5ELUA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
NENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVDLTRFPVTTMYYLTLEAKDGGKKKLYEAKVWVKGYLLEELKHNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
molecule keywords SUMO-Affirmer-S2B3
molecule tags Signaling protein
source organism Synthetic construct
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eluA00
1EQKA 4TX4A 3SVAA 4N6UA 2CH9A 1R4CA 2BO9B 2KXGA 1A90A 5ELUA 1WNHA 1GD3A 1G96A 3UL5A 5ELJA 4N6MA 3GAXA 3Q2PA 1N5HA 1MOLA 1DVDA 3KFQC 1YVBI 5EQLA 3S67A 1IV7A 1LXEA 3KSED 3IMAB 4N6TA 1MNLA 3PS8A 4N6OB 1N9JA 4N6LA 1CYUA 3MWZA 3PXMA 1RN7A 1CEWI 1DVCA 5LC7A 4N6NB 2OCTA 4EYCA 5LC6A 1A67A 1N5PA 1NB3I 2W9QA 4CCVA 1FA3A 4LZIA 3UL6A 1PFPA 1CYVA 1FUWA 1M9GA 3K9MC 2W9PA 5A0OB 1TIJA 1IV9A 1STFI 3L0RA 2O9UX 1NB5I 1KWIA 1GD4A 4ZM8A 3QRDA 3NX0A 3PYJA 1ROAA 4IT7A 3LH4A 4N6V0
chains in the Genus database with same CATH superfamily
1O7MB 1BRKA 4TX4A 1FGMA 2UX0A 2Z6BA 3K5TA 5G2GA 1JZOA 4O02B 3X41A 2RNTA 3M8CA 2CHCA 2P05A 2F99A 4MMZB 3V98A 4FMDA 3N8BA 4CJNA 3ROBA 3CC73 3S5CA 4BIRA 4MEIA 3SYUA 2C11A 1Q864 1JKGA 1N8QA 1VQ93 2MC8A 3SOYA 4O8SA 6GSPA 1BNRA 2JDIH 3WDGB 3FGYA 5G1LA 3FF0A 4NREA 2XSHB 4WWUC 4BTWA 1NDOB 3K7CA 5EEOA 1TU5A 3SXXA 1AY7A 1R4YA 5ELUA 1T2IA 5AIIA 1ISKA 4GSPA 3X42A 3FKAA 3BB9A 2UGIA 3CCL3 5IF6A 3OV4A 1N9EA 1IU7A 1G0TA 5JPPA 3LXUX 1BNSA 1GD3A 3EF8A 1HU9A 1G02A 4I4KA 1JN5A 1RLSA 3SOAA 1DMQA 1JB2A 1SPUA 3G6E3 2KF4A 3K63A 4GHOA 4J8TA 5ELJA 1YJN3 5D81A 1W4NA 3J7Yd 4HM6B 5AIFA 1U8CB 2CW9A 4ILFA 1RN1A 4WP5A 1IK3A 1BRNL 2K3DA 2H0HA 1Q7Y4 1RCKA 1MOLA 4ORLA 2BNGA 1S5AA 5I97A 3CMA3 1RRHA 5HGRA 1NO3A 3LT9A 1RGEA 3DM8A 5M1AA 4J9AA 1L5GB 1MWRA 2CFGA 3SEDA 1UCKA 3MG3A 2B1XB 2WGOA 3MSOA 1VQ73 1JJ22 4LYLB 5EQLA 1OF5B 4FCJA 3KKGA 4WYKB 8RNTA 1Z1SA 1IT8A 3V92A 4BL2A 2CK3H 1A2KA 5CLKA 1OHPA 2P09A 1O7GB 2XH9A 1C54A 2Y74A 3CCR3 5IEPA 1GY5A 1LXEA 3KZTA 3MHEA 2PZVA 3KSED 4J5GA 3DGMA 3WMDA 4N6OB 2HMKB 1YNVX 2RFRA 2KCDA 1W6CA 5M18A 2KF5A 3KN4A 2R4IA 3PXMA 4QWTA 1B2MA 1LOVA 4J5KA 1ASKA 1QALA 3JUNA 1O7HB 1QAKA 1B2XA 2RCDA 1EG9B 1FGOA 1DE3A 1WQLB 1GSPA 3WOFB 1BSAA 4N6NB 1W5ZA 4WHAA 3GRDA 5GSPA 1UDII 2CX0A 4HM8B 2R41A 2YFIB 1N5PA 2KF3A 2FNQA 3NQZA 1J2BA 3EQQB 1VQK3 4CCVA 3CD63 1FA3A 2RGQA 3JVCA 4MMYB 1YJ93 1O7WB 3UNLA 3D5GA 4JF8A 1K28A 3F7XA 1UGIA 1B2SA 3NV0B 4LMIA 3BNDA 3HI7A 4HM5B 3MG2A 3ZG0A 3OX9A 1GMQA 4XBXA 1RRLA 1YGEA 4NHFA 5FW5A 5A0OB 1RTUA 5CK6A 3L0RA 1BNJA 4KVHA 2F56A 4STDA 2W56B 4O2HA 1K9M4 2FXTA 3G0KA 2F5WA 3LT8A 3GZYB 3KIIA 1W01A 3LH4A 3VF1A 5IG5A 3E99A 3X3ZA 4HM0B 4FMBA 4R9LA 1MWUA 3D9RA 7STDA 3DMCA 3HIGA 1GMPA 1EQKA 1M1XB 4N6UA 3FZWA 4RNZA 1FUSA 2L1SA 3I553 4XDWA 2CIUA 2OOVC 3F8XA 3GZXB 1BUQA 7RNTA 4RNYA 4HOHA 4RZMA 3ZFZA 2XEPA 2OTL3 3T0UA 4X2OA 1R4CA 5JBSA 1RGKA 3X3YA 4R4KA 2GBXB 2E2TA 4K90B 5AYSC 5AEWB 3OXAA 6STDA 1SARA 3I563 2BMRB 2BHMA 2BO9B 1I3FA 3AHSA 2GBWB 2RSXA 1UW1A 2KXGA 1RMSA 1SQWA 4LSOA 1KQS2 1T3BA 4PEJA 2GXFA 1PYLA 1UCLA 1Q42A 3LYGA 4GL6A 1MWTA 5BU4A 5BXQA 2GEYA 1UUWB 1G96A 1X1YA 1F8NA 3EN1B 5IERA 3UL5A 2CC3A 1I3IA 4R80A 3SX1A 3JUMA 1BAOA 3LTAA 4H3UA 2Y73A 3O8YA 4OK0A 2BT3A 5IW9A 1I2FA 1VQO3 2OOVA 3BNBA 2XRXB 1EKMA 1GOVA 3F7SA 3Q90A 1N5HA 3DGLA 4FMAA 4FCZA 4N3VA 3HZPA 4OUQA 3CXC2 1KD14 1HYFA 3S28A 3CCJ3 3NQYA 1EEJA 1RGLA 1OHOA 2A15A 1BRHA 1CH0A 5AYRB 1JB5A 1Q9EA 1UI8A 2Z76A 1Q40A 1VQ43 3MKIA 4G1MB 1SJWA 1X1UA 1LOYA 1IV7A 4HM2B 1BNIA 3LZAA 4HZBB 3T8NA 4BTXA 1BSCA 1JV2B 4EC6A 1W02A 3IMAB 1IVWA 2C4BA 2XFTA 4N6TA 2F86B 3PS8A 2HMJB 2W03A 3G4S3 3EE1A 4KFEA 1JKGB 1QJGA 2F98A 1HZ1A 1NJI4 3DY5A 3IPTA 3ZG5A 3U97A 2P0XA 1DVCA 4EW5A 1I2GA 4O3VA 3F8HA 3S29A 1B21A 5D83A 2O3OA 1STDA 2F5MA 5HOHA 1HKXA 2OCTA 4AKYA 1M904 4KFDA 1NU3A 1W2B2 1I0XA 2LYXA 4EV2A 1ROVA 1ULIB 2CFDA 