5ELUA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
NENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVDLTRFPVTTMYYLTLEAKDGGKKKLYEAKVWVKGYLLEELKHNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-Affirmer-S2B3
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eluA00
4LZIA 3MWZA 1RN7A 1IV7A 4CCVA 3K9MC 1FUWA 2W9PA 2BO9B 1GD3A 3PXMA 1GD4A 4N6NB 1STFI 1N5HA 1YVBI 1EQKA 2CH9A 1ROAA 4ZM8A 4N6MA 2OCTA 3UL6A 4N6UA 3IMAB 3UL5A 5ELUA 3NX0A 4EYCA 1PFPA 3SVAA 5ELJA 3QRDA 1NB5I 3S67A 3LH4A 1KWIA 1N5PA 3PYJA 1N9JA 3KSED 4N6LA 5A0OB 1G96A 1LXEA 1A67A 1WNHA 1A90A 5LC7A 4N6V0 2W9QA 1R4CA 1IV9A 1MOLA 5LC6A 4TX4A 5EQLA 1TIJA 2O9UX 1M9GA 1CEWI 4IT7A 4N6OB 1DVDA 3Q2PA 3L0RA 3KFQC 1CYUA 1DVCA 2KXGA 1MNLA 4N6TA 3PS8A 1NB3I 3GAXA 1CYVA 1FA3A
chains in the Genus database with same CATH superfamily
3CXC2 1I2EA 1WQLB 1RN7A 2GEYA 3I0YA 1RRLA 1C54A 1IV7A 2Z77A 4BTWA 2D1WA 1IU7A 2GU3A 3ZFZA 2RCDA 1ASKA 1SJWA 4BIRA 3OWSA 1WMPA 1G02A 1T3BA 1Q42A 3X41A 3MKIA 8CHOA 3KN4A 1FW7A 4L8PA 1RGEA 2FNQA 3GZBA 1SQWA 1EUIC 4HZBB 4R9LA 1VQP3 4OK0A 1VQ83 1X1WA 2CKFB 1EQKA 4MMXB 1BUQA 1IQYA 1BNFA 5TGNA 3ROBA 1HZ1A 2L4VA 3HZPA 1YIJ3 3CC43 2XR8B 3X3YA 2CH9A 1MWTA 1ROAA 3NXJA 4HVNA 1KD14 1LQMB 2BIRA 2Q07A 3AHWA 4H3UA 2GBWB 3N54B 4RNZA 3SOYA 4ZM8A 4HM0B 3UL6A 5M19A 3VGNA 3UL5A 3S28A 4EYCA 3GZRA 4LSOA 4EW5A 1I3IA 1W02A 3NBJA 1RGHA 2XEPA 1NO3A 1US1A 2H0GA 3WODG 4XBYA 1LNIA 1OHPA 3EBTA 1FUSA 2CFGA 2JQ5A 2Z7AA 1ZS7A 3V99A 1IVWA 5HOHA 1JJ22 2Y74A 4XB5A 3S67A 1RJOA 5AIGA 3JUMA 1KWIA 2AADA 1FZUA 9RNTA 4J9AA 2KCDA 4BU4A 1MWUA 2RNTA 3I563 1K9M4 2CHCA 1AV4A 5G2GA 3FLJA 5AYRB 1W00A 2W04A 3GZXB 1JNQA 3CU3A 3J7Yd 4RBNA 1W4NA 3PCRA 2XSOB 3CMA3 1BNEA 1RHLA 1OACA 2HOHA 1E97A 1CH0A 3NHXA 6RNTA 1Q7Y4 4R1KA 2XSHB 2W56A 3CD63 4OVMA 2HMKB 4HM2B 5IF6A 3DH2A 1SARA 3A76A 2XH9A 1I2GA 1TRPA 4XDVA 3CCQ3 1QVG2 1B2XA 3FG1A 3OV4A 4K1VA 1YJW3 1LXEA 1MWRA 5AI1A 1KSIA 1K28A 1BRHA 2HMLB 3UB1A 3U1WA 3CCM3 3OW22 2XGNA 3DM8A 2H0HA 1D6YA 3OXAA 1TP6A 1R4CA 5CXOA 1M1K4 3FKAA 1Q40B 1HYFA 3KIIA 1F8NA 2IMJA 4FCZA 3T8NA 3D3LA 2RFRA 4L8OA 5LC6A 3GSPA 4TX4A 4HKVB 2CW9A 2O9UX 4HZ9B 4R9KA 2YFLB 1E3VA 3WHOA 3OWYA 4WFOA 5FGOA 3S27A 3M8CA 1OPYA 1V57A 2QGUA 5IERA 4EXRA 5I97A 4KFEA 2CK3H 3FG4A 1VQM3 1BRJA 1STDA 3JUOA 4WP5A 1W6CA 1T2HA 1UUVB 4HM8B 3SYUA 1IVUA 1DVCA 1NU3A 3NM2A 4HM7B 4RZMA 2F56A 4WHAA 4LGQA 3PZWA 4KFFA 3BU4A 1O7NB 4L7KA 4N6TA 3G0KA 4X2OA 5D83A 1JBTA 1NB3I 2XFSA 3MG2A 3JUNA 5M18A 1PY3A 3IPTA 3RDEA 3V98A 2CFKA 1DYUA 3LTAA 4NHFA 4R4KA 4FMBA 4GHOA 3CCJ3 4U13A 3FZWA 3KSPA 2IUKA 2P0XA 3NBBA 4XDWA 3SOAA 5EEOA 3I553 4EC6A 2BO9B 1TTOA 2K54A 4HJLB 1QVF2 1MGWA 4O02B 3G16A 2XFTA 4BL3A 2YFIB 3PXMA 3DZLA 4EBGA 3CCV3 1DETA 3B8LA 1BSBA 3CCL3 3WOFB 3FSDA 1LOYA 4LMIA 1NWWA 2F5MA 2HMOB 3CCS3 1B2MA 4HM4B 1L5GB 1LNHA 3FGYA 3NQYA 1UI7A 5AEWB 6STDA 1GOUA 3FF2A 2CWVA 1JBSA 3Q1CA 3T0UA 1BNSA 2BNGA 1V74A 3LTCA 4ORLA 1JKGA 1BSDA 2SARA 1RNBA 5D81A 1X1UA 3BIRA 3BNCA 1VQL3 1PYLA 1Q814 3B7CA 4HM3B 1UW1A 1JBRA 5M1AA 1N8QA 1Q40A 3B4PA 2K3DA 2F5WA 4IIAA 1RN1A 2KF3A 3ALAA 3NX0A 3RGRA 1FGMA 1TU5A 1FGRA 1PFPA 1OUNA 3SVAA 4HM1B 4XBTA 1YJN3 1OCVA 3F7SA 4N3VA 5ELJA 1X1XA 7GSPA 4O2HA 6GSPA 1NB5I 4HM5B 3EF8A 1GMRA 3LH4A 1IYYA 5AIIA 4KT3B 4J5GA 4O3VA 2L1SA 3WA3A 1MGRA 3NBRA 1O7GB 3RNTA 2W2CA 3N8BA 1M1XB 2GSPA 2YFJB 2XRXB 3KSED 5CF1A 1UCKA 1JB4A 3F40A 5BVBA 4N6LA 1VQ53 1C7HA 4RNTA 1K8A4 5A0OB 1I70A 1K41A 3K0ZA 4K61A 1GOVA 2Z6BA 3CC73 2RGQA 1ZX2A 3AGOA 4WYKB 1AQZA 2HMJB 2I9WA 4PEJA 1YNVX 2AAEA 3JUPA 1WNHA 3HI7A 1G0TA 5LC7A 4AKZA 4STDA 3LYGA 1U5OA 1TFKA 2W9QA 4N6V0 4Q53A 1B2ZA 1QJGA 4MEIA 1FGTA 1LQGC 2CWUA 5JPUA 1VZZA 1AY7A 4AKYA 1B21A 1IV9A 1RGLA 1UCIA 3K5TA 3Q90A 3B4OA 3ZG0A 3BB9A 2C10A 2JDIH 1UCLA 3D5IA 3E99A 2XGLA 