5ELUA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
NENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVDLTRFPVTTMYYLTLEAKDGGKKKLYEAKVWVKGYLLEELKHNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
molecule keywords SUMO-Affirmer-S2B3
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eluA00
1GD3A 3L0RA 3MWZA 3Q2PA 4EYCA 3GAXA 2O9UX 1RN7A 2OCTA 1CYVA 5A0OB 1YVBI 1FA3A 1DVDA 1PFPA 1IV7A 3PS8A 1DVCA 4N6V0 1KWIA 1MNLA 3K9MC 2BO9B 1STFI 5ELUA 1CEWI 1N5PA 1CYUA 1FUWA 4N6NB 3QRDA 1TIJA 3KFQC 2CH9A 2W9QA 3SVAA 3PXMA 4LZIA 1IV9A 2W9PA 1N9JA 3PYJA 1WNHA 2KXGA 1LXEA 5EQLA 3NX0A 4N6LA 3UL5A 1EQKA 4N6UA 1M9GA 1ROAA 1GD4A 1R4CA 3UL6A 3IMAB 4N6MA 3S67A 4ZM8A 1NB5I 3LH4A 4CCVA 4IT7A 1N5HA 4N6TA 1A67A 4N6OB 5ELJA 5LC7A 1A90A 3KSED 1NB3I 4TX4A 1G96A 1MOLA 5LC6A
chains in the Genus database with same CATH superfamily
1GD3A 3NM7A 4FCZA 1UGIA 3OV4A 2STDA 3G6E3 1FW7A 3URPA 1HYFA 4KFDA 1EA2A 3ER7A 4OUQA 3WDGB 4O02B 4BL3A 1QJGA 1T2HA 4BTXA 1OUNA 4JF8A 1N8R4 1GOVA 2IUKA 5AYSC 1VQ83 2RNTA 4AKYA 1DYUA 1TTOA 5EEOA 3WMDA 4N6UA 2GSPA 2ML6A 3EN1B 4BIRA 1A2PA 3U1WA 5M18A 3SX1A 3DGNA 1K8A4 2WO0A 2ML5A 1JKGA 5FGOA 2BT3A 1VQ73 2BMQB 2BMRB 1O7MB 1STDA 4FMDA 1BNSA 4HBRA 2K3DA 1V74A 4KFEA 1X1UA 1K734 1BNGA 1OHSA 3CCJ3 1NJI4 1T3BA 2OWPA 4O3VA 4XB5A 3L0RA 1ISKA 3K5TA 3F9SA 2KRTA 2WGQA 4GL6A 2OCTA 1VQ53 1JB2A 2F5MA 2CG0A 1BANA 1N9EA 1QVF2 1JZOA 3B8LA 3K7CA 1AV4A 1B2MA 2B24B 3DM8A 2HMMB 2XEPA 3NM2A 5G1KA 1W6GA 3KFQC 4HM5B 2B1XB 4HOHA 2V1LA 1BNFA 1W02A 1BAOA 2P0XA 3LMLA 4L8PA 3PYJA 2P09A 1WNHA 5D81A 1LXEA 1NWWA 1UUVB 3FSDA 1F8NA 1WMPA 8CHOA 3FKAA 4H61A 4FMBA 4NPBA 9RNTA 2HOHA 1UGHI 3GZXB 3NQYA 1LVNA 1JV2B 3GZYB 2FXTA 1Q9EA 1V57A 5LC7A 1ULJB 1BRIA 3UB1A 1TRPA 1BSDA 1JBSA 3MG3A 1OGXA 2SARA 3TDGA 3CCE3 2IUJA 2CFWA 1JNQA 4WFOA 3D5IA 