5LC6A 1Q814 1DMMA 1T2HA 2GEXA 2F4YA 1EUIC 2L4VA 4HM1B 4U13A 3DGOA 3WA2X 1JN5B 3UL6A 3AGNA 2YX9A 2XSOB 1FUWA 5AIHA 1BNGA 3G8ZA 3NUVA 1M9GA 1E3VA 1W6GA 4DKIA 1LOWA 4MJDA 3PCSA 1TIJA 3D79A 3PZWA 1VQN3 3N9HA 2CG1A 3CCE3 5CXOA 2SBLA 1RN4A 1STFI 1X1XA 2O9UX 3DUKA 2SARA 4HM4B 1GD4A 2GSPA 1BRJA 1VZZA 1VQQA 1FW7A 1FGRA 3FSDA 4ZM8A 1QVG2 3QRDA 3D4AA 1VQL3 3NX0A 3PYJA 3B4OA 1RGGA 1IVUA 5CF2A 2D42A 1SIIA 3PCRA 1BU4A 3NM2A 4EXRA 5IENA 2INXA 2Z77A 3RDEA 2XR8B 4HZ9B 4I5QA 4HKVB 1O7NB 2H0GA 1DYUA 1I70A 1OPYA 3A5EA 1LOXA 3SVAA 2OQEC 1T5YA 5G1KA 2HMOB 3T8UA 1M1K4 2IUJA 4HM7B 1OUNA 2AAEA 5IG3A 5EVHA 1AVLA 2D1WA 3NM7A 4XDVA 5AIGA 2HMMB 3BIRA 1VQ83 2PNCA 1GY7A 1B3SA 3VGNA 3FH1A 3MPHA 1YHQ3 2W2CA 3CPW2 1QMAA 3H3HA 1VQ63 3RGRA 3AMOA 1A90A 1BUJA 3BLZA 1CQSA 2RBIA 1VQ53 1WNHA 3CPOA 4L7KA 3RGAA 5BVBA 1OH0A 4IPBA 1MGWA 3CNMA 3NBJA 1BSEA 3QK9A 2IUKA 1BRGA 1LQMB 2ZL8A 5RNTA 3MYTA 2ML6A 3B4PA 4KT3B 3WA3A 2UUGC 1ULJB 2W6JH 4N6MA 1OCVA 1RJOA 2OQEA 2IA7A 1K8A4 1IDPA 1JRQA 1DMNA 3UJMA 2CFKA 3Q2PA 2OTJ3 1W2ZA 2P38A 3GSPA 8CHOA 1Q7HA 4KZ1A 1DVDA 3LMLA 3KFQC 4XBTA 3V99A 3F9SA 1E97A 2ZA4A 4LEHA 3JUPA 3LOYA 1GS3A 1RGCA 3LTBA 1I8VA 4K1UA 3DGYA 3CCQ3 2CKFB 1JNQA 3S67A 1YJW3 1N8R4 3B8LA 5KP1A 3HIIA 3OWYA 4BU4A 3F14A 4HVNA 4HAAA 3CCS3 1RGAA 5TGNA 2W0QA 1SIHA 4KFFA 1KSIA 2W04A 3STDA 3I0YA 1K41A 1YVSA 3NBRA 4GB5A 1VQM3 3A76A 3FLJA 1JBRA 2CG0A 3JUQA 1YIT3 1WMNA 6RNTA 1UCJA 1MNLA 1LRAA 1GYBA 1UUGB 1N9JA 1UI7A 1WMPA 2YFJB 3BNCA 3FG1A 1BSDA 3H51A 3MWZA 4RNTA 3KSPA 1RN7A 2KRTA 1B2UA 4HYZA 2QGUA 2WOHA 2J8XB 1RGHA 4R1KA 3G16A 3ER7A 3KE7A 5IG0A 4L8PA 1OHSA 3JUOA 4WFOA 2JQ5A 3HK4A 3Q3FA 1RNBA 1BNFA 1UCIA 2CFLA 2YFLB 1A67A 1NB3I 2W9QA 1BNEA 1BSBA 2CWTA 4K1VA 4R9KA 2Z7AA 1NWWA 3EX9A 3U1WA 1W6YA 1Q824 5KP3A 4EBGA 5AEUB 1ZO2A 3OW22 1IYYA 5CF1A 1MGRA 3HX8A 4XB5A 3AGOA 3EB8A 1ZS7A 5D82A 1LNIA 4RBNA 1ZX2A 5DRVA 1C7HA 1RNTA 3GZRA 1BRIA 1GOYA 1OF5A 1GOUA 1RDSA 4WYKA 4BL3A 1BRSA 1Q40B 2XF3A 1KC84 5M19A 1I0VA 2CWVA 2KAAA 1K734 5STDA 1LVNA 2CWUA 2M7OA 2WO0A 4HJLB 2WOFA 1W7CA 2XGNA 3EHCA 3GWRA 4EV5A 2CH9A 1RHLA 1V58A 4AEQA 9RNTA 2XGLA 1TFKA 3AHWA 1LNHA 3DH2A 3DXOA 3X3XA 3ALAA 1FYSA 4CDLA 3D5IA 3EJVA 3CCV3 4FMCA 1AVKA 4HBRA 3OWUA 1TTOA 1IQXA 1ZGXA 1BANA 2BIRA 3CC23 3EBTA 2BMQB 2STDA 3FG4A 2I9WA 1BIRA 3DGNA 2IYJA 4X2HA 3MG1A 3CC43 1RSNA 7GSPA 4XM4A 3LTDA 1WMOA 1RKYA 1U5OA 2Q07A 1Y4KA 3EC9A 5DREA 1US1A 3PGBA 3VSYA 3D3LA 3LTCA 2BU4A 2QEX3 3BU4A 2MF7A 3KCHA 3NV0A 4FR9A 1S723 3CNXA 2FGTA 1BVIA 2K0MA 1NNVA 2ZDJA 3EN8A 4Q53A 3FF2A 3GAXA 2WGQA 1GMRA 1FGQA 4K61A 1IVXA 1GY6A 2HMNB 4L8OA 2LQVA 3ECFA 1TRQA 1YIJ3 2AADA 1FGTA 1YVBI 2OWPA 1D6YA 1OACA 2ML5A 2W56A 2GU3A 4BTYA 3CCU3 4MMXB 3WOEB 1AQZA 1O7PB 4IIAA 2IMJA 3TDGA 2ZHXB 1UUVB 1B2ZA 1AV4A 1V74A 3HOHA 5JPUA 2H0IA 3X40A 4XBYA 1WTHA 1D6UA 2BMOB 1IQ8A 1QAFA 1FZUA 3SLUA 4CPKA 2IY2A 1EA2A 4N6LA 3IJEB 5AI1A 4OVMA 5IG4A 1CYUA 1A2VA 3GZBA 1VQP3 1BOXA 1YI23 1JBTA 3WHOA 1CEWI 1TUHA 1I2EA 1W00A 2KF6A 1D6ZA 2CFWA 3EBYA 5LC7A 4FCMA 3AMOB 4H61A 1PU4A 3S27A 2GU1A 3NHXA 1AR0A 2QIYA 1UGHI 4EYCA 2QA43 1X1WA 4NPBA 3FCSB 2HMLB 1B27A 4LZIA 3CME3 1QVF2 1JBSA 1FUTA 1OGZA 1PFPA 3F40A 5BIRA 1CYVA 1TP6A 3K0ZA 3CCM3 2E2UA 1B20A 4HM3B 2E2VA 3K9MC 3WODG 2W9PA 2B24B 1TRPA 3RNTA 1IV9A 2C10A 2P0MA 3G713 1PY3A 1OGXA 3CU3A 1JZDA 1IT7A 3NXJA 1V57A 2CX1A 4LGQA 3WR2A 1NB5I 1KWIA 1A2PA 1JB4A 1TFOA 3BNEA 1IVVA 3UB1A 1RGFA 1DETA 1TJDA 3N54B 5FGOA 5IEOA 1LQGC 3DZLA 3NBBA 1BGSA 2K54A 2HOHA 2XFSA 1ROAA 4JRFA 1YGWA 3OWSA 2V1LA 4IT7A 5KP4A 3Q1CA 1MWSA 1E3RA 3B7CA 1IQYA 1RCLA 4AKZA 4N6V0 3URPA 3FG3A
chains in the Genus database with same CATH topology