3MHEA 2KF5A 4QWTA 4G1MB 1BSAA 2QA43 4IT7A 4N6OB 4NPBA 3HOHA 3VF1A 1IT8A 4AEQA 5KP1A 1TRQA 2E2TA 2MF7A 1RGGA 2W0QA 1WMNA 5IEPA 3KFQC 1O7WB 2LQVA 5DRVA 1M904 1IQ8A 3JUQA 5IG0A 1YGWA 1ZO2A 2UGIA 3D5GA 5KP3A 4CPKA 1ISKA 3DGMA 1RN4A 3X3ZA 1B2UA 2OQEA 1CYVA 3WA2X 1O7MB 2KRTA 3G8ZA 1B2SA 3F9SA 3EQQB 1CQSA 4LZIA 3NV0B 5RNTA 3MWZA 2GBXB 2ML6A 3URPA 3BNEA 1LRAA 1ULIB 1BU4A 3FF0A 1BOXA 2W9PA 2WOHA 1QMAA 1EKMA 1YHQ3 1EEJA 1W01A 1GD3A 1Q9EA 1RMSA 3LT9A 1RLSA 3NQZA 3UNLA 1BAOA 2CWTA 1GD4A 1A2KA 2XF3A 4GSPA 4MMZB 3GWRA 4KFDA 1N5HA 4KVHA 1RCLA 4J5KA 1YVBI 3A5EA 3D9RA 3D79A 5BU4A 4WYKA 1TFOA 2OOVA 2K0MA 1MWSA 3UJMA 1BGSA 3DGNA 1T2IA 4GB5A 5G1KA 4FMAA 2IY2A 3MYTA 2R4IA 1WMOA 2ML5A 3IJEB 4XM4A 1Z1SA 4FCMA 1U8CB 1SPUA 2HMNB 4CJNA 3X40A 3PGBA 4N6MA 2OCTA 2RSXA 3ECFA 4I4KA 4N6UA 2STDA 3DUKA 3IMAB 2H0IA 4O8SA 3CPOA 3MPHA 4JF8A 5ELUA 4HM6B 1GS3A 3QK9A 3SX1A 1IK3A 1RDSA 3HK4A 3KE7A 2GEXA 1GOYA 1DE3A 5CF2A 3QRDA 3CCE3 2P05A 2P0MA 1KQS2 3AHSA 3DGYA 5AIHA 4JRFA 1N5PA 1QAKA 2KF6A 3OX9A 2A15A 4MMYB 5STDA 1BVIA 2INXA 1BNGA 1YGEA 1IT7A 1FYSA 1KC84 1VQ93 1GMPA 4XBXA 2PNCA 1YI23 1UGIA 3LZAA 3KZTA 4FMDA 4BL2A 1ULJB 1EG9B 2HMMB 2F99A 1Q824 5IG3A 3LT8A 2YX9A 1RTUA 2BMOB 1PU4A 1UUGB 1I3FA 3H3HA 2CFLA 4EV2A 3H51A 2KAAA 1N8R4 1Q864 1G96A 3CNXA 3DGLA 4RNYA 3SXXA 7STDA 1UUWB 1LOVA 1BRNL 2WGOA 1A67A 4K90B 2IUJA 2IA7A 2W03A 1A90A 1RGFA 4H61A 3DGOA 4J8TA 2BMQB 1BNRA 1DMQA 1I2FA 1RNTA 3N9HA 1FUTA 2UX0A 4HOHA 3AMOB 1Y4KA 2W56B 2LYXA 1RGKA 1VQK3 1OF5B 2ZDJA 3X3XA 5EQLA 1TIJA 3G6E3 1VQ63 2R41A 3O8YA 1I0VA 2D42A 2Y73A 1J2BA 1GY5A 1ZGXA 3D4AA 4GL6A 2OWPA 4WWUC 2MC8A 5D82A 3WR2A 2QEX3 1BUJA 1BNJA 1BRKA 2E2UA 1I8VA 3Q2PA 1DVDA 4LEHA 1BRIA 3DMCA 3NM7A 1B3SA 1BRGA 1IQXA 3EHCA 1TUHA 4EV5A 1FGOA 1ROVA 5BXQA 1W6GA 1CYUA 1W5ZA 2KXGA 4HAAA 1NJI4 1GY6A 3EJVA 3DXOA 1BANA 3EB8A 5IEOA 3BNBA 2E2VA 1OH0A 1B27A 2SBLA 3T8UA 1QALA 3PS8A 1W6YA 4K1UA 1GSPA 5CK6A 3GAXA 3EN1B 3TDGA 3LTBA 3G4S3 3STDA 3LOYA 1NNVA 3V92A 1FA3A 3KKGA 1S723 2OQEC 1VQO3 1UCJA 1OGZA 2CG1A 3CPW2 1GMQA 1JZOA 1RGCA 3OWUA 4HYZA 3X42A 1O7HB 1LVNA 4BTXA 4CCVA 3K9MC 1VQ73 1FUWA 2O3OA 2WOFA 1BSEA 1JRQA 2C11A 3WDGB 3MG3A 3SLUA 3BNDA 3SEDA 1K734 1IDPA 2CFDA 2ZL8A 2GXFA 1O7PB 3U97A 1BIRA 3GZYB 4N6NB 5JPPA 1STFI 1T5YA 3EBYA 2F98A 4X2HA 5AIFA 2WGQA 4CDLA 1WTHA 3HIGA 3HX8A 1VQQA 2F86B 3EN8A 1W7CA 3MSOA 5IG4A 3CME3 2OOVC 1SIHA 4BTYA 5KP4A 3EE1A 1UDII 3LTDA 1BRSA 1UI8A 2CC3A 2CG0A 1W2ZA 3CC23 2CX0A 4FR9A 4ILFA 4FMCA 3AMOA 1B20A 2ZHXB 5BIRA 3DY5A 4OUQA 1OF5A 1DMNA 1JB2A 4KZ1A 3PCSA 1QAFA 4NREA 1YIT3 5EVHA 1SIIA 2OTJ3 3Q3FA 1AVLA 1JN5B 1UGHI 1JKGB 1GYBA 3BLZA 3GRDA 5HGRA 1S5AA 3FH1A 1V58A 3PYJA 3WOEB 1N9JA 2M7OA 1A2VA 1HKXA 1JB5A 5JBSA 2OTL3 1Q7HA 3F14A 2IYJA 1D6ZA 2B24B 3F8HA 3CCR3 3NUVA 3VSYA 2BT3A 1X1YA 1GY7A 4I5QA 2KF4A 5IW9A 4R80A 3HIIA 1R4YA 1OHOA 4IPBA 5CLKA 8RNTA 3F8XA 3G713 1NDOB 3CNMA 3ER7A 1E3RA 3F7XA 2BMRB 1BSCA 1OGXA 3ZG5A 2W6JH 4DKIA 1RCKA 1YVSA 2C4BA 1AVKA 3AGNA 1DMMA 5AYSC 1BNIA 1W2B2 2P09A 4HBRA 1IVVA 2J8XB 2CFWA 2GU1A 1RGAA 1RRHA 1TJDA 1N9EA 1OHSA 3FCSB 4FCJA 5IENA 1LOXA 2BHMA 1MOLA 2UUGC 3RGAA 1VQ43 2CIUA 2QIYA 3KCHA 2WO0A 3JVCA 1RKYA 1M9GA 1CEWI 3LMLA 3EC9A 1AR0A 3K63A 1I0XA 2B1XB 3S5CA 3EX9A 2ZA4A 1FGQA 5GSPA 7RNTA 1RSNA 3NV0A 2F4YA 5DREA 1JZDA 3WMDA 3L0RA 2P38A 1LOWA 1D6UA 1VQN3 2V1LA 2RBIA 4LYLB 1YJ93 2BU4A 2FXTA 2Z76A 5FW5A 5G1LA 5IG5A 1EA2A 2CX1A 3K7CA 3MG1A 4MJDA 1MNLA 3S29A 3FG3A 1HU9A 1JN5A 2PZVA 5AEUB 1JV2B 3CCU3 1A2PA 2FGTA 1IVXA 3LXUX
chains in the Genus database with same CATH topology
