;  4EIQ A;  4K6X A;  5AIX A;  3GSS A;  4D73 B;  2PER A;  1SKW B;  4L5L A;  4Q5F A;  4KCA A;  1T8E B;  4KW6 A;  2N5F A;  3VI5 A;  4Q5R A;  5D93 A;  4HQZ A;  2LJA A;  5J4Y A;  3E0U A;  3ZIV A;  4MDC A;  5AIS A;  2MMZ A;  2F8A A;  3K8N A;  5HR2 A;  1SJ6 A;  4Q5N A;  5B8A A;  3GX0 A;  1PA3 A;  4OFT A;  2DLX A;  3TRQ A;  4L8E A;  1EWX A;  1SK0 A;  5DCG A;  1Z3E A;  2CZ3 A;  4PXO A;  4L0U A;  4X0X A;  1BJX A;  4MJC A;  4JU5 A;  4V2L A;  4EKZ A;  2AYT A;  5KOX A;  2C4J A;  1THO A;  2YCD A;  2FUG 2;  1TKD B;  14GS A;  1KTE A;  3FR3 A;  3GST A;  3TKP A;  3ZRD A;  5JCU A;  3KP8 A;  3WYW A;  2HSM B;  1G6W A;  1C72 A;  4ZIJ A;  4IBP A;  2A2P A;  4LMW A;  1EZK A;  5GAN D;  5CRW A;  4F03 A;  2H74 A;  3Q18 A;  2EIO A;  4ZIL A;  2EFE A;  3ZFB A;  2HRA A;  2VD0 A;  3LXZ A;  1TU7 A;  4RI6 A;  3LYK A;  2NDO A;  1FB0 A;  5F05 A;  3TRX A;  2HE3 A;  1DUG A;  1THX A;  2V6O A;  1V40 A;  3GKM A;  4BVY B;  2R37 A;  4J56 E;  1T1V A;  2LV3 A;  4WKW A;  4Q5Q A;  3TOT A;  1U3A A;  3LOR A;  5E59 A;  3IXR A;  1N8J A;  2VLV A;  2YPM A;  2EIR A;  2HSY A;  4GSN A;  2IWT A;  3QAG A;  3GTU A;  5IPG A;  3EIN A;  2GDR A;  1UC7 A;  3I9V 2;  2BJX A;  4MF6 A;  4ECC A;  1O6J A;  3BBY A;  1B48 A;  5IMV A;  2C0D A;  1ZYQ B;  1K0N A;  3MAK A;  3TB2 A;  2IMD A;  2H1G A;  3F6F A;  5ECS A;  2DIY A;  3KJY A;  2AAW A;  2CQ9 A;  4G19 A;  1ILO A;  1RK4 A;  1NHY A;  2IL3 A;  4KF9 A;  2DJK A;  3DYR A;  4FQU A;  2IPA A;  3IK9 A;  3O76 A;  1WPI A;  5G1K A;  1K0M A;  1M9B A;  5D73 A;  3IC8 A;  1ERU A;  2H0G A;  2LQQ A;  2DSA A;  3GN3 A;  5BRT A;  4K2D A;  3UBK A;  2L4C A;  4ECJ A;  2C3Q A;  1GSD A;  5AIV A;  5HFG A;  1V57 A;  3V1W A;  3DRN A;  4KSM A;  1XWC A;  3HVV A;  3GMF A;  3US3 A;  2O7K A;  2PU9 C;  1U6T A;  2WUL A;  2MBS A;  4I97 A;  4EE0 A;  2ALB A;  4BWQ A;  1A24 A;  5DAK A;  4V1A p;  5ECO B;  1PX7 A;  7GSS A;  4AGS A;  4TR1 B;  4GST A;  5FT3 A;  1T4Z A;  5HR0 A;  5F8B A;  1SVO A;  3FK8 A;  1M9A A;  2EIQ A;  5HFI A;  2X49 A;  1A2M A;  3J7Y b;  1VF1 A;  3M8N A;  2H6Y A;  2A4H A;  3IC4 A;  1WWJ A;  1URM A;  3SBC A;  3F3R A;  3EMP A;  5A4U A;  1FB6 A;  4PNG A;  2LST A;  2GGT A;  1OVN A;  4PUA A;  5CAX A;  4O5Q A;  1E2Y A;  4LMV A;  1PN9 A;  1YJ6 A;  1MDJ A;  3FZ5 A;  2XPD A;  18GS A;  3CXG A;  1T4Y A;  4P3Y B;  2LNS A;  2IFQ B;  3D0Z A;  5COH A;  2XHF A;  4HS1 A;  2GSR A;  1B4Q A;  2EFC A;  1A0F A;  2VCV A;  4AF2 A;  5BMU B;  2VOC A;  3PPU A;  3EYT A;  3C8E A;  2GSQ A;  1A2J A;  5ABR A;  4IP6 A;  1W89 A;  3U6V A;  4TXO A;  4XS4 B;  5DAL A;  5A5H B;  4IKH A;  4IS0 A;  2GST A;  2YV7 A;  3DD3 A;  4MJA A;  2YZU A;  4HZ2 A;  2H8L A;  4LLR A;  4EF0 A;  1XXU A;  2B5Y A;  4NHZ A;  1XW6 A;  5DJL A;  3A5W A;  1GSE A;  3GUR A;  3TUE A;  3ZLP A;  4NV5 A;  5DBQ A;  1X9W B;  4D73 A;  4WBR D;  4EL1 A;  2M80 A;  2REM A;  4POB A;  4MJE A;  6GSW A;  3APS A;  1XOA A;  4ZL8 A;  1EV4 A;  5CRE A;  3U5R E;  3VWX A;  1O85 A;  2VL2 C;  4A5P A;  3P7X A;  5IO0 A;  19GS A;  4IHU A;  2UZ8 A;  1FAA A;  3KZQ A;  4FH8 A;  4FO5 A;  3KTB A;  4BVX B;  3W8S A;  1ERT A;  4W66 A;  3ZFL A;  2H1B A;  3IA1 A;  1WOU A;  2DJ1 A;  3H93 A;  1YZX A;  4I6X A;  3F9U A;  1GUL A;  4WBJ A;  4CY8 A;  2FWE A;  4FYU A;  2LJR A;  4AJ7 A;  2GSS A;  3LQ7 A;  9GSS A;  1Z6M A;  1QK8 A;  2HYX A;  3UOM A;  1NSW A;  2HSM A;  4K0G A;  1BG1 A;  2V1M A;  3GL5 A;  2ES7 A;  1M99 A;  4JED A;  4TRX A;  5GZZ B;  4IJI A;  2DMM A;  3LSZ A;  2LQO A;  1ABA A;  4Z2R A;  4E68 A;  3ISO A;  2FNO A;  4NXI A;  4NAX A;  2E2M A;  5IOW A;  4MK3 A;  1OC3 A;  2JZR A;  2XPE A;  1B9Y C;  5LNK e;  5GSS A;  3LG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...