1O7MB 4TX4A 1FGMA 2UX0A 2Z6BA 3K5TA 5G2GA 4O02B 3X41A 3V98A 3M8CA 2CHCA 2P05A 2F99A 4MMZB 4FMDA 3N8BA 3CC73 3ROBA 3S5CA 4MEIA 2C11A 1Q864 1JKGA 1N8QA 1VQ93 2MC8A 3SOYA 4O8SA 2JDIH 3WDGB 3FGYA 3FF0A 4NREA 2XSHB 4WWUC 4BTWA 1NDOB 3K7CA 5EEOA 1TU5A 3SXXA 5ELUA 5AIIA 1ISKA 3X42A 3FKAA 3BB9A 5IF6A 3OV4A 1N9EA 1IU7A 5JPPA 3LXUX 1GD3A 3EF8A 1HU9A 4I4KA 1JN5A 3SOAA 1DMQA 1JB2A 1SPUA 3G6E3 3K63A 4J8TA 5ELJA 1YJN3 5D81A 1W4NA 3J7Yd 4HM6B 5AIFA 1U8CB 2CW9A 4WP5A 1IK3A 1Q7Y4 1MOLA 4ORLA 2BNGA 1S5AA 5I97A 3CMA3 1RRHA 5HGRA 1NO3A 3LT9A 3DM8A 1L5GB 4J9AA 2CFGA 3SEDA 3MG3A 2B1XB 2WGOA 3MSOA 1VQ73 1JJ22 5EQLA 1OF5B 4FCJA 3KKGA 4WYKB 1Z1SA 1IT8A 3V92A 2CK3H 1A2KA 5CLKA 1OHPA 2P09A 1O7GB 2XH9A 2Y74A 3CCR3 5IEPA 1GY5A 1LXEA 3KZTA 3MHEA 2PZVA 3KSED 3DGMA 3WMDA 4N6OB 2HMKB 2RFRA 2KCDA 1W6CA 3KN4A 2R4IA 3PXMA 4QWTA 1ASKA 1QALA 3JUNA 1O7HB 1QAKA 2RCDA 1EG9B 1FGOA 1WQLB 3WOFB 4N6NB 1W5ZA 4WHAA 3GRDA 4HM8B 2YFIB 1N5PA 2FNQA 3NQZA 1J2BA 3EQQB 1VQK3 4CCVA 3CD63 1FA3A 2RGQA 3JVCA 4MMYB 1YJ93 1O7WB 3UNLA 4JF8A 1K28A 3F7XA 3NV0B 4LMIA 3BNDA 3HI7A 4HM5B 3MG2A 3OX9A 4XBXA 1RRLA 1YGEA 4NHFA 5FW5A 5A0OB 5CK6A 3L0RA 4KVHA 4STDA 2W56B 4O2HA 1K9M4 2FXTA 3G0KA 3LT8A 3GZYB 3KIIA 1W01A 3LH4A 3VF1A 5IG5A 3E99A 3X3ZA 4HM0B 4FMBA 4R9LA 3D9RA 7STDA 3DMCA 3HIGA 1EQKA 1M1XB 4N6UA 3FZWA 4RNZA 3I553 4XDWA 2CIUA 2OOVC 3F8XA 3GZXB 1BUQA 4RNYA 4RZMA 2XEPA 2OTL3 3T0UA 4X2OA 1R4CA 5JBSA 3X3YA 4R4KA 2GBXB 2E2TA 4K90B 5AYSC 5AEWB 3OXAA 6STDA 3I563 2BMRB 2BHMA 2BO9B 2GBWB 2RSXA 1UW1A 2KXGA 1SQWA 4LSOA 1KQS2 4PEJA 2GXFA 1Q42A 3LYGA 4GL6A 5BXQA 2GEYA 1UUWB 1G96A 3EN1B 1F8NA 5IERA 3UL5A 2CC3A 4R80A 3SX1A 3JUMA 3LTAA 4H3UA 2Y73A 3O8YA 4OK0A 2BT3A 5IW9A 1VQO3 2OOVA 3BNBA 2XRXB 1EKMA 3F7SA 3Q90A 1N5HA 3DGLA 4FMAA 4FCZA 4N3VA 3HZPA 4OUQA 3CXC2 1KD14 3S28A 3CCJ3 3NQYA 1OHOA 2A15A 5AYRB 1JB5A 1UI8A 2Z76A 1Q40A 1VQ43 3MKIA 4G1MB 1SJWA 1IV7A 4HM2B 3LZAA 4HZBB 3T8NA 4BTXA 1JV2B 4EC6A 1W02A 3IMAB 1IVWA 2XFTA 4N6TA 2F86B 3PS8A 2W03A 2HMJB 3G4S3 3EE1A 4KFEA 1JKGB 1QJGA 2F98A 1NJI4 3DY5A 3IPTA 3U97A 2P0XA 1DVCA 4O3VA 3F8HA 1IQYA 3S29A 5D83A 2O3OA 1STDA 1HKXA 2OCTA 4AKYA 1M904 4KFDA 1NU3A 1W2B2 2LYXA 1Q814 4EV2A 1ROVA 1ULIB 2CFDA 5LC6A 1DMMA 2GEXA 2L4VA 4HM1B 4U13A 3DGOA 3WA2X 1JN5B 3UL6A 2YX9A 2XSOB 1FUWA 5AIHA 3G8ZA 3NUVA 1M9GA 1E3VA 1W6GA 4MJDA 3PCSA 1TIJA 3PZWA 1VQN3 3N9HA 2CG1A 3CCE3 5CXOA 2SBLA 1STFI 2O9UX 3DUKA 4HM4B 1GD4A 1VZZA 1FGRA 3FSDA 4ZM8A 1QVG2 3QRDA 1VQL3 3NX0A 3PYJA 3B4OA 1IVUA 5CF2A 2D42A 1SIIA 3PCRA 4EXRA 3NM2A 5IENA 2INXA 2Z77A 3RDEA 2XR8B 4HZ9B 4HKVB 1O7NB 3SVAA 1DYUA 1OPYA 1LOXA 2OQEC 1T5YA 2HMOB 3T8UA 1M1K4 2IUJA 4HM7B 1OUNA 5IG3A 5EVHA 1AVLA 2D1WA 3NM7A 4XDVA 5AIGA 2HMMB 1VQ83 2PNCA 1GY7A 3VGNA 3FH1A 3MPHA 1YHQ3 2W2CA 3CPW2 1QMAA 3H3HA 1VQ63 3RGRA 3AMOA 1A90A 3BLZA 1CQSA 1VQ53 1WNHA 3CPOA 4L7KA 3RGAA 5BVBA 1OH0A 4IPBA 3CNMA 3NBJA 3QK9A 2IUKA 2ZL8A 3MYTA 2ML6A 3B4PA 3WA3A 1ULJB 2W6JH 4N6MA 1OCVA 1RJOA 2OQEA 2IA7A 1K8A4 1IDPA 1JRQA 1DMNA 3UJMA 2CFKA 3Q2PA 2OTJ3 1W2ZA 2P38A 8CHOA 1DVDA 4KZ1A 3LMLA 3KFQC 4XBTA 3V99A 3F9SA 1E97A 4LEHA 3JUPA 3LOYA 1GS3A 3LTBA 3CCQ3 4K1UA 1YJW3 2CKFB 1JNQA 3S67A 1N8R4 3B8LA 5KP1A 3HIIA 3OWYA 3CCS3 3F14A 4HVNA 5TGNA 2W0QA 1SIHA 4KFFA 1KSIA 2W04A 3STDA 3I0YA 1K41A 3NBRA 4GB5A 1VQM3 3A76A 3FLJA 2CG0A 3JUQA 1YIT3 1WMNA 1MNLA 2YFJB 1GYBA 1N9JA 1UI7A 1WMPA 3BNCA 3FG1A 3H51A 3MWZA 3CCL3 3KSPA 1RN7A 2KRTA 4HYZA 2WOHA 2QGUA 4R1KA 3G16A 3ER7A 3KE7A 5IG0A 4L8PA 1OHSA 3JUOA 4WFOA 2JQ5A 3HK4A 1A67A 2CFLA 2YFLB 1NB3I 2W9QA 2CWTA 4K1VA 4R9KA 2Z7AA 1NWWA 3EX9A 3U1WA 1W6YA 1Q824 5KP3A 4EBGA 5AEUB 1ZO2A 3OW22 5CF1A 3HX8A 4XB5A 3EB8A 5D82A 4RBNA 1ZX2A 5DRVA 1C7HA 3GZRA 1OF5A 4WYKA 1KC84 1Q40B 2XF3A 2CWVA 1K734 5STDA 1LVNA 2CWUA 2M7OA 2WO0A 4HJLB 2WOFA 1W7CA 2XGNA 3EHCA 3GWRA 4EV5A 2CH9A 4AEQA 2XGLA 1TFKA 3DXOA 1LNHA 3X3XA 3ALAA 4CDLA 3EJVA 3CCV3 4FMCA 1AVKA 4HBRA 3OWUA 1IQXA 3CC23 3EBTA 2BMQB 2STDA 