3CXC2 1WQLB 1RN7A 2GEYA 3I0YA 1RRLA 1IV7A 2Z77A 4BTWA 2D1WA 1IU7A 2GU3A 2RCDA 1ASKA 1SJWA 3OWSA 1WMPA 3X41A 1Q42A 3MKIA 8CHOA 3KN4A 4L8PA 2FNQA 3GZBA 1SQWA 4HZBB 4R9LA 1VQP3 4OK0A 1VQ83 2CKFB 1EQKA 4MMXB 1BUQA 1IQYA 3ROBA 5TGNA 2L4VA 3HZPA 1YIJ3 3CC43 2XR8B 3X3YA 2CH9A 1ROAA 3NXJA 4HVNA 1KD14 4RNZA 2Q07A 4ZM8A 4H3UA 2GBWB 3N54B 3SOYA 4HM0B 3UL6A 3VGNA 3UL5A 3S28A 4EYCA 3GZRA 4LSOA 1W02A 3NBJA 2XEPA 1NO3A 1US1A 3WODG 4XBYA 3EBTA 1OHPA 2CFGA 2JQ5A 2Z7AA 3V99A 1IVWA 1JJ22 2Y74A 4XB5A 3S67A 1RJOA 5AIGA 3JUMA 1KWIA 4J9AA 2KCDA 3I563 1K9M4 2CHCA 1AV4A 5G2GA 3FLJA 5AYRB 1W00A 2W04A 3GZXB 1JNQA 3CU3A 3J7Yd 4RBNA 1W4NA 3PCRA 2XSOB 3CMA3 1OACA 1E97A 3NHXA 1Q7Y4 4R1KA 2XSHB 2W56A 3CD63 4OVMA 2HMKB 4HM2B 5IF6A 3A76A 2XH9A 4XDVA 3CCQ3 1QVG2 3FG1A 3OV4A 4K1VA 1YJW3 1LXEA 5AI1A 1KSIA 1K28A 3UB1A 2HMLB 3U1WA 3OW22 3CCM3 2XGNA 3DM8A 1D6YA 3OXAA 1TP6A 1R4CA 5CXOA 1M1K4 3FKAA 1Q40B 3KIIA 1F8NA 2IMJA 4FCZA 3T8NA 3D3LA 2RFRA 4L8OA 5LC6A 4TX4A 4HKVB 2CW9A 2O9UX 4HZ9B 4R9KA 2YFLB 1E3VA 3OWYA 4WFOA 5FGOA 3S27A 3M8CA 1OPYA 2QGUA 5IERA 4EXRA 5I97A 4KFEA 2CK3H 3FG4A 1VQM3 1STDA 3JUOA 4WP5A 1W6CA 1UUVB 4HM8B 1IVUA 1DVCA 1NU3A 3NM2A 4HM7B 4RZMA 4WHAA 4LGQA 3PZWA 4KFFA 1O7NB 4L7KA 4N6TA 3G0KA 4X2OA 5D83A 1NB3I 2XFSA 3MG2A 3JUNA 3IPTA 3RDEA 3V98A 2CFKA 1DYUA 3LTAA 4NHFA 4R4KA 4FMBA 3CCJ3 1VQ53 4U13A 3FZWA 3KSPA 2IUKA 2P0XA 3NBBA 4XDWA 3SOAA 5EEOA 3I553 4EC6A 2BO9B 2K54A 4HJLB 1QVF2 4O02B 3G16A 2XFTA 2YFIB 3PXMA 3DZLA 4EBGA 3CCV3 3B8LA 3CCL3 3WOFB 3FSDA 4LMIA 1NWWA 2HMOB 3CCS3 4HM4B 1L5GB 1LNHA 3FGYA 3NQYA 1UI7A 5AEWB 6STDA 3FF2A 2CWVA 3Q1CA 3T0UA 2BNGA 1V74A 3LTCA 4ORLA 1JKGA 5D81A 3BNCA 1VQL3 1Q814 3B7CA 4HM3B 1UW1A 1N8QA 1Q40A 3B4PA 4IIAA 3ALAA 3NX0A 1TU5A 3RGRA 1FGMA 1FGRA 1PFPA 1OUNA 3SVAA 4HM1B 4XBTA 1YJN3 1OCVA 3F7SA 4N3VA 5ELJA 4O2HA 1NB5I 4HM5B 3EF8A 3LH4A 5AIIA 4O3VA 3WA3A 3NBRA 1O7GB 2W2CA 3N8BA 1M1XB 2YFJB 2XRXB 3KSED 5CF1A 3F40A 1JB4A 5BVBA 4N6LA 1C7HA 1K8A4 5A0OB 3K0ZA 1K41A 4K61A 2Z6BA 3CC73 2RGQA 1ZX2A 4WYKB 2HMJB 2I9WA 4PEJA 3JUPA 1WNHA 3HI7A 5LC7A 4AKZA 4STDA 3LYGA 2W9QA 1TFKA 1U5OA 4N6V0 4Q53A 4MEIA 1QJGA 1FGTA 2CWUA 5JPUA 1VZZA 4AKYA 1IV9A 3K5TA 3Q90A 3B4OA 3BB9A 2C10A 2JDIH 3E99A 2XGLA 3MHEA 4QWTA 4G1MB 2QA43 4IT7A 4N6OB 3VF1A 1IT8A 4AEQA 5KP1A 2E2TA 2MF7A 2W0QA 1WMNA 5IEPA 3KFQC 2LQVA 1O7WB 5DRVA 1M904 1IQ8A 3JUQA 5IG0A 1ZO2A 5KP3A 1ISKA 3DGMA 3X3ZA 2OQEA 1CYVA 3WA2X 2KRTA 1O7MB 3G8ZA 3F9SA 4LZIA 3EQQB 1CQSA 3NV0B 3MWZA 2GBXB 2ML6A 3BNEA 1ULIB 3FF0A 2W9PA 2WOHA 1QMAA 1EKMA 1YHQ3 1W01A 1GD3A 3LT9A 3NQZA 3UNLA 2CWTA 1GD4A 1A2KA 2XF3A 4MMZB 3GWRA 4KFDA 1N5HA 4KVHA 1YVBI 3D9RA 4WYKA 1TFOA 2OOVA 2K0MA 3UJMA 3DGNA 4GB5A 4FMAA 3MYTA 2R4IA 1WMOA 2ML5A 3IJEB 4XM4A 1Z1SA 4FCMA 1U8CB 1SPUA 2HMNB 3X40A 3PGBA 4N6MA 2OCTA 2RSXA 3ECFA 4I4KA 4N6UA 2STDA 3DUKA 3IMAB 4O8SA 3CPOA 3MPHA 4JF8A 5ELUA 4HM6B 1GS3A 3QK9A 3SX1A 1IK3A 3HK4A 3KE7A 2GEXA 5CF2A 3QRDA 3CCE3 2P05A 2P0MA 1KQS2 5AIHA 4JRFA 1N5PA 1QAKA 5STDA 3OX9A 2A15A 4MMYB 2INXA 1YGEA 1IT7A 1KC84 1VQ93 4XBXA 2PNCA 1YI23 3LZAA 3KZTA 4FMDA 1ULJB 1EG9B 2HMMB 2F99A 1Q824 5IG3A 3LT8A 2YX9A 2BMOB 1PU4A 3H3HA 2CFLA 4EV2A 3H51A 1N8R4 1Q864 1G96A 3CNXA 3DGLA 4RNYA 3SXXA 7STDA 1UUWB 2WGOA 1A67A 4K90B 2IUJA 2IA7A 2W03A 1A90A 4H61A 3DGOA 4J8TA 2BMQB 1DMQA 3N9HA 2UX0A 3AMOB 1Y4KA 2W56B 2LYXA 1VQK3 1OF5B 2ZDJA 3X3XA 5EQLA 1TIJA 3G6E3 1VQ63 3O8YA 2D42A 2Y73A 1J2BA 1GY5A 4GL6A 2OWPA 4WWUC 2MC8A 5D82A 2QEX3 1DVDA 3Q2PA 2E2UA 4LEHA 3DMCA 3NM7A 1IQXA 3EHCA 1TUHA 4EV5A 1FGOA 1ROVA 5BXQA 1W6GA 1CYUA 1W5ZA 2KXGA 1NJI4 1GY6A 3EJVA 3DXOA 3EB8A 5IEOA 3BNBA 2E2VA 1OH0A 2SBLA 3T8UA 1QALA 3PS8A 1W6YA 4K1UA 5CK6A 3GAXA 3EN1B 3TDGA 3LTBA 3G4S3 3STDA 3LOYA 3V92A 1FA3A 3KKGA 1S723 2OQEC 1VQO3 1OGZA 2CG1A 3CPW2 3OWUA 4HYZA 3X42A 1O7HB 1LVNA 4BTXA 4CCVA 3K9MC 1VQ73 1FUWA 2O3OA 2WOFA 1JRQA 2C11A 3WDGB 3MG3A 3SLUA 3BNDA 3SEDA 1K734 1IDPA 2CFDA 2ZL8A 2GXFA 1O7PB 3U97A 5JPPA 3GZYB 4N6NB 1STFI 1T5YA 3EBYA 2F98A 4X2HA 5AIFA 