4K1VA 1YJ93 1GOUA 3K63A 1ASKA 1TFOA 4N3VA 2CG1A 3STDA 3UNLA 3LTCA 1TJDA 5IG4A 5AIIA 5IG0A 1R4YA 3D9RA 2Z7AA 1UI7A 1BRHA 3NBBA 4N6NB 3G713 2E2TA 1Q814 3BIRA 3NUVA 5KP1A 3I553 2BNGA 4HVNA 2YFJB 2Z76A 3KSPA 2CFDA 3V99A 2KF4A 1FGRA 1ZGXA 3EJVA 3F40A 4K1UA 2LQVA 3HIIA 3PCRA 1HZ1A 2XFTA 3DGYA 3G16A 1B20A 4HM3B 1RDSA 4HAAA 4N6OB 1T2IA 1KD14 1GS3A 1EG9B 1GMQA 3PGBA 1RN1A 1K9M4 4X2OA 4BTWA 1WQLB 3AMOA 3BLZA 3GZBA 4IPBA 1AVKA 1PFPA 2XSOB 1RMSA 4NHFA 3MSOA 2HMNB 3CME3 4WYKB 3JUPA 1IT7A 1MGWA 2OQEC 3MHEA 1LOVA 1IU7A 1OACA 3EB8A 1VQ93 1LOYA 4CJNA 1KC84 1EUIC 5CF1A 2CC3A 3BB9A 5AIFA 4MMZB 2INXA 1VQO3 3X3ZA 1E97A 4WHAA 1IVVA 4EW5A 2CWVA 2KF5A 2H0HA 3Q1CA 1OPYA 1RGGA 2D1WA 1RCKA 2HMKB 3D79A 3K0ZA 3GZRA 2YFLB 1B2SA 1OGZA 2GBWB 1FZUA 1QMAA 1TRQA 2K0MA 4GHOA 1W7CA 1I8VA 1IQXA 2Y74A 4WYKA 3FG3A 3K9MC 3DGOA 4EV2A 1RKYA 1UCLA 1B21A 3JUNA 1RGHA 4HM0B 1GSPA 1W5ZA 1B27A 3KIIA 3O8YA 1IV9A 2C4BA 2F99A 5DRVA 1T5YA 1LQGC 2W6JH 3T0UA 4L7KA 2UGIA 3KN4A 3MPHA 4BL2A 1BNRA 1BNEA 1N8QA 3X3YA 4EBGA 1RHLA 1UCKA 1VZZA 1I3IA 1SIHA 1FGQA 1A67A 1OHPA 1W4NA 1KSIA 2E2VA 1JN5B 3LTDA 4HM7B 1G96A 1K41A 1I0VA 2RFRA 2CFKA 3Q2PA 4HM2B 1S723 1G02A 4BU4A 3BNBA 3H3HA 4QWTA 1GYBA 1GY6A 4MMXB 1OF5B 2OTJ3 1NO3A 1AVLA 1M904 1UI8A 4FCJA 1AR0A 2P0MA 2CH9A 4WWUC 1LOXA 4LZIA 1FGMA 2F5WA 5EQLA 2A15A 1JKGB 1JRQA 3SLUA 3V98A 1DETA 3OX9A 4ZM8A 3OXAA 3RGAA 5AEWB 3MYTA 1W6CA 3N9HA 3NBRA 3NBJA 2QEX3 1X1WA 1YIJ3 5ELJA 1IQ8A 5LC6A 4CDLA 8RNTA 2ZDJA 2ZL8A 3MWZA 2IYJA 4FMAA 3AGNA 1GMPA 1RRHA 1DMNA 1X1XA 2KF6A 2UX0A 2F56A 3LT8A 1D6YA 1VQN3 1GY5A 4N6V0 3ECFA 5GSPA 1J2BA 1VQK3 1M1K4 2HMJB 1WMOA 3EX9A 1N5PA 2CIUA 1IQYA 3PXMA 3KKGA 1Y4KA 4X2HA 1CH0A 1O7GB 4CPKA 3VGNA 3HX8A 4RNTA 2UUGC 2OQEA 1RSNA 1QAKA 3GWRA 5RNTA 1UCIA 5STDA 1QVG2 2XR8B 1JB5A 3MG1A 3HZPA 3RNTA 5IERA 2IA7A 1E3RA 