3FG4A 2I9WA 3DGNA 4X2HA 3MG1A 3CC43 4XM4A 3LTDA 1WMOA 1RKYA 1U5OA 2Q07A 1Y4KA 3EC9A 5DREA 1US1A 3PGBA 3VSYA 3D3LA 3LTCA 2QEX3 2MF7A 3NV0A 4FR9A 1S723 3CNXA 2FGTA 2K0MA 2ZDJA 3EN8A 4Q53A 3FF2A 3GAXA 2WGQA 4K61A 1FGQA 1IVXA 1GY6A 2HMNB 4L8OA 2LQVA 3ECFA 1YIJ3 1FGTA 1YVBI 2OWPA 1D6YA 1OACA 2ML5A 2W56A 4BTYA 3CCU3 4MMXB 3WOEB 1O7PB 4IIAA 2IMJA 3TDGA 1UUVB 1AV4A 1V74A 5JPUA 3X40A 4XBYA 1WTHA 1D6UA 2BMOB 1IQ8A 1QAFA 3SLUA 1EA2A 4N6LA 3IJEB 5AI1A 4OVMA 5IG4A 1CYUA 1A2VA 3GZBA 1VQP3 1YI23 1CEWI 1TUHA 1W00A 3EBYA 1D6ZA 2CFWA 5LC7A 4FCMA 3AMOB 4H61A 1PU4A 3S27A 2GU1A 3NHXA 1AR0A 2QIYA 4EYCA 2QA43 3FCSB 2HMLB 4LZIA 3CME3 1QVF2 1OGZA 1PFPA 3F40A 1CYVA 1TP6A 3K0ZA 3CCM3 2E2UA 4HM3B 2E2VA 3K9MC 3WODG 2W9PA 2B24B 1IV9A 2C10A 2P0MA 3G713 3NXJA 1OGXA 3CU3A 1IT7A 4LGQA 1NB5I 1KWIA 1JB4A 1TFOA 3BNEA 1IVVA 3UB1A 5IEOA 5FGOA 3N54B 3DZLA 3NBBA 2K54A 2XFSA 1ROAA 4JRFA 5KP4A 3OWSA 2V1LA 4IT7A 3Q1CA 1E3RA 3B7CA 2GU3A 4AKZA 4N6V0 3FG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQK A;  4TX4 A;  3SVA A;  4N6U A;  2CH9 A;  1R4C A;  2BO9 B;  2KXG A;  1A90 A;  5ELU A;  1WNH A;  1GD3 A;  1G96 A;  3UL5 A;  5ELJ A;  4N6M A;  3GAX A;  3Q2P A;  1N5H A;  1MOL A;  1DVD A;  3KFQ C;  1YVB I;  5EQL A;  3S67 A;  1IV7 A;  1LXE A;  3KSE D;  3IMA B;  4N6T A;  1MNL A;  3PS8 A;  4N6O B;  1N9J A;  4N6L A;  1CYU A;  3MWZ A;  3PXM A;  1RN7 A;  1CEW I;  1DVC A;  5LC7 A;  4N6N B;  2OCT A;  4EYC A;  5LC6 A;  1A67 A;  1N5P A;  1NB3 I;  2W9Q A;  4CCV A;  1FA3 A;  4LZI A;  3UL6 A;  1PFP A;  1CYV A;  1FUW A;  1M9G A;  3K9M C;  2W9P A;  5A0O B;  1TIJ A;  1IV9 A;  1STF I;  3L0R A;  2O9U X;  1NB5 I;  1KWI A;  1GD4 A;  4ZM8 A;  3QRD A;  3NX0 A;  3PYJ A;  1ROA A;  4IT7 A;  3LH4 A;  4N6V 0; 
#chains in the Genus database with same CATH topology
 1O7M B;  1BRK A;  4TX4 A;  1FGM A;  2UX0 A;  2Z6B A;  3K5T A;  5G2G A;  1JZO A;  4O02 B;  3X41 A;  2RNT A;  3M8C A;  2CHC A;  2P05 A;  2F99 A;  4MMZ B;  3V98 A;  4FMD A;  3N8B A;  4CJN A;  3ROB A;  3CC7 3;  3S5C A;  4BIR A;  4MEI A;  3SYU A;  2C11 A;  1Q86 4;  1JKG A;  1N8Q A;  1VQ9 3;  2MC8 A;  3SOY A;  4O8S A;  6GSP A;  1BNR A;  2JDI H;  3WDG B;  3FGY A;  5G1L A;  3FF0 A;  4NRE A;  2XSH B;  4WWU C;  4BTW A;  1NDO B;  3K7C A;  5EEO A;  1TU5 A;  3SXX A;  1AY7 A;  1R4Y A;  5ELU A;  1T2I A;  5AII A;  1ISK A;  4GSP A;  3X42 A;  3FKA A;  3BB9 A;  2UGI A;  3CCL 3;  5IF6 A;  3OV4 A;  1N9E A;  1IU7 A;  1G0T A;  5JPP A;  3LXU X;  1BNS A;  1GD3 A;  3EF8 A;  1HU9 A;  1G02 A;  4I4K A;  1JN5 A;  1RLS A;  3SOA A;  1DMQ A;  1JB2 A;  1SPU A;  3G6E 3;  2KF4 A;  3K63 A;  4GHO A;  4J8T A;  5ELJ A;  1YJN 3;  5D81 A;  1W4N A;  3J7Y d;  4HM6 B;  5AIF A;  1U8C B;  2CW9 A;  4ILF A;  1RN1 A;  4WP5 A;  1IK3 A;  1BRN L;  2K3D A;  2H0H A;  1Q7Y 4;  1RCK A;  1MOL A;  4ORL A;  2BNG A;  1S5A A;  5I97 A;  3CMA 3;  1RRH A;  5HGR A;  1NO3 A;  3LT9 A;  1RGE A;  3DM8 A;  5M1A A;  4J9A A;  1L5G B;  1MWR A;  2CFG A;  3SED A;  1UCK A;  3MG3 A;  2B1X B;  2WGO A;  3MSO A;  1VQ7 3;  1JJ2 2;  4LYL B;  5EQL A;  1OF5 B;  4FCJ A;  3KKG A;  4WYK B;  8RNT A;  1Z1S A;  1IT8 A;  3V92 A;  4BL2 A;  2CK3 H;  1A2K A;  5CLK A;  1OHP A;  2P09 A;  1O7G B;  2XH9 A;  1C54 A;  2Y74 A;  3CCR 3;  5IEP A;  1GY5 A;  1LXE A;  3KZT A;  3MHE A;  2PZV A;  3KSE D;  4J5G A;  3DGM A;  3WMD A;  4N6O B;  2HMK B;  1YNV X;  2RFR A;  2KCD A;  1W6C A;  5M18 A;  2KF5 A;  3KN4 A;  2R4I A;  3PXM A;  4QWT A;  1B2M A;  1LOV A;  4J5K A;  1ASK A;  1QAL A;  3JUN A;  1O7H B;  1QAK A;  1B2X A;  2RCD A;  1EG9 B;  1FGO A;  1DE3 A;  1WQL B;  1GSP A;  3WOF B;  1BSA A;  4N6N B;  1W5Z A;  4WHA A;  3GRD A;  5GSP A;  1UDI I;  2CX0 A;  4HM8 B;  2R41 A;  2YFI B;  1N5P A;  2KF3 A;  2FNQ A;  3NQZ A;  1J2B A;  3EQQ B;  1VQK 3;  