2WGQA 4CDLA 1WTHA 3HIGA 3HX8A 2F86B 3EN8A 1W7CA 3MSOA 5IG4A 3CME3 2OOVC 1SIHA 4BTYA 5KP4A 3EE1A 3LTDA 1UI8A 2CC3A 2CG0A 1W2ZA 3CC23 4FR9A 4FMCA 3AMOA 3DY5A 4OUQA 1OF5A 1DMNA 1JB2A 4KZ1A 3PCSA 1QAFA 4NREA 1YIT3 5EVHA 1SIIA 2OTJ3 1AVLA 1JN5B 1JKGB 1GYBA 3BLZA 3GRDA 5HGRA 1S5AA 3FH1A 3WOEB 3PYJA 1N9JA 2M7OA 1A2VA 1HKXA 1JB5A 5JBSA 2OTL3 3F14A 1D6ZA 2B24B 3F8HA 3CCR3 3NUVA 3VSYA 2BT3A 1GY7A 5IW9A 4R80A 3HIIA 1OHOA 4IPBA 5CLKA 3F8XA 3G713 1NDOB 3CNMA 3ER7A 1E3RA 3F7XA 2BMRB 1OGXA 2W6JH 1AVKA 1DMMA 5AYSC 1W2B2 2P09A 4HBRA 1IVVA 2CFWA 2GU1A 1RRHA 1N9EA 1OHSA 3FCSB 4FCJA 5IENA 1LOXA 2BHMA 1MOLA 3RGAA 1VQ43 2CIUA 2QIYA 2WO0A 3JVCA 1RKYA 1M9GA 1CEWI 3LMLA 3EC9A 1AR0A 3K63A 3S5CA 2B1XB 3EX9A 1FGQA 3NV0A 5DREA 3WMDA 3L0RA 2P38A 1D6UA 1VQN3 2V1LA 1YJ93 2FXTA 5FW5A 2Z76A 5IG5A 1EA2A 3MG1A 3K7CA 4MJDA 3S29A 1MNLA 3FG3A 1HU9A 1JN5A 2PZVA 5AEUB 1JV2B 3CCU3 2FGTA 1IVXA 3LXUX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZI A;  3MWZ A;  1RN7 A;  1IV7 A;  4CCV A;  3K9M C;  1FUW A;  2W9P A;  2BO9 B;  1GD3 A;  3PXM A;  1GD4 A;  4N6N B;  1STF I;  1N5H A;  1YVB I;  1EQK A;  2CH9 A;  1ROA A;  4ZM8 A;  4N6M A;  2OCT A;  3UL6 A;  4N6U A;  3IMA B;  3UL5 A;  5ELU A;  3NX0 A;  4EYC A;  1PFP A;  3SVA A;  5ELJ A;  3QRD A;  1NB5 I;  3S67 A;  3LH4 A;  1KWI A;  1N5P A;  3PYJ A;  1N9J A;  3KSE D;  4N6L A;  5A0O B;  1G96 A;  1LXE A;  1A67 A;  1WNH A;  1A90 A;  5LC7 A;  4N6V 0;  2W9Q A;  1R4C A;  1IV9 A;  1MOL A;  5LC6 A;  4TX4 A;  5EQL A;  1TIJ A;  2O9U X;  1M9G A;  1CEW I;  4IT7 A;  4N6O B;  1DVD A;  3Q2P A;  3L0R A;  3KFQ C;  1CYU A;  1DVC A;  2KXG A;  1MNL A;  4N6T A;  3PS8 A;  1NB3 I;  3GAX A;  1CYV A;  1FA3 A; 
#chains in the Genus database with same CATH topology
 3CXC 2;  1I2E A;  1WQL B;  1RN7 A;  2GEY A;  3I0Y A;  1RRL A;  1C54 A;  1IV7 A;  2Z77 A;  4BTW A;  2D1W A;  1IU7 A;  2GU3 A;  3ZFZ A;  2RCD A;  1ASK A;  1SJW A;  4BIR A;  3OWS A;  1WMP A;  1G02 A;  1T3B A;  1Q42 A;  3X41 A;  3MKI A;  8CHO A;  3KN4 A;  1FW7 A;  4L8P A;  1RGE A;  2FNQ A;  3GZB A;  1SQW A;  1EUI C;  4HZB B;  4R9L A;  1VQP 3;  4OK0 A;  1VQ8 3;  1X1W A;  2CKF B;  1EQK A;  4MMX B;  1BUQ A;  1IQY A;  1BNF A;  5TGN A;  3ROB A;  1HZ1 A;  2L4V A;  3HZP A;  1YIJ 3;  3CC4 3;  2XR8 B;  3X3Y A;  2CH9 A;  1MWT A;  1ROA A;  3NXJ A;  4HVN A;  1KD1 4;  1LQM B;  2BIR A;  2Q07 A;  3AHW A;  4H3U A;  2GBW B;  3N54 B;  4RNZ A;  3SOY A;  4ZM8 A;  4HM0 B;  3UL6 A;  5M19 A;  3VGN A;  3UL5 A;  3S28 A;  4EYC A;  3GZR A;  4LSO A;  4EW5 A;  1I3I A;  1W02 A;  3NBJ A;  1RGH A;  2XEP A;  1NO3 A;  1US1 A;  2H0G A;  3WOD G;  4XBY A;  1LNI A;  1OHP A;  3EBT A;  1FUS A;  2CFG A;  2JQ5 A;  2Z7A A;  1ZS7 A;  3V99 A;  1IVW A;  5HOH A;  1JJ2 2;  2Y74 A;  4XB5 A;  3S67 A;  1RJO A;  5AIG A;  3JUM A;  1KWI A;  2AAD A;  1FZU A;  9RNT A;  4J9A A;  2KCD A;  4BU4 A;  1MWU A;  2RNT A;  3I56 3;  1K9M 4;  2CHC A;  1AV4 A;  5G2G A;  3FLJ A;  5AYR B;  1W00 A;  2W04 A;  3GZX B;  1JNQ A;  3CU3 A;  3J7Y d;  4RBN A;  1W4N A;  3PCR A;  2XSO B;  3CMA 3;  1BNE A;  1RHL A;  1OAC A;  2HOH A;  1E97 A;  1CH0 A;  3NHX A;  6RNT A;  1Q7Y 4;  4R1K A;  2XSH B;  2W56 A;  3CD6 3;  4OVM A;  2HMK B;  4HM2 B;  5IF6 A;  3DH2 A;  1SAR A;  3A76 A;  2XH9 A;  1I2G A;  1TRP A;  4XDV A;  3CCQ 3;  1QVG 2;  1B2X A;  3FG1 A;  3OV4 A;  4K1V A;  1YJW 3;  1LXE A;  1MWR A;  5AI1 A;  1KSI A;  1K28 A;  1BRH A;  2HML B;  3UB1 A;  3U1W A;  3CCM 3;  3OW2 2;  2XGN A;  3DM8 A;  2H0H A;  1D6Y A;  3OXA A;  1TP6 A;  1R4C A;  5CXO A;  1M1K 4;  3FKA A;  1Q40 B;  1HYF A;  3KII A;  1F8N A;  2IMJ A;  4FCZ A;  3T8N A;  3D3L A;  2RFR A;  4L8O A;  5LC6 A;  3GSP A;  4TX4 A;  4HKV B;  2CW9 A;  2O9U X;  4HZ9 B;  4R9K A;  2YFL B;  1E3V A;  3WHO A;  3OWY A;  4WFO A;  