1S5AA 5JBSA 3WOEB 2RGQA 1FUTA 2CWUA 3A76A 3WHOA 3EQQB 4OK0A 3FG1A 1CYVA 1X1YA 1OHOA 3IPTA 3DH2A 4LGQA 1IT8A 1RLSA 1I70A 1KWIA 3HIGA 2OOVA 1BGSA 3X42A 1VQ63 3DY5A 3FG4A 3VSYA 3CU3A 3FZWA 1W01A 4JRFA 3OW22 3ALAA 3T8UA 2P38A 1A2KA 1RGKA 1YNVX 4IIAA 3UL6A 3S67A 1I3FA 1SPUA 3LT9A 1US1A 1VQM3 1YIT3 1PY3A 2OTL3 1A90A 7STDA 3FGYA 3OWYA 2JQ5A 3SOAA 2CFGA 5IF6A 2K54A 3EBTA 3CPW2 2XGLA 1HKXA 2O3OA 4HKVB 1QALA 1B2XA 3GAXA 2O9UX 5BIRA 5EVHA 4RNYA 5G1LA 5A0OB 1FA3A 4HM4B 4HZ9B 4HZBB 2W0QA 3AHSA 1VQP3 3CCQ3 2I9WA 1TIJA 1BIRA 1U5OA 3FF2A 3MKIA 3JUOA 4AEQA 3CC73 3B4OA 1MWRA 3MG2A 5AEUB 1EKMA 2AADA 5KP3A 2Z77A 1YJW3 1RCLA 1OF5A 3F7XA 4J5GA 3E99A 3X41A 1BRKA 4ILFA 1BSBA 1NNVA 2YX9A 3CCM3 1W2B2 5BXQA 1CQSA 1TFKA 1A2VA 1V58A 5CLKA 3S28A 2L1SA 4HM1B 3I0YA 1Q824 2WOHA 3CCL3 3WR2A 2XSHB 3EBYA 4EYCA 2KF3A 5IENA 1BSEA 1W2ZA 2CWTA 3FCSB 4HM6B 4R9KA 4STDA 3FLJA 3PS8A 2GU3A 4KT3B 5HOHA 2BO9B 1STFI 1VQQA 2QA43 3LYGA 5CXOA 2CFLA 2W03A 4AKZA 1QAFA 4RZMA 1BRSA 2XGNA 1I2FA 3CPOA 5IEOA 3ZG0A 1FUSA 3UL5A 1JBTA 3DZLA 5DREA 2PZVA 4K61A 5D83A 2F4YA 4KZ1A 4N6MA 5FW5A 2L4VA 4CCVA 2CHCA 1DMMA 3CCU3 1B2UA 1LOWA 5AI1A 7RNTA 3VF1A 1KQS2 1W6YA 1VQL3 4TX4A 1JBRA 3A5EA 1RGFA 3CMA3 3CC23 1C54A 1GMRA 5M1AA 5KP4A 1JB4A 1RN7A 1BSCA 1Q40B 1O7NB 3KE7A 4FCMA 5IG3A 3V92A 4DKIA 1MNLA 1DE3A 5HGRA 2BU4A 1FUWA 2RSXA 3ZFZA 3CCS3 4XDVA 4PEJA 1HU9A 4GB5A 4MEIA 1O7PB 2CX0A 1BVIA 2KXGA 3DXOA 4FR9A 4KVHA 1L5GB 1LNIA 2GEYA 1GD4A 3CXC2 1FGOA 1RNTA 2KAAA 3H51A 3IMAB 3Q3FA 4XBTA 4NREA 4XBXA 2IY2A 1I0XA 2RCDA 3RGRA 3B4PA 2ZA4A 4MMYB 3OWUA 1BOXA 1AY7A 3FF0A 4R4KA 4FMCA 5TGNA 1BSAA 2F86B 2E2UA 3G4S3 1LNHA 2CX1A 4HJLB 4XBYA 2OOVC 1BRJA 1Z1SA 3Q90A 4MJDA 1NDOB 1UW1A 3F7SA 1MWUA 3LTAA 3LOYA 3RDEA 1JJ22 4J8TA 3UJMA 1MWSA 1RGAA 1FGTA 3KZTA 4LYLB 2CK3H 2RBIA 1CYUA 1LRAA 1JZDA 1Q7Y4 