4CCV A;  3CD6 3;  1FA3 A;  2RGQ A;  3JVC A;  4MMY B;  1YJ9 3;  1O7W B;  3UNL A;  3D5G A;  4JF8 A;  1K28 A;  3F7X A;  1UGI A;  1B2S A;  3NV0 B;  4LMI A;  3BND A;  3HI7 A;  4HM5 B;  3MG2 A;  3ZG0 A;  3OX9 A;  1GMQ A;  4XBX A;  1RRL A;  1YGE A;  4NHF A;  5FW5 A;  5A0O B;  1RTU A;  5CK6 A;  3L0R A;  1BNJ A;  4KVH A;  2F56 A;  4STD A;  2W56 B;  4O2H A;  1K9M 4;  2FXT A;  3G0K A;  2F5W A;  3LT8 A;  3GZY B;  3KII A;  1W01 A;  3LH4 A;  3VF1 A;  5IG5 A;  3E99 A;  3X3Z A;  4HM0 B;  4FMB A;  4R9L A;  1MWU A;  3D9R A;  7STD A;  3DMC A;  3HIG A;  1GMP A;  1EQK A;  1M1X B;  4N6U A;  3FZW A;  4RNZ A;  1FUS A;  2L1S A;  3I55 3;  4XDW A;  2CIU A;  2OOV C;  3F8X A;  3GZX B;  1BUQ A;  7RNT A;  4RNY A;  4HOH A;  4RZM A;  3ZFZ A;  2XEP A;  2OTL 3;  3T0U A;  4X2O A;  1R4C A;  5JBS A;  1RGK A;  3X3Y A;  4R4K A;  2GBX B;  2E2T A;  4K90 B;  5AYS C;  5AEW B;  3OXA A;  6STD A;  1SAR A;  3I56 3;  2BMR B;  2BHM A;  2BO9 B;  1I3F A;  3AHS A;  2GBW B;  2RSX A;  1UW1 A;  2KXG A;  1RMS A;  1SQW A;  4LSO A;  1KQS 2;  1T3B A;  4PEJ A;  2GXF A;  1PYL A;  1UCL A;  1Q42 A;  3LYG A;  4GL6 A;  1MWT A;  5BU4 A;  5BXQ A;  2GEY A;  1UUW B;  1G96 A;  1X1Y A;  1F8N A;  3EN1 B;  5IER A;  3UL5 A;  2CC3 A;  1I3I A;  4R80 A;  3SX1 A;  3JUM A;  1BAO A;  3LTA A;  4H3U A;  2Y73 A;  3O8Y A;  4OK0 A;  2BT3 A;  5IW9 A;  1I2F A;  1VQO 3;  2OOV A;  3BNB A;  2XRX B;  1EKM A;  1GOV A;  3F7S A;  3Q90 A;  1N5H A;  3DGL A;  4FMA A;  4FCZ A;  4N3V A;  3HZP A;  4OUQ A;  3CXC 2;  1KD1 4;  1HYF A;  3S28 A;  3CCJ 3;  3NQY A;  1EEJ A;  1RGL A;  1OHO A;  2A15 A;  1BRH A;  1CH0 A;  5AYR B;  1JB5 A;  1Q9E A;  1UI8 A;  2Z76 A;  1Q40 A;  1VQ4 3;  3MKI A;  4G1M B;  1SJW A;  1X1U A;  1LOY A;  1IV7 A;  4HM2 B;  1BNI A;  3LZA A;  4HZB B;  3T8N A;  4BTX A;  1BSC A;  1JV2 B;  4EC6 A;  1W02 A;  3IMA B;  1IVW A;  2C4B A;  2XFT A;  4N6T A;  2F86 B;  3PS8 A;  2HMJ B;  2W03 A;  3G4S 3;  3EE1 A;  4KFE A;  1JKG B;  1QJG A;  2F98 A;  1HZ1 A;  1NJI 4;  3DY5 A;  3IPT A;  3ZG5 A;  3U97 A;  2P0X A;  1DVC A;  4EW5 A;  1I2G A;  4O3V A;  3F8H A;  3S29 A;  1B21 A;  5D83 A;  2O3O A;  1STD A;  2F5M A;  5HOH A;  1HKX A;  2OCT A;  4AKY A;  1M90 4;  4KFD A;  1NU3 A;  1W2B 2;  1I0X A;  2LYX A;  4EV2 A;  1ROV A;  1ULI B;  2CFD A;  5LC6 A;  1Q81 4;  1DMM A;  1T2H A;  2GEX A;  2F4Y A;  1EUI C;  2L4V A;  4HM1 B;  4U13 A;  3DGO A;  3WA2 X;  1JN5 B;  3UL6 A;  3AGN A;  2YX9 A;  2XSO B;  1FUW A;  5AIH A;  1BNG A;  3G8Z A;  3NUV A;  1M9G A;  1E3V A;  1W6G A;  4DKI A;  1LOW A;  4MJD A;  3PCS A;  1TIJ A;  3D79 A;  3PZW A;  1VQN 3;  3N9H A;  2CG1 A;  3CCE 3;  5CXO A;  2SBL A;  1RN4 A;  1STF I;  1X1X A;  2O9U X;  3DUK A;  2SAR A;  4HM4 B;  1GD4 A;  2GSP A;  1BRJ A;  1VZZ A;  1VQQ A;  1FW7 A;  1FGR A;  3FSD A;  4ZM8 A;  1QVG 2;  3QRD A;  3D4A A;  1VQL 3;  3NX0 A;  3PYJ A;  3B4O A;  1RGG A;  1IVU A;  5CF2 A;  2D42 A;  1SII A;  3PCR A;  1BU4 A;  3NM2 A;  4EXR A;  5IEN A;  2INX A;  2Z77 A;  3RDE A;  2XR8 B;  4HZ9 B;  4I5Q A;  4HKV B;  1O7N B;  2H0G A;  1DYU A;  1I70 A;  1OPY A;  3A5E A;  1LOX A;  3SVA A;  2OQE C;  1T5Y A;  5G1K A;  2HMO B;  3T8U A;  1M1K 4;  2IUJ A;  4HM7 B;  1OUN A;  2AAE A;  5IG3 A;  5EVH A;  1AVL A;  2D1W A;  3NM7 A;  4XDV A;  5AIG A;  2HMM B;  3BIR A;  1VQ8 3;  2PNC A;  1GY7 A;  1B3S A;  3VGN A;  3FH1 A;  3MPH A;  1YHQ 3;  2W2C A;  3CPW 2;  1QMA A;  3H3H A;  1VQ6 3;  3RGR A;  3AMO A;  1A90 A;  1BUJ A;  3BLZ A;  1CQS A;  2RBI A;  1VQ5 3;  1WNH A;  3CPO A;  4L7K A;  3RGA A;  5BVB A;  1OH0 A;  4IPB A;  1MGW A;  3CNM A;  3NBJ A;  1BSE A;  3QK9 A;  2IUK A;  1BRG A;  1LQM B;  2ZL8 A;  5RNT A;  3MYT A;  2ML6 A;  3B4P A;  4KT3 B;  3WA3 A;  2UUG C;  1ULJ B;  2W6J H;  4N6M A;  1OCV A;  1RJO A;  2OQE A;  2IA7 A;  1K8A 4;  