5FGO A;  3S27 A;  3M8C A;  1OPY A;  1V57 A;  2QGU A;  5IER A;  4EXR A;  5I97 A;  4KFE A;  2CK3 H;  3FG4 A;  1VQM 3;  1BRJ A;  1STD A;  3JUO A;  4WP5 A;  1W6C A;  1T2H A;  1UUV B;  4HM8 B;  3SYU A;  1IVU A;  1DVC A;  1NU3 A;  3NM2 A;  4HM7 B;  4RZM A;  2F56 A;  4WHA A;  4LGQ A;  3PZW A;  4KFF A;  3BU4 A;  1O7N B;  4L7K A;  4N6T A;  3G0K A;  4X2O A;  5D83 A;  1JBT A;  1NB3 I;  2XFS A;  3MG2 A;  3JUN A;  5M18 A;  1PY3 A;  3IPT A;  3RDE A;  3V98 A;  2CFK A;  1DYU A;  3LTA A;  4NHF A;  4R4K A;  4FMB A;  4GHO A;  3CCJ 3;  4U13 A;  3FZW A;  3KSP A;  2IUK A;  2P0X A;  3NBB A;  4XDW A;  3SOA A;  5EEO A;  3I55 3;  4EC6 A;  2BO9 B;  1TTO A;  2K54 A;  4HJL B;  1QVF 2;  1MGW A;  4O02 B;  3G16 A;  2XFT A;  4BL3 A;  2YFI B;  3PXM A;  3DZL A;  4EBG A;  3CCV 3;  1DET A;  3B8L A;  1BSB A;  3CCL 3;  3WOF B;  3FSD A;  1LOY A;  4LMI A;  1NWW A;  2F5M A;  2HMO B;  3CCS 3;  1B2M A;  4HM4 B;  1L5G B;  1LNH A;  3FGY A;  3NQY A;  1UI7 A;  5AEW B;  6STD A;  1GOU A;  3FF2 A;  2CWV A;  1JBS A;  3Q1C A;  3T0U A;  1BNS A;  2BNG A;  1V74 A;  3LTC A;  4ORL A;  1JKG A;  1BSD A;  2SAR A;  1RNB A;  5D81 A;  1X1U A;  3BIR A;  3BNC A;  1VQL 3;  1PYL A;  1Q81 4;  3B7C A;  4HM3 B;  1UW1 A;  1JBR A;  5M1A A;  1N8Q A;  1Q40 A;  3B4P A;  2K3D A;  2F5W A;  4IIA A;  1RN1 A;  2KF3 A;  3ALA A;  3NX0 A;  3RGR A;  1FGM A;  1TU5 A;  1FGR A;  1PFP A;  1OUN A;  3SVA A;  4HM1 B;  4XBT A;  1YJN 3;  1OCV A;  3F7S A;  4N3V A;  5ELJ A;  1X1X A;  7GSP A;  4O2H A;  6GSP A;  1NB5 I;  4HM5 B;  3EF8 A;  1GMR A;  3LH4 A;  1IYY A;  5AII A;  4KT3 B;  4J5G A;  4O3V A;  2L1S A;  3WA3 A;  1MGR A;  3NBR A;  1O7G B;  3RNT A;  2W2C A;  3N8B A;  1M1X B;  2GSP A;  2YFJ B;  2XRX B;  3KSE D;  5CF1 A;  1UCK A;  1JB4 A;  3F40 A;  5BVB A;  4N6L A;  1VQ5 3;  1C7H A;  4RNT A;  1K8A 4;  5A0O B;  1I70 A;  1K41 A;  3K0Z A;  4K61 A;  1GOV A;  2Z6B A;  3CC7 3;  2RGQ A;  1ZX2 A;  3AGO A;  4WYK B;  1AQZ A;  2HMJ B;  2I9W A;  4PEJ A;  1YNV X;  2AAE A;  3JUP A;  1WNH A;  3HI7 A;  1G0T A;  5LC7 A;  4AKZ A;  4STD A;  3LYG A;  1U5O A;  1TFK A;  2W9Q A;  4N6V 0;  4Q53 A;  1B2Z A;  1QJG A;  4MEI A;  1FGT A;  1LQG C;  2CWU A;  5JPU A;  1VZZ A;  1AY7 A;  4AKY A;  1B21 A;  1IV9 A;  1RGL A;  1UCI A;  3K5T A;  3Q90 A;  3B4O A;  3ZG0 A;  3BB9 A;  2C10 A;  2JDI H;  1UCL A;  3D5I A;  3E99 A;  2XGL A;  3MHE A;  2KF5 A;  4QWT A;  4G1M B;  1BSA A;  2QA4 3;  4IT7 A;  4N6O B;  4NPB A;  3HOH A;  3VF1 A;  1IT8 A;  4AEQ A;  5KP1 A;  1TRQ A;  2E2T A;  2MF7 A;  1RGG A;  2W0Q A;  1WMN A;  5IEP A;  3KFQ C;  1O7W B;  2LQV A;  5DRV A;  1M90 4;  1IQ8 A;  3JUQ A;  5IG0 A;  1YGW A;  1ZO2 A;  2UGI A;  3D5G A;  5KP3 A;  4CPK A;  1ISK A;  3DGM A;  1RN4 A;  3X3Z A;  1B2U A;  2OQE A;  1CYV A;  3WA2 X;  1O7M B;  2KRT A;  3G8Z A;  1B2S A;  3F9S A;  3EQQ B;  1CQS A;  4LZI A;  3NV0 B;  5RNT A;  3MWZ A;  2GBX B;  2ML6 A;  3URP A;  3BNE A;  1LRA A;  1ULI B;  1BU4 A;  3FF0 A;  1BOX A;  2W9P A;  2WOH A;  1QMA A;  1EKM A;  1YHQ 3;  1EEJ A;  1W01 A;  1GD3 A;  1Q9E A;  1RMS A;  3LT9 A;  1RLS A;  3NQZ A;  3UNL A;  1BAO A;  2CWT A;  1GD4 A;  1A2K A;  2XF3 A;  4GSP A;  4MMZ B;  3GWR A;  4KFD A;  1N5H A;  4KVH A;  1RCL A;  4J5K A;  1YVB I;  3A5E A;  3D9R A;  3D79 A;  5BU4 A;  4WYK A;  1TFO A;  2OOV A;  2K0M A;  1MWS A;  3UJM A;  1BGS A;  3DGN A;  1T2I A;  4GB5 A;  5G1K A;  4FMA A;  2IY2 A;  3MYT A;  2R4I A;  1WMO A;  2ML5 A;  3IJE B;  4XM4 A;  1Z1S A;  4FCM A;  1U8C B;  1SPU A;  2HMN B;  4CJN A;  3X40 A;  3PGB A;  4N6M A;  2OCT A;  2RSX A;  3ECF A;  4I4K A;  4N6U A;  2STD A;  3DUK A;  3IMA B;  2H0I A;  4O8S A;  3CPO A;  3MPH A;  4JF8 A;  5ELU A;  4HM6 B;  1GS3 A;  3QK9 A;  3SX1 A;  1IK3 A;  1RDS A;  3HK4 A;  3KE7 A;  2GEX A;  1GOY A;  1DE3 A;  