3LTBA 3F14A 2W2CA 2W9PA 1ULIB 1N9JA 4ORLA 2FNQA 1UCJA 5AYRB 3NX0A 3BNEA 4I5QA 4O2HA 1BUQA 1M9GA 1ROAA 1BRGA 3SYUA 2GXFA 4XM4A 2QGUA 3U97A 1RRLA 1O7HB 1BUJA 4LEHA 4OVMA 4Q53A 1MOLA 3EE1A 6STDA 4BTYA 1IVWA 3CNMA 1E3VA 2WGOA 1IK3A 3OWSA 4I4KA 3X40A 3S27A 2XH9A 4GSPA 1TP6A 2XF3A 1ZS7A 3EN8A 2SBLA 4H3UA 5D82A 5I97A 5M19A 1NU3A 3S5CA 1YGWA 4L8OA 1ROVA 4J5KA 5IEPA 2HMLB 3WA3A 2W04A 3DUKA 3CCV3 2XFSA 2WOFA 2R41A 1WTHA 1M1XB 2P05A 4RNZA 3EHCA 1MGRA 1SIIA 2C10A 3AGOA 3HOHA 4N6LA 4R80A 2MC8A 1I2GA 1RGEA 1SARA 1NB5I 4U13A 3T8NA 1GY7A 5CK6A 2Z6BA 2MF7A 1W00A 3NQZA 2FGTA 1BRNL 4IT7A 3F8XA 3B7CA 1OCVA 1RNBA 2W56A 2ZHXB 4EV5A 2LYXA 2AAEA 1BU4A 1YJN3 3CD63 1ZO2A 3FH1A 1BNJA 3DGMA 3IJEB 3CCR3 2GU1A 3CNXA 4EXRA 1DMQA 5BU4A 1IVXA 4LMIA 3PCSA 5AIGA 3EC9A 2R4IA 2W9QA 3I563 1IVUA 3HK4A 1TUHA 3BU4A 1AQZA 4K90B 1GOYA 1RGLA 2CKFB 3DMCA 1TU5A 1FYSA 1Q40A 2D42A 1SQWA 3WODG 2GBXB 1UUWB 1YVSA 2QIYA 3D3LA 3JUQA 4RBNA 3LXUX 2KCDA 1O7WB 3GSPA 3NXJA 4HYZA 1C7HA 1JN5A 3WA2X 1EEJA 2BIRA 3WOFB 4HM8B 1RTUA 2Q07A 3KSED 3BNCA 2GEXA 4KFFA 5CF2A 3F8HA 3NV0A 3N54B 3D4AA 5JPUA 1UDII 1YVBI 1RN4A 5AIHA 1DVDA 1DVCA 3ZG5A 4J9AA 3SXXA 2H0IA 1D6ZA 3JUMA 1LQMB 1MWTA 2C11A 3QRDA 2BMOB 2F98A 1U8CB 1YI23 5G2GA 3BNDA 3D5GA 2HMOB 3HI7A 2W56B 3X3XA 7GSPA 4O8SA 1R4CA 2Y73A 4R1KA 1VQ43 4EC6A 1BNIA 1WMNA 3LH4A 3G8ZA 3NHXA 3KCHA 1N5HA 4XDWA 3S29A 5JPPA 3J7Yd 1B3SA 3SEDA 1PU4A 5BVBA 1Q864 3N8BA 6GSPA 1YHQ3 2M7OA 3ROBA 2IMJA 1I2EA 4G1MB 3LZAA 5IG5A 3GRDA 1IV7A 4R9LA 1Q7HA 4WP5A 2XRXB 5ELUA 1CEWI 2J8XB 1B2ZA 5IW9A 6RNTA 3SVAA 3AHWA 1SJWA 1IYYA 1K28A 1EQKA 3NV0B 1PYLA 1RJOA 3AMOB 3CC43 1UUGB 2CW9A 3G0KA 3M8CA 3QK9A 3EF8A 1OH0A 1IDPA 2PNCA 4LSOA 2JDIH 1Q42A 3SOYA 1ZX2A 4N6TA 1RGCA 3PZWA 3JVCA 2BHMA 1YGEA 2H0GA 1NB3I 3DGLA 2YFIB 1G0TA 1D6UA