1IDP A;  1JRQ A;  1DMN A;  3UJM A;  2CFK A;  3Q2P A;  2OTJ 3;  1W2Z A;  2P38 A;  3GSP A;  8CHO A;  1Q7H A;  4KZ1 A;  1DVD A;  3LML A;  3KFQ C;  4XBT A;  3V99 A;  3F9S A;  1E97 A;  2ZA4 A;  4LEH A;  3JUP A;  3LOY A;  1GS3 A;  1RGC A;  3LTB A;  1I8V A;  4K1U A;  3DGY A;  3CCQ 3;  2CKF B;  1JNQ A;  3S67 A;  1YJW 3;  1N8R 4;  3B8L A;  5KP1 A;  3HII A;  3OWY A;  4BU4 A;  3F14 A;  4HVN A;  4HAA A;  3CCS 3;  1RGA A;  5TGN A;  2W0Q A;  1SIH A;  4KFF A;  1KSI A;  2W04 A;  3STD A;  3I0Y A;  1K41 A;  1YVS A;  3NBR A;  4GB5 A;  1VQM 3;  3A76 A;  3FLJ A;  1JBR A;  2CG0 A;  3JUQ A;  1YIT 3;  1WMN A;  6RNT A;  1UCJ A;  1MNL A;  1LRA A;  1GYB A;  1UUG B;  1N9J A;  1UI7 A;  1WMP A;  2YFJ B;  3BNC A;  3FG1 A;  1BSD A;  3H51 A;  3MWZ A;  4RNT A;  3KSP A;  1RN7 A;  2KRT A;  1B2U A;  4HYZ A;  2QGU A;  2WOH A;  2J8X B;  1RGH A;  4R1K A;  3G16 A;  3ER7 A;  3KE7 A;  5IG0 A;  4L8P A;  1OHS A;  3JUO A;  4WFO A;  2JQ5 A;  3HK4 A;  3Q3F A;  1RNB A;  1BNF A;  1UCI A;  2CFL A;  2YFL B;  1A67 A;  1NB3 I;  2W9Q A;  1BNE A;  1BSB A;  2CWT A;  4K1V A;  4R9K A;  2Z7A A;  1NWW A;  3EX9 A;  3U1W A;  1W6Y A;  1Q82 4;  5KP3 A;  4EBG A;  5AEU B;  1ZO2 A;  3OW2 2;  1IYY A;  5CF1 A;  1MGR A;  3HX8 A;  4XB5 A;  3AGO A;  3EB8 A;  1ZS7 A;  5D82 A;  1LNI A;  4RBN A;  1ZX2 A;  5DRV A;  1C7H A;  1RNT A;  3GZR A;  1BRI A;  1GOY A;  1OF5 A;  1GOU A;  1RDS A;  4WYK A;  4BL3 A;  1BRS A;  1Q40 B;  2XF3 A;  1KC8 4;  5M19 A;  1I0V A;  2CWV A;  2KAA A;  1K73 4;  5STD A;  1LVN A;  2CWU A;  2M7O A;  2WO0 A;  4HJL B;  2WOF A;  1W7C A;  2XGN A;  3EHC A;  3GWR A;  4EV5 A;  2CH9 A;  1RHL A;  1V58 A;  4AEQ A;  9RNT A;  2XGL A;  1TFK A;  3AHW A;  1LNH A;  3DH2 A;  3DXO A;  3X3X A;  3ALA A;  1FYS A;  4CDL A;  3D5I A;  3EJV A;  3CCV 3;  4FMC A;  1AVK A;  4HBR A;  3OWU A;  1TTO A;  1IQX A;  1ZGX A;  1BAN A;  2BIR A;  3CC2 3;  3EBT A;  2BMQ B;  2STD A;  3FG4 A;  2I9W A;  1BIR A;  3DGN A;  2IYJ A;  4X2H A;  3MG1 A;  3CC4 3;  1RSN A;  7GSP A;  4XM4 A;  3LTD A;  1WMO A;  1RKY A;  1U5O A;  2Q07 A;  1Y4K A;  3EC9 A;  5DRE A;  1US1 A;  3PGB A;  3VSY A;  3D3L A;  3LTC A;  2BU4 A;  2QEX 3;  3BU4 A;  2MF7 A;  3KCH A;  3NV0 A;  4FR9 A;  1S72 3;  3CNX A;  2FGT A;  1BVI A;  2K0M A;  1NNV A;  2ZDJ A;  3EN8 A;  4Q53 A;  3FF2 A;  3GAX A;  2WGQ A;  1GMR A;  1FGQ A;  4K61 A;  1IVX A;  1GY6 A;  2HMN B;  4L8O A;  2LQV A;  3ECF A;  1TRQ A;  1YIJ 3;  2AAD A;  1FGT A;  1YVB I;  2OWP A;  1D6Y A;  1OAC A;  2ML5 A;  2W56 A;  2GU3 A;  4BTY A;  3CCU 3;  4MMX B;  3WOE B;  1AQZ A;  1O7P B;  4IIA A;  2IMJ A;  3TDG A;  2ZHX B;  1UUV B;  1B2Z A;  1AV4 A;  1V74 A;  3HOH A;  5JPU A;  2H0I A;  3X40 A;  4XBY A;  1WTH A;  1D6U A;  2BMO B;  1IQ8 A;  1QAF A;  1FZU A;  3SLU A;  4CPK A;  2IY2 A;  1EA2 A;  4N6L A;  3IJE B;  5AI1 A;  4OVM A;  5IG4 A;  1CYU A;  1A2V A;  3GZB A;  1VQP 3;  1BOX A;  1YI2 3;  1JBT A;  3WHO A;  1CEW I;  1TUH A;  1I2E A;  1W00 A;  2KF6 A;  1D6Z A;  2CFW A;  3EBY A;  5LC7 A;  4FCM A;  3AMO B;  4H61 A;  1PU4 A;  3S27 A;  2GU1 A;  3NHX A;  1AR0 A;  2QIY A;  1UGH I;  4EYC A;  2QA4 3;  1X1W A;  4NPB A;  3FCS B;  2HML B;  1B27 A;  4LZI A;  3CME 3;  1QVF 2;  1JBS A;  1FUT A;  1OGZ A;  1PFP A;  3F40 A;  5BIR A;  1CYV A;  1TP6 A;  3K0Z A;  3CCM 3;  2E2U A;  1B20 A;  4HM3 B;  2E2V A;  3K9M C;  3WOD G;  2W9P A;  2B24 B;  1TRP A;  3RNT A;  1IV9 A;  2C10 A;  2P0M A;  3G71 3;  1PY3 A;  1OGX A;  3CU3 A;  1JZD A;  1IT7 A;  3NXJ A;  1V57 A;  2CX1 A;  4LGQ A;  3WR2 A;  1NB5 I;  1KWI A;  1A2P A;  1JB4 A;  1TFO A;  3BNE A;  1IVV A;  3UB1 A;  1RGF A;  1DET A;  1TJD A;  3N54 B;  5FGO A;  5IEO A;  1LQG C;  3DZL A;  3NBB A;  1BGS A;  2K54 A;  2HOH A;  2XFS A;  1ROA A;  4JRF A;  1YGW A;  3OWS A;  2V1L A;  4IT7 A;  5KP4 A;  3Q1C A;  1MWS A;  1E3R A;  3B7C A;  1IQY A;  1RCL A;  4AKZ A;  4N6V 0;  3URP A;  3FG3 A; 