5CF2 A;  3QRD A;  3CCE 3;  2P05 A;  2P0M A;  1KQS 2;  3AHS A;  3DGY A;  5AIH A;  4JRF A;  1N5P A;  1QAK A;  2KF6 A;  3OX9 A;  2A15 A;  4MMY B;  5STD A;  1BVI A;  2INX A;  1BNG A;  1YGE A;  1IT7 A;  1FYS A;  1KC8 4;  1VQ9 3;  1GMP A;  4XBX A;  2PNC A;  1YI2 3;  1UGI A;  3LZA A;  3KZT A;  4FMD A;  4BL2 A;  1ULJ B;  1EG9 B;  2HMM B;  2F99 A;  1Q82 4;  5IG3 A;  3LT8 A;  2YX9 A;  1RTU A;  2BMO B;  1PU4 A;  1UUG B;  1I3F A;  3H3H A;  2CFL A;  4EV2 A;  3H51 A;  2KAA A;  1N8R 4;  1Q86 4;  1G96 A;  3CNX A;  3DGL A;  4RNY A;  3SXX A;  7STD A;  1UUW B;  1LOV A;  1BRN L;  2WGO A;  1A67 A;  4K90 B;  2IUJ A;  2IA7 A;  2W03 A;  1A90 A;  1RGF A;  4H61 A;  3DGO A;  4J8T A;  2BMQ B;  1BNR A;  1DMQ A;  1I2F A;  1RNT A;  3N9H A;  1FUT A;  2UX0 A;  4HOH A;  3AMO B;  1Y4K A;  2W56 B;  2LYX A;  1RGK A;  1VQK 3;  1OF5 B;  2ZDJ A;  3X3X A;  5EQL A;  1TIJ A;  3G6E 3;  1VQ6 3;  2R41 A;  3O8Y A;  1I0V A;  2D42 A;  2Y73 A;  1J2B A;  1GY5 A;  1ZGX A;  3D4A A;  4GL6 A;  2OWP A;  4WWU C;  2MC8 A;  5D82 A;  3WR2 A;  2QEX 3;  1BUJ A;  1BNJ A;  1BRK A;  2E2U A;  1I8V A;  3Q2P A;  1DVD A;  4LEH A;  1BRI A;  3DMC A;  3NM7 A;  1B3S A;  1BRG A;  1IQX A;  3EHC A;  1TUH A;  4EV5 A;  1FGO A;  1ROV A;  5BXQ A;  1W6G A;  1CYU A;  1W5Z A;  2KXG A;  4HAA A;  1NJI 4;  1GY6 A;  3EJV A;  3DXO A;  1BAN A;  3EB8 A;  5IEO A;  3BNB A;  2E2V A;  1OH0 A;  1B27 A;  2SBL A;  3T8U A;  1QAL A;  3PS8 A;  1W6Y A;  4K1U A;  1GSP A;  5CK6 A;  3GAX A;  3EN1 B;  3TDG A;  3LTB A;  3G4S 3;  3STD A;  3LOY A;  1NNV A;  3V92 A;  1FA3 A;  3KKG A;  1S72 3;  2OQE C;  1VQO 3;  1UCJ A;  1OGZ A;  2CG1 A;  3CPW 2;  1GMQ A;  1JZO A;  1RGC A;  3OWU A;  4HYZ A;  3X42 A;  1O7H B;  1LVN A;  4BTX A;  4CCV A;  3K9M C;  1VQ7 3;  1FUW A;  2O3O A;  2WOF A;  1BSE A;  1JRQ A;  2C11 A;  3WDG B;  3MG3 A;  3SLU A;  3BND A;  3SED A;  1K73 4;  1IDP A;  2CFD A;  2ZL8 A;  2GXF A;  1O7P B;  3U97 A;  1BIR A;  3GZY B;  4N6N B;  5JPP A;  1STF I;  1T5Y A;  3EBY A;  2F98 A;  4X2H A;  5AIF A;  2WGQ A;  4CDL A;  1WTH A;  3HIG A;  3HX8 A;  1VQQ A;  2F86 B;  3EN8 A;  1W7C A;  3MSO A;  5IG4 A;  3CME 3;  2OOV C;  1SIH A;  4BTY A;  5KP4 A;  3EE1 A;  1UDI I;  3LTD A;  1BRS A;  1UI8 A;  2CC3 A;  2CG0 A;  1W2Z A;  3CC2 3;  2CX0 A;  4FR9 A;  4ILF A;  4FMC A;  3AMO A;  1B20 A;  2ZHX B;  5BIR A;  3DY5 A;  4OUQ A;  1OF5 A;  1DMN A;  1JB2 A;  4KZ1 A;  3PCS A;  1QAF A;  4NRE A;  1YIT 3;  5EVH A;  1SII A;  2OTJ 3;  3Q3F A;  1AVL A;  1JN5 B;  1UGH I;  1JKG B;  1GYB A;  3BLZ A;  3GRD A;  5HGR A;  1S5A A;  3FH1 A;  1V58 A;  3PYJ A;  3WOE B;  1N9J A;  2M7O A;  1A2V A;  1HKX A;  1JB5 A;  5JBS A;  2OTL 3;  1Q7H A;  3F14 A;  2IYJ A;  1D6Z A;  2B24 B;  3F8H A;  3CCR 3;  3NUV A;  3VSY A;  2BT3 A;  1X1Y A;  1GY7 A;  4I5Q A;  2KF4 A;  5IW9 A;  4R80 A;  3HII A;  1R4Y A;  1OHO A;  4IPB A;  5CLK A;  8RNT A;  3F8X A;  3G71 3;  1NDO B;  3CNM A;  3ER7 A;  1E3R A;  3F7X A;  2BMR B;  1BSC A;  1OGX A;  3ZG5 A;  2W6J H;  4DKI A;  1RCK A;  1YVS A;  2C4B A;  1AVK A;  3AGN A;  1DMM A;  5AYS C;  1BNI A;  1W2B 2;  2P09 A;  4HBR A;  1IVV A;  2J8X B;  2CFW A;  2GU1 A;  1RGA A;  1RRH A;  1TJD A;  1N9E A;  1OHS A;  3FCS B;  4FCJ A;  5IEN A;  1LOX A;  2BHM A;  1MOL A;  2UUG C;  3RGA A;  1VQ4 3;  2CIU A;  2QIY A;  3KCH A;  2WO0 A;  3JVC A;  1RKY A;  1M9G A;  1CEW I;  3LML A;  3EC9 A;  1AR0 A;  3K63 A;  1I0X A;  2B1X B;  3S5C A;  3EX9 A;  2ZA4 A;  1FGQ A;  5GSP A;  7RNT A;  1RSN A;  3NV0 A;  2F4Y A;  5DRE A;  1JZD A;  3WMD A;  3L0R A;  2P38 A;  1LOW A;  1D6U A;  1VQN 3;  2V1L A;  2RBI A;  4LYL B;  1YJ9 3;  2BU4 A;  2FXT A;  2Z76 A;  5FW5 A;  5G1L A;  5IG5 A;  1EA2 A;  2CX1 A;  3K7C A;  3MG1 A;  4MJD A;  1MNL A;  3S29 A;  3FG3 A;  1HU9 A;  1JN5 A;  2PZV A;  5AEU B;  1JV2 B;  3CCU 3;  1A2P A;  2FGT A;  1IVX A;  3LXU X; 