chains in the Genus database with same CATH topology
1GD3A 3NM7A 4FCZA 3OV4A 2STDA 3G6E3 4KFDA 1EA2A 3ER7A 4OUQA 3WDGB 4O02B 1QJGA 4BTXA 1OUNA 4JF8A 1N8R4 2IUKA 5AYSC 1VQ83 4AKYA 1DYUA 5EEOA 3WMDA 4N6UA 2ML6A 3EN1B 3U1WA 1K8A4 3SX1A 3DGNA 2WO0A 2ML5A 1JKGA 5FGOA 2BT3A 1VQ73 2BMRB 2BMQB 1O7MB 1STDA 4FMDA 4HBRA 4KFEA 1V74A 1K734 3CCJ3 1OHSA 1NJI4 2OWPA 4O3VA 4XB5A 3L0RA 1ISKA 3K5TA 3F9SA 2KRTA 2WGQA 4GL6A 2OCTA 1VQ53 1JB2A 2CG0A 1N9EA 1QVF2 3B8LA 3K7CA 1AV4A 2B24B 3DM8A 2HMMB 2XEPA 3NM2A 1W6GA 3KFQC 4HM5B 2B1XB 2V1LA 4L8PA 1W02A 2P0XA 3LMLA 3PYJA 2P09A 1WNHA 5D81A 1LXEA 1NWWA 1UUVB 3FSDA 1F8NA 1WMPA 8CHOA 3FKAA 4H61A 4FMBA 3GZXB 3NQYA 1LVNA 1JV2B 3GZYB 2FXTA 5LC7A 1ULJB 3UB1A 3MG3A 1OGXA 3TDGA 3CCE3 2IUJA 2CFWA 1JNQA 4WFOA 4K1VA 1YJ93 3K63A 1ASKA 1TFOA 4N3VA 2CG1A 3STDA 3UNLA 3LTCA 5IG4A 5AIIA 5IG0A 3D9RA 2Z7AA 1UI7A 3NBBA 4N6NB 3G713 2E2TA 1Q814 3NUVA 5KP1A 3I553 2BNGA 4HVNA 2YFJB 2Z76A 3KSPA 2CFDA 3V99A 1FGRA 3F40A 3EJVA 4K1UA 2LQVA 3HIIA 3PCRA 2XFTA 3G16A 4HM3B 4N6OB 1KD14 1GS3A 1EG9B 3PGBA 1K9M4 4X2OA 4BTWA 1WQLB 3AMOA 3BLZA 3GZBA 4IPBA 1AVKA 1PFPA 2XSOB 4NHFA 3MSOA 2HMNB 3CME3 4WYKB 3JUPA 1IT7A 2OQEC 3MHEA 1OACA 1IU7A 3EB8A 1VQ93 1KC84 5CF1A 2CC3A 3BB9A 5AIFA 4MMZB 2INXA 1VQO3 3X3ZA 1E97A 4WHAA 1IVVA 2CWVA 3Q1CA 1OPYA 2D1WA 2HMKB 3K0ZA 3GZRA 2YFLB 1OGZA 2GBWB 1QMAA 2K0MA 1W7CA 1IQXA 2Y74A 4WYKA 3FG3A 3K9MC 3DGOA 4EV2A 1RKYA 3JUNA 4HM0B 1W5ZA 3KIIA 3O8YA 1IV9A 5DRVA 2F99A 3T0UA 1T5YA 2W6JH 4L7KA 3KN4A 3MPHA 1N8QA 3X3YA 4EBGA 1VZZA 1SIHA 1FGQA 1A67A 1OHPA 1W4NA 1KSIA 2E2VA 1JN5B 3LTDA 4HM7B 1K41A 1G96A 2RFRA 2CFKA 3Q2PA 4HM2B 1S723 3BNBA 3H3HA 4QWTA 1GYBA 1GY6A 4MMXB 1OF5B 2OTJ3 1NO3A 1AVLA 1M904 1UI8A 4FCJA 1AR0A 2P0MA 2CH9A 4WWUC 1LOXA 4LZIA 1FGMA 5EQLA 2A15A 1JKGB 1JRQA 3SLUA 3V98A 3OX9A 4ZM8A 3OXAA 3RGAA 5AEWB 3MYTA 1W6CA 