#chains in the Genus database with same CATH homology
 1O7M B;  4TX4 A;  1FGM A;  2UX0 A;  2Z6B A;  3K5T A;  5G2G A;  4O02 B;  3X41 A;  3V98 A;  3M8C A;  2CHC A;  2P05 A;  2F99 A;  4MMZ B;  4FMD A;  3N8B A;  3CC7 3;  3ROB A;  3S5C A;  4MEI A;  2C11 A;  1Q86 4;  1JKG A;  1N8Q A;  1VQ9 3;  2MC8 A;  3SOY A;  4O8S A;  2JDI H;  3WDG B;  3FGY A;  3FF0 A;  4NRE A;  2XSH B;  4WWU C;  4BTW A;  1NDO B;  3K7C A;  5EEO A;  1TU5 A;  3SXX A;  5ELU A;  5AII A;  1ISK A;  3X42 A;  3FKA A;  3BB9 A;  5IF6 A;  3OV4 A;  1N9E A;  1IU7 A;  5JPP A;  3LXU X;  1GD3 A;  3EF8 A;  1HU9 A;  4I4K A;  1JN5 A;  3SOA A;  1DMQ A;  1JB2 A;  1SPU A;  3G6E 3;  3K63 A;  4J8T A;  5ELJ A;  1YJN 3;  5D81 A;  1W4N A;  3J7Y d;  4HM6 B;  5AIF A;  1U8C B;  2CW9 A;  4WP5 A;  1IK3 A;  1Q7Y 4;  1MOL A;  4ORL A;  2BNG A;  1S5A A;  5I97 A;  3CMA 3;  1RRH A;  5HGR A;  1NO3 A;  3LT9 A;  3DM8 A;  1L5G B;  4J9A A;  2CFG A;  3SED A;  3MG3 A;  2B1X B;  2WGO A;  3MSO A;  1VQ7 3;  1JJ2 2;  5EQL A;  1OF5 B;  4FCJ A;  3KKG A;  4WYK B;  1Z1S A;  1IT8 A;  3V92 A;  2CK3 H;  1A2K A;  5CLK A;  1OHP A;  2P09 A;  1O7G B;  2XH9 A;  2Y74 A;  3CCR 3;  5IEP A;  1GY5 A;  1LXE A;  3KZT A;  3MHE A;  2PZV A;  3KSE D;  3DGM A;  3WMD A;  4N6O B;  2HMK B;  2RFR A;  2KCD A;  1W6C A;  3KN4 A;  2R4I A;  3PXM A;  4QWT A;  1ASK A;  1QAL A;  3JUN A;  1O7H B;  1QAK A;  2RCD A;  1EG9 B;  1FGO A;  1WQL B;  3WOF B;  4N6N B;  1W5Z A;  4WHA A;  3GRD A;  4HM8 B;  2YFI B;  1N5P A;  2FNQ A;  3NQZ A;  1J2B A;  3EQQ B;  1VQK 3;  4CCV A;  3CD6 3;  1FA3 A;  2RGQ A;  3JVC A;  4MMY B;  1YJ9 3;  1O7W B;  3UNL A;  4JF8 A;  1K28 A;  3F7X A;  3NV0 B;  4LMI A;  3BND A;  3HI7 A;  4HM5 B;  3MG2 A;  3OX9 A;  4XBX A;  1RRL A;  1YGE A;  4NHF A;  5FW5 A;  5A0O B;  5CK6 A;  3L0R A;  4KVH A;  4STD A;  2W56 B;  4O2H A;  1K9M 4;  2FXT A;  3G0K A;  3LT8 A;  3GZY B;  3KII A;  1W01 A;  3LH4 A;  3VF1 A;  5IG5 A;  3E99 A;  3X3Z A;  4HM0 B;  4FMB A;  4R9L A;  3D9R A;  7STD A;  3DMC A;  3HIG A;  1EQK A;  1M1X B;  4N6U A;  3FZW A;  4RNZ A;  3I55 3;  4XDW A;  2CIU A;  2OOV C;  3F8X A;  3GZX B;  1BUQ A;  4RNY A;  4RZM A;  2XEP A;  2OTL 3;  3T0U A;  4X2O A;  1R4C A;  5JBS A;  3X3Y A;  4R4K A;  2GBX B;  2E2T A;  4K90 B;  5AYS C;  5AEW B;  3OXA A;  6STD A;  3I56 3;  2BMR B;  2BHM A;  2BO9 B;  2GBW B;  2RSX A;  1UW1 A;  2KXG A;  1SQW A;  4LSO A;  1KQS 2;  4PEJ A;  2GXF A;  1Q42 A;  3LYG A;  4GL6 A;  5BXQ A;  2GEY A;  1UUW B;  1G96 A;  3EN1 B;  1F8N A;  5IER A;  3UL5 A;  2CC3 A;  4R80 A;  3SX1 A;  3JUM A;  3LTA A;  4H3U A;  2Y73 A;  3O8Y A;  4OK0 A;  2BT3 A;  5IW9 A;  1VQO 3;  2OOV A;  3BNB A;  2XRX B;  1EKM A;  3F7S A;  3Q90 A;  1N5H A;  3DGL A;  4FMA A;  4FCZ A;  4N3V A;  3HZP A;  4OUQ A;  3CXC 2;  1KD1 4;  3S28 A;  3CCJ 3;  3NQY A;  1OHO A;  2A15 A;  5AYR B;  1JB5 A;  1UI8 A;  2Z76 A;  1Q40 A;  1VQ4 3;  3MKI A;  4G1M B;  1SJW A;  1IV7 A;  4HM2 B;  3LZA A;  4HZB B;  3T8N A;  4BTX A;  1JV2 B;  4EC6 A;  1W02 A;  3IMA B;  1IVW A;  2XFT A;  4N6T A;  2F86 B;  3PS8 A;  2W03 A;  2HMJ B;  3G4S 3;  3EE1 A;  4KFE A;  1JKG B;  1QJG A;  2F98 A;  1NJI 4;  3DY5 A;  3IPT A;  3U97 A;  2P0X A;  1DVC A;  4O3V A;  3F8H A;  1IQY A;  3S29 A;  5D83 A;  2O3O A;  1STD A;  1HKX A;  2OCT A;  4AKY A;  1M90 4;  4KFD A;  1NU3 A;  1W2B 2;  2LYX A;  1Q81 4;  4EV2 A;  1ROV A;  1ULI B;  2CFD A;  5LC6 A;  1DMM A;  2GEX A;  2L4V A;  4HM1 B;  4U13 A;  3DGO A;  3WA2 X;  1JN5 B;  3UL6 A;  2YX9 A;  2XSO B;  1FUW A;  5AIH A;  3G8Z A;  3NUV A;  1M9G A;  1E3V A;  1W6G A;  4MJD A;  3PCS A;  1TIJ A;  3PZW A;  1VQN 3;  3N9H A;  2CG1 A;  3CCE 3;  5CXO A;  2SBL A;  1STF I;  2O9U X;  3DUK A;  4HM4 B;  1GD4 