#chains in the Genus database with same CATH homology
 3CXC 2;  1WQL B;  1RN7 A;  2GEY A;  3I0Y A;  1RRL A;  1IV7 A;  2Z77 A;  4BTW A;  2D1W A;  1IU7 A;  2GU3 A;  2RCD A;  1ASK A;  1SJW A;  3OWS A;  1WMP A;  3X41 A;  1Q42 A;  3MKI A;  8CHO A;  3KN4 A;  4L8P A;  2FNQ A;  3GZB A;  1SQW A;  4HZB B;  4R9L A;  1VQP 3;  4OK0 A;  1VQ8 3;  2CKF B;  1EQK A;  4MMX B;  1BUQ A;  1IQY A;  3ROB A;  5TGN A;  2L4V A;  3HZP A;  1YIJ 3;  3CC4 3;  2XR8 B;  3X3Y A;  2CH9 A;  1ROA A;  3NXJ A;  4HVN A;  1KD1 4;  4RNZ A;  2Q07 A;  4ZM8 A;  4H3U A;  2GBW B;  3N54 B;  3SOY A;  4HM0 B;  3UL6 A;  3VGN A;  3UL5 A;  3S28 A;  4EYC A;  3GZR A;  4LSO A;  1W02 A;  3NBJ A;  2XEP A;  1NO3 A;  1US1 A;  3WOD G;  4XBY A;  3EBT A;  1OHP A;  2CFG A;  2JQ5 A;  2Z7A A;  3V99 A;  1IVW A;  1JJ2 2;  2Y74 A;  4XB5 A;  3S67 A;  1RJO A;  5AIG A;  3JUM A;  1KWI A;  4J9A A;  2KCD A;  3I56 3;  1K9M 4;  2CHC A;  1AV4 A;  5G2G A;  3FLJ A;  5AYR B;  1W00 A;  2W04 A;  3GZX B;  1JNQ A;  3CU3 A;  3J7Y d;  4RBN A;  1W4N A;  3PCR A;  2XSO B;  3CMA 3;  1OAC A;  1E97 A;  3NHX A;  1Q7Y 4;  4R1K A;  2XSH B;  2W56 A;  3CD6 3;  4OVM A;  2HMK B;  4HM2 B;  5IF6 A;  3A76 A;  2XH9 A;  4XDV A;  3CCQ 3;  1QVG 2;  3FG1 A;  3OV4 A;  4K1V A;  1YJW 3;  1LXE A;  5AI1 A;  1KSI A;  1K28 A;  3UB1 A;  2HML B;  3U1W A;  3OW2 2;  3CCM 3;  2XGN A;  3DM8 A;  1D6Y A;  3OXA A;  1TP6 A;  1R4C A;  5CXO A;  1M1K 4;  3FKA A;  1Q40 B;  3KII A;  1F8N A;  2IMJ A;  4FCZ A;  3T8N A;  3D3L A;  2RFR A;  4L8O A;  5LC6 A;  4TX4 A;  4HKV B;  2CW9 A;  2O9U X;  4HZ9 B;  4R9K A;  2YFL B;  1E3V A;  3OWY A;  4WFO A;  5FGO A;  3S27 A;  3M8C A;  1OPY A;  2QGU A;  5IER A;  4EXR A;  5I97 A;  4KFE A;  2CK3 H;  3FG4 A;  1VQM 3;  1STD A;  3JUO A;  4WP5 A;  1W6C A;  1UUV B;  4HM8 B;  1IVU A;  1DVC A;  1NU3 A;  3NM2 A;  4HM7 B;  4RZM A;  4WHA A;  4LGQ A;  3PZW A;  4KFF A;  1O7N B;  4L7K A;  4N6T A;  3G0K A;  4X2O A;  5D83 A;  1NB3 I;  2XFS A;  3MG2 A;  3JUN A;  3IPT A;  3RDE A;  3V98 A;  2CFK A;  1DYU A;  3LTA A;  4NHF A;  4R4K A;  4FMB A;  3CCJ 3;  1VQ5 3;  4U13 A;  3FZW A;  3KSP A;  2IUK A;  2P0X A;  3NBB A;  4XDW A;  3SOA A;  5EEO A;  3I55 3;  4EC6 A;  2BO9 B;  2K54 A;  4HJL B;  1QVF 2;  4O02 B;  3G16 A;  2XFT A;  2YFI B;  3PXM A;  3DZL A;  4EBG A;  3CCV 3;  3B8L A;  3CCL 3;  3WOF B;  3FSD A;  4LMI A;  1NWW A;  2HMO B;  3CCS 3;  4HM4 B;  1L5G B;  1LNH A;  3FGY A;  3NQY A;  1UI7 A;  5AEW B;  6STD A;  3FF2 A;  2CWV A;  3Q1C A;  3T0U A;  2BNG A;  1V74 A;  3LTC A;  4ORL A;  1JKG A;  5D81 A;  3BNC A;  1VQL 3;  1Q81 4;  3B7C A;  4HM3 B;  1UW1 A;  1N8Q A;  1Q40 A;  3B4P A;  4IIA A;  3ALA A;  3NX0 A;  1TU5 A;  3RGR A;  1FGM A;  1FGR A;  1PFP A;  1OUN A;  3SVA A;  4HM1 B;  4XBT A;  1YJN 3;  1OCV A;  3F7S A;  4N3V A;  5ELJ A;  4O2H A;  1NB5 I;  4HM5 B;  3EF8 A;  3LH4 A;  5AII A;  4O3V A;  3WA3 A;  3NBR A;  1O7G B;  2W2C A;  3N8B A;  1M1X B;  2YFJ B;  2XRX B;  3KSE D;  5CF1 A;  3F40 A;  1JB4 A;  5BVB A;  4N6L A;  1C7H A;  1K8A 4;  5A0O B;  3K0Z A;  1K41 A;  4K61 A;  2Z6B A;  3CC7 3;  2RGQ A;  1ZX2 A;  4WYK B;  2HMJ B;  2I9W A;  4PEJ A;  3JUP A;  1WNH A;  3HI7 A;  5LC7 A;  4AKZ A;  4STD A;  3LYG A;  2W9Q A;  1TFK A;  1U5O A;  4N6V 0;  4Q53 A;  4MEI A;  1QJG A;  1FGT A;  2CWU A;  5JPU A;  1VZZ A;  4AKY A;  1IV9 A;  3K5T A;  3Q90 A;  3B4O A;  3BB9 A;  2C10 A;  2JDI H;  3E99 A;  2XGL A;  3MHE A;  4QWT A;  4G1M B;  2QA4 3;  4IT7 A;  4N6O B;  3VF1 A;  1IT8 A;  4AEQ A;  5KP1 A;  2E2T A;  2MF7 A;  2W0Q A;  1WMN A;  5IEP A;  3KFQ C;  2LQV A;  1O7W B;  5DRV A;  1M90 4;  1IQ8 A;  3JUQ A;  5IG0 A;  1ZO2 A;  5KP3 A;  1ISK A;  3DGM A;  3X3Z A;  2OQE A;  1CYV A;  3WA2 X;  2KRT A;  