3N9HA 3NBRA 3NBJA 2QEX3 1YIJ3 5ELJA 1IQ8A 5LC6A 4CDLA 2ZDJA 2ZL8A 3MWZA 4FMAA 1RRHA 1DMNA 2UX0A 3LT8A 1D6YA 1VQN3 1GY5A 4N6V0 3ECFA 1J2BA 1VQK3 1M1K4 2HMJB 1WMOA 3EX9A 1N5PA 2CIUA 1IQYA 3PXMA 3KKGA 1Y4KA 4X2HA 1O7GB 3VGNA 3HX8A 2OQEA 1QAKA 3GWRA 5STDA 1QVG2 2XR8B 1JB5A 3MG1A 3HZPA 5IERA 2IA7A 1E3RA 1S5AA 5JBSA 3WOEB 2RGQA 2CWUA 3A76A 3EQQB 4OK0A 3FG1A 1CYVA 1OHOA 3IPTA 4LGQA 1IT8A 1KWIA 3HIGA 3X42A 2OOVA 1VQ63 3DY5A 3FG4A 3VSYA 3CU3A 3FZWA 1W01A 4JRFA 3OW22 3ALAA 3T8UA 2P38A 1A2KA 4IIAA 3UL6A 3S67A 1SPUA 3LT9A 1US1A 1VQM3 1YIT3 2OTL3 1A90A 7STDA 3FGYA 3OWYA 2JQ5A 3SOAA 2CFGA 5IF6A 2K54A 3EBTA 3CPW2 2XGLA 1HKXA 2O3OA 4HKVB 1QALA 3GAXA 2O9UX 5EVHA 4RNYA 5A0OB 1FA3A 4HM4B 4HZ9B 4HZBB 2W0QA 1VQP3 3CCQ3 2I9WA 1TIJA 3FF2A 1U5OA 3MKIA 3JUOA 4AEQA 3CC73 3B4OA 3MG2A 5AEUB 1EKMA 5KP3A 2Z77A 1YJW3 1OF5A 3F7XA 3E99A 3X41A 3CCM3 2YX9A 1W2B2 5BXQA 1CQSA 1TFKA 1A2VA 5CLKA 3S28A 4HM1B 3I0YA 1Q824 2WOHA 3CCL3 2XSHB 3EBYA 4EYCA 5IENA 1W2ZA 2CWTA 3FCSB 4HM6B 4R9KA 4STDA 3FLJA 3PS8A 2GU3A 2BO9B 1STFI 2QA43 3LYGA 5CXOA 2CFLA 2W03A 4AKZA 1QAFA 4RZMA 2XGNA 3CPOA 5IEOA 3UL5A 3DZLA 5DREA 2PZVA 4K61A 5D83A 4KZ1A 4N6MA 5FW5A 2L4VA 4CCVA 2CHCA 1DMMA 3CCU3 5AI1A 3VF1A 1KQS2 1W6YA 1VQL3 4TX4A 3CMA3 3CC23 5KP4A 1JB4A 1RN7A 1Q40B 1O7NB 3KE7A 4FCMA 5IG3A 3V92A 1MNLA 5HGRA 1FUWA 2RSXA 3CCS3 4XDVA 4PEJA 1HU9A 4GB5A 4MEIA 1O7PB 3DXOA 2KXGA 4FR9A 4KVHA 1L5GB 2GEYA 1GD4A 3CXC2 1FGOA 3H51A 3IMAB 4XBTA 4NREA 4XBXA 2RCDA 3RGRA 3B4PA 4MMYB 3OWUA 3FF0A 4R4KA 4FMCA 5TGNA 2F86B 3G4S3 2E2UA 1LNHA 4HJLB 4XBYA 2OOVC 1Z1SA 3Q90A 4MJDA 1NDOB 1UW1A 3F7SA 3LTAA 3LOYA 3RDEA 1JJ22 4J8TA 3UJMA 3KZTA 1FGTA 1CYUA 2CK3H 1Q7Y4 3LTBA 3F14A 2W2CA 2W9PA 1ULIB 1N9JA 4ORLA 2FNQA 5AYRB 3NX0A 3BNEA 4O2HA 1BUQA 1M9GA 1ROAA 2GXFA 4XM4A 2QGUA 3U97A 1RRLA 1O7HB 4LEHA 4OVMA 