A;  1VZZ A;  1FGR A;  3FSD A;  4ZM8 A;  1QVG 2;  3QRD A;  1VQL 3;  3NX0 A;  3PYJ A;  3B4O A;  1IVU A;  5CF2 A;  2D42 A;  1SII A;  3PCR A;  4EXR A;  3NM2 A;  5IEN A;  2INX A;  2Z77 A;  3RDE A;  2XR8 B;  4HZ9 B;  4HKV B;  1O7N B;  3SVA A;  1DYU A;  1OPY A;  1LOX A;  2OQE C;  1T5Y A;  2HMO B;  3T8U A;  1M1K 4;  2IUJ A;  4HM7 B;  1OUN A;  5IG3 A;  5EVH A;  1AVL A;  2D1W A;  3NM7 A;  4XDV A;  5AIG A;  2HMM B;  1VQ8 3;  2PNC A;  1GY7 A;  3VGN A;  3FH1 A;  3MPH A;  1YHQ 3;  2W2C A;  3CPW 2;  1QMA A;  3H3H A;  1VQ6 3;  3RGR A;  3AMO A;  1A90 A;  3BLZ A;  1CQS A;  1VQ5 3;  1WNH A;  3CPO A;  4L7K A;  3RGA A;  5BVB A;  1OH0 A;  4IPB A;  3CNM A;  3NBJ A;  3QK9 A;  2IUK A;  2ZL8 A;  3MYT A;  2ML6 A;  3B4P A;  3WA3 A;  1ULJ B;  2W6J H;  4N6M A;  1OCV A;  1RJO A;  2OQE A;  2IA7 A;  1K8A 4;  1IDP A;  1JRQ A;  1DMN A;  3UJM A;  2CFK A;  3Q2P A;  2OTJ 3;  1W2Z A;  2P38 A;  8CHO A;  1DVD A;  4KZ1 A;  3LML A;  3KFQ C;  4XBT A;  3V99 A;  3F9S A;  1E97 A;  4LEH A;  3JUP A;  3LOY A;  1GS3 A;  3LTB A;  3CCQ 3;  4K1U A;  1YJW 3;  2CKF B;  1JNQ A;  3S67 A;  1N8R 4;  3B8L A;  5KP1 A;  3HII A;  3OWY A;  3CCS 3;  3F14 A;  4HVN A;  5TGN A;  2W0Q A;  1SIH A;  4KFF A;  1KSI A;  2W04 A;  3STD A;  3I0Y A;  1K41 A;  3NBR A;  4GB5 A;  1VQM 3;  3A76 A;  3FLJ A;  2CG0 A;  3JUQ A;  1YIT 3;  1WMN A;  1MNL A;  2YFJ B;  1GYB A;  1N9J A;  1UI7 A;  1WMP A;  3BNC A;  3FG1 A;  3H51 A;  3MWZ A;  3CCL 3;  3KSP A;  1RN7 A;  2KRT A;  4HYZ A;  2WOH A;  2QGU A;  4R1K A;  3G16 A;  3ER7 A;  3KE7 A;  5IG0 A;  4L8P A;  1OHS A;  3JUO A;  4WFO A;  2JQ5 A;  3HK4 A;  1A67 A;  2CFL A;  2YFL B;  1NB3 I;  2W9Q A;  2CWT A;  4K1V A;  4R9K A;  2Z7A A;  1NWW A;  3EX9 A;  3U1W A;  1W6Y A;  1Q82 4;  5KP3 A;  4EBG A;  5AEU B;  1ZO2 A;  3OW2 2;  5CF1 A;  3HX8 A;  4XB5 A;  3EB8 A;  5D82 A;  4RBN A;  1ZX2 A;  5DRV A;  1C7H A;  3GZR A;  1OF5 A;  4WYK A;  1KC8 4;  1Q40 B;  2XF3 A;  2CWV A;  1K73 4;  5STD A;  1LVN A;  2CWU A;  2M7O A;  2WO0 A;  4HJL B;  2WOF A;  1W7C A;  2XGN A;  3EHC A;  3GWR A;  4EV5 A;  2CH9 A;  4AEQ A;  2XGL A;  1TFK A;  3DXO A;  1LNH A;  3X3X A;  3ALA A;  4CDL A;  3EJV A;  3CCV 3;  4FMC A;  1AVK A;  4HBR A;  3OWU A;  1IQX A;  3CC2 3;  3EBT A;  2BMQ B;  2STD A;  3FG4 A;  2I9W A;  3DGN A;  4X2H A;  3MG1 A;  3CC4 3;  4XM4 A;  3LTD A;  1WMO A;  1RKY A;  1U5O A;  2Q07 A;  1Y4K A;  3EC9 A;  5DRE A;  1US1 A;  3PGB A;  3VSY A;  3D3L A;  3LTC A;  2QEX 3;  2MF7 A;  3NV0 A;  4FR9 A;  1S72 3;  3CNX A;  2FGT A;  2K0M A;  2ZDJ A;  3EN8 A;  4Q53 A;  3FF2 A;  3GAX A;  2WGQ A;  4K61 A;  1FGQ A;  1IVX A;  1GY6 A;  2HMN B;  4L8O A;  2LQV A;  3ECF A;  1YIJ 3;  1FGT A;  1YVB I;  2OWP A;  1D6Y A;  1OAC A;  2ML5 A;  2W56 A;  4BTY A;  3CCU 3;  4MMX B;  3WOE B;  1O7P B;  4IIA A;  2IMJ A;  3TDG A;  1UUV B;  1AV4 A;  1V74 A;  5JPU A;  3X40 A;  4XBY A;  1WTH A;  1D6U A;  2BMO B;  1IQ8 A;  1QAF A;  3SLU A;  1EA2 A;  4N6L A;  3IJE B;  5AI1 A;  4OVM A;  5IG4 A;  1CYU A;  1A2V A;  3GZB A;  1VQP 3;  1YI2 3;  1CEW I;  1TUH A;  1W00 A;  3EBY A;  1D6Z A;  2CFW A;  5LC7 A;  4FCM A;  3AMO B;  4H61 A;  1PU4 A;  3S27 A;  2GU1 A;  3NHX A;  1AR0 A;  2QIY A;  4EYC A;  2QA4 3;  3FCS B;  2HML B;  4LZI A;  3CME 3;  1QVF 2;  1OGZ A;  1PFP A;  3F40 A;  1CYV A;  1TP6 A;  3K0Z A;  3CCM 3;  2E2U A;  4HM3 B;  2E2V A;  3K9M C;  3WOD G;  2W9P A;  2B24 B;  1IV9 A;  2C10 A;  2P0M A;  3G71 3;  3NXJ A;  1OGX A;  3CU3 A;  1IT7 A;  4LGQ A;  1NB5 I;  1KWI A;  1JB4 A;  1TFO A;  3BNE A;  1IVV A;  3UB1 A;  5IEO A;  5FGO A;  3N54 B;  3DZL A;  3NBB A;  2K54 A;  2XFS A;  1ROA A;  4JRF A;  5KP4 A;  3OWS A;  2V1L A;  4IT7 A;  3Q1C A;  1E3R A;  3B7C A;  2GU3 A;  4AKZ A;  4N6V 0;  3FG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...