1O7M B;  3G8Z A;  3F9S A;  4LZI A;  3EQQ B;  1CQS A;  3NV0 B;  3MWZ A;  2GBX B;  2ML6 A;  3BNE A;  1ULI B;  3FF0 A;  2W9P A;  2WOH A;  1QMA A;  1EKM A;  1YHQ 3;  1W01 A;  1GD3 A;  3LT9 A;  3NQZ A;  3UNL A;  2CWT A;  1GD4 A;  1A2K A;  2XF3 A;  4MMZ B;  3GWR A;  4KFD A;  1N5H A;  4KVH A;  1YVB I;  3D9R A;  4WYK A;  1TFO A;  2OOV A;  2K0M A;  3UJM A;  3DGN A;  4GB5 A;  4FMA A;  3MYT A;  2R4I A;  1WMO A;  2ML5 A;  3IJE B;  4XM4 A;  1Z1S A;  4FCM A;  1U8C B;  1SPU A;  2HMN B;  3X40 A;  3PGB A;  4N6M A;  2OCT A;  2RSX A;  3ECF A;  4I4K A;  4N6U A;  2STD A;  3DUK A;  3IMA B;  4O8S A;  3CPO A;  3MPH A;  4JF8 A;  5ELU A;  4HM6 B;  1GS3 A;  3QK9 A;  3SX1 A;  1IK3 A;  3HK4 A;  3KE7 A;  2GEX A;  5CF2 A;  3QRD A;  3CCE 3;  2P05 A;  2P0M A;  1KQS 2;  5AIH A;  4JRF A;  1N5P A;  1QAK A;  5STD A;  3OX9 A;  2A15 A;  4MMY B;  2INX A;  1YGE A;  1IT7 A;  1KC8 4;  1VQ9 3;  4XBX A;  2PNC A;  1YI2 3;  3LZA A;  3KZT A;  4FMD A;  1ULJ B;  1EG9 B;  2HMM B;  2F99 A;  1Q82 4;  5IG3 A;  3LT8 A;  2YX9 A;  2BMO B;  1PU4 A;  3H3H A;  2CFL A;  4EV2 A;  3H51 A;  1N8R 4;  1Q86 4;  1G96 A;  3CNX A;  3DGL A;  4RNY A;  3SXX A;  7STD A;  1UUW B;  2WGO A;  1A67 A;  4K90 B;  2IUJ A;  2IA7 A;  2W03 A;  1A90 A;  4H61 A;  3DGO A;  4J8T A;  2BMQ B;  1DMQ A;  3N9H A;  2UX0 A;  3AMO B;  1Y4K A;  2W56 B;  2LYX A;  1VQK 3;  1OF5 B;  2ZDJ A;  3X3X A;  5EQL A;  1TIJ A;  3G6E 3;  1VQ6 3;  3O8Y A;  2D42 A;  2Y73 A;  1J2B A;  1GY5 A;  4GL6 A;  2OWP A;  4WWU C;  2MC8 A;  5D82 A;  2QEX 3;  1DVD A;  3Q2P A;  2E2U A;  4LEH A;  3DMC A;  3NM7 A;  1IQX A;  3EHC A;  1TUH A;  4EV5 A;  1FGO A;  1ROV A;  5BXQ A;  1W6G A;  1CYU A;  1W5Z A;  2KXG A;  1NJI 4;  1GY6 A;  3EJV A;  3DXO A;  3EB8 A;  5IEO A;  3BNB A;  2E2V A;  1OH0 A;  2SBL A;  3T8U A;  1QAL A;  3PS8 A;  1W6Y A;  4K1U A;  5CK6 A;  3GAX A;  3EN1 B;  3TDG A;  3LTB A;  3G4S 3;  3STD A;  3LOY A;  3V92 A;  1FA3 A;  3KKG A;  1S72 3;  2OQE C;  1VQO 3;  1OGZ A;  2CG1 A;  3CPW 2;  3OWU A;  4HYZ A;  3X42 A;  1O7H B;  1LVN A;  4BTX A;  4CCV A;  3K9M C;  1VQ7 3;  1FUW A;  2O3O A;  2WOF A;  1JRQ A;  2C11 A;  3WDG B;  3MG3 A;  3SLU A;  3BND A;  3SED A;  1K73 4;  1IDP A;  2CFD A;  2ZL8 A;  2GXF A;  1O7P B;  3U97 A;  5JPP A;  3GZY B;  4N6N B;  1STF I;  1T5Y A;  3EBY A;  2F98 A;  4X2H A;  5AIF A;  2WGQ A;  4CDL A;  1WTH A;  3HIG A;  3HX8 A;  2F86 B;  3EN8 A;  1W7C A;  3MSO A;  5IG4 A;  3CME 3;  2OOV C;  1SIH A;  4BTY A;  5KP4 A;  3EE1 A;  3LTD A;  1UI8 A;  2CC3 A;  2CG0 A;  1W2Z A;  3CC2 3;  4FR9 A;  4FMC A;  3AMO A;  3DY5 A;  4OUQ A;  1OF5 A;  1DMN A;  1JB2 A;  4KZ1 A;  3PCS A;  1QAF A;  4NRE A;  1YIT 3;  5EVH A;  1SII A;  2OTJ 3;  1AVL A;  1JN5 B;  1JKG B;  1GYB A;  3BLZ A;  3GRD A;  5HGR A;  1S5A A;  3FH1 A;  3WOE B;  3PYJ A;  1N9J A;  2M7O A;  1A2V A;  1HKX A;  1JB5 A;  5JBS A;  2OTL 3;  3F14 A;  1D6Z A;  2B24 B;  3F8H A;  3CCR 3;  3NUV A;  3VSY A;  2BT3 A;  1GY7 A;  5IW9 A;  4R80 A;  3HII A;  1OHO A;  4IPB A;  5CLK A;  3F8X A;  3G71 3;  1NDO B;  3CNM A;  3ER7 A;  1E3R A;  3F7X A;  2BMR B;  1OGX A;  2W6J H;  1AVK A;  1DMM A;  5AYS C;  1W2B 2;  2P09 A;  4HBR A;  1IVV A;  2CFW A;  2GU1 A;  1RRH A;  1N9E A;  1OHS A;  3FCS B;  4FCJ A;  5IEN A;  1LOX A;  2BHM A;  1MOL A;  3RGA A;  1VQ4 3;  2CIU A;  2QIY A;  2WO0 A;  3JVC A;  1RKY A;  1M9G A;  1CEW I;  3LML A;  3EC9 A;  1AR0 A;  3K63 A;  3S5C A;  2B1X B;  3EX9 A;  1FGQ A;  3NV0 A;  5DRE A;  3WMD A;  3L0R A;  2P38 A;  1D6U A;  1VQN 3;  2V1L A;  1YJ9 3;  2FXT A;  5FW5 A;  2Z76 A;  5IG5 A;  1EA2 A;  3MG1 A;  3K7C A;  4MJD A;  3S29 A;  1MNL A;  3FG3 A;  1HU9 A;  1JN5 A;  2PZV A;  5AEU B;  1JV2 B;  3CCU 3;  2FGT A;  1IVX A;  3LXU X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...