4Q53A 3EE1A 1MOLA 6STDA 4BTYA 1IVWA 3CNMA 1E3VA 2WGOA 1IK3A 3OWSA 4I4KA 3X40A 3S27A 2XH9A 4H3UA 1TP6A 2XF3A 5D82A 3EN8A 2SBLA 5I97A 1NU3A 3S5CA 4L8OA 1ROVA 5IEPA 2HMLB 3WA3A 2W04A 3DUKA 3CCV3 2XFSA 2WOFA 1WTHA 1M1XB 2P05A 4RNZA 3EHCA 1SIIA 2C10A 4N6LA 4R80A 2MC8A 1NB5I 4U13A 3T8NA 1GY7A 5CK6A 2Z6BA 2MF7A 1W00A 3NQZA 2FGTA 4IT7A 3F8XA 3B7CA 1OCVA 2W56A 4EV5A 2LYXA 1YJN3 3CD63 1ZO2A 3FH1A 3IJEB 3DGMA 3CCR3 2GU1A 3CNXA 4EXRA 1DMQA 1IVXA 4LMIA 3PCSA 5AIGA 3EC9A 2R4IA 2W9QA 3I563 1IVUA 3HK4A 1TUHA 4K90B 2CKFB 3DMCA 1TU5A 3WODG 1Q40A 2D42A 1SQWA 2GBXB 1UUWB 2QIYA 3D3LA 3JUQA 4RBNA 3LXUX 2KCDA 1O7WB 3NXJA 4HYZA 1C7HA 1JN5A 3WA2X 3WOFB 4HM8B 2Q07A 3KSED 3BNCA 2GEXA 4KFFA 5CF2A 3F8HA 3NV0A 3N54B 5JPUA 1YVBI 5AIHA 1DVDA 1DVCA 4J9AA 3SXXA 1D6ZA 3JUMA 2C11A 3QRDA 2BMOB 2F98A 1U8CB 1YI23 5G2GA 3BNDA 3HI7A 2HMOB 2W56B 3X3XA 4O8SA 1R4CA 2Y73A 4R1KA 1VQ43 4EC6A 1WMNA 3LH4A 3NHXA 3G8ZA 5JPPA 3J7Yd 1N5HA 4XDWA 3S29A 3SEDA 1PU4A 5BVBA 1Q864 3N8BA 1YHQ3 2M7OA 3ROBA 2IMJA 4G1MB 3LZAA 5IG5A 3GRDA 1IV7A 4R9LA 4WP5A 2XRXB 5ELUA 1CEWI 5IW9A 3SVAA 1SJWA 1K28A 1EQKA 3NV0B 1RJOA 3AMOB 3CC43 3QK9A 2CW9A 3G0KA 3M8CA 3EF8A 1OH0A 1IDPA 2PNCA 4LSOA 2JDIH 1Q42A 3SOYA 1ZX2A 4N6TA 3PZWA 3JVCA 2BHMA 1YGEA 1NB3I 3DGLA 2YFIB 1D6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD3 A;  3L0R A;  3MWZ A;  3Q2P A;  4EYC A;  3GAX A;  2O9U X;  1RN7 A;  2OCT A;  1CYV A;  5A0O B;  1YVB I;  1FA3 A;  1DVD A;  1PFP A;  1IV7 A;  3PS8 A;  1DVC A;  4N6V 0;  1KWI A;  1MNL A;  3K9M C;  2BO9 B;  1STF I;  5ELU A;  1CEW I;  1N5P A;  1CYU A;  1FUW A;  4N6N B;  3QRD A;  1TIJ A;  3KFQ C;  2CH9 A;  2W9Q A;  3SVA A;  3PXM A;  4LZI A;  1IV9 A;  2W9P A;  1N9J A;  3PYJ A;  1WNH A;  2KXG A;  1LXE A;  5EQL A;  3NX0 A;  4N6L A;  3UL5 A;  1EQK A;  4N6U A;  1M9G A;  1ROA A;  1GD4 A;  1R4C A;  3UL6 A;  3IMA B;  4N6M A;  3S67 A;  4ZM8 A;  1NB5 I;  3LH4 A;  4CCV A;  4IT7 A;  1N5H A;  4N6T A;  1A67 A;  4N6O B;  5ELJ A;  5LC7 A;  1A90 A;  3KSE D;  1NB3 I;  4TX4 A;  1G96 A;  1MOL A;  5LC6 A; 
#chains in the Genus database with same CATH topology
 1GD3 A;  3NM7 A;  4FCZ A;  1UGI A;  3OV4 A;  2STD A;  3G6E 3;  1FW7 A;  3URP A;  1HYF A;  4KFD A;  1EA2 A;  3ER7 A;  4OUQ A;  3WDG B;  4O02 B;  4BL3 A;  1QJG A;  1T2H A;  4BTX A;  1OUN A;  4JF8 A;  1N8R 4;  1GOV A;  2IUK A;  5AYS C;  1VQ8 3;  2RNT A;  4AKY A;  1DYU A;  1TTO A;  5EEO A;  3WMD A;  4N6U A;  2GSP A;  2ML6 A;  3EN1 B;  4BIR A;  1A2P A;  3U1W A;  5M18 A;  3SX1 A;  3DGN A;  1K8A 4;  2WO0 A;  2ML5 A;  1JKG A;  5FGO A;  2BT3 A;  1VQ7 3;  2BMQ B;  2BMR B;  1O7M B;  1STD A;  4FMD A;  1BNS A;  4HBR A;  2K3D A;  1V74 A;  4KFE A;  1X1U A;  1K73 4;  1BNG A;  1OHS A;  3CCJ 3;  1NJI 4;  1T3B A;  2OWP A;  4O3V A;  4XB5 A;  3L0R A;  1ISK A;  3K5T A;  3F9S A;  2KRT A;  2WGQ A;  4GL6 A;  2OCT A;  1VQ5 3;  1JB2 A;  2F5M A;  2CG0 A;  1BAN A;  1N9E A;  1QVF 2;  1JZO A;  3B8L A;  3K7C A;  1AV4 A;  1B2M A;  2B24 B;  3DM8 A;  2HMM B;  2XEP A;  3NM2 A;  5G1K A;  1W6G A;  3KFQ C;  4HM5 B;  2B1X B;  4HOH A;  2V1L A;  1BNF A;  1W02 A;  1BAO A;  2P0X A;  3LML A;  4L8P A;  3PYJ A;  2P09 A;  1WNH A;  5D81 A;  1LXE A;  1NWW A;  1UUV B;  3FSD A;  1F8N A;  1WMP A;  8CHO A;  3FKA A;  4H61 A;  4FMB A;  4NPB A;  9RNT A;  2HOH A;  1UGH I;  3GZX B;  3NQY A;  1LVN A;  1JV2 B;  3GZY B;  2FXT A;  1Q9E A;  1V57 A;  5LC7 A;  1ULJ B;  1BRI A;  3UB1 A;  1TRP A;  1BSD A;  1JBS A;  3MG3 A;  1OGX A;  2SAR A;  3TDG A;  3CCE 3;  2IUJ A;  2CFW A;  1JNQ A;  4WFO A;  3D5I A;  4K1V A;  1YJ9 3;  1GOU A;  3K63 A;  1ASK A;  1TFO A;  4N3V A;  2CG1 A;  3STD A;  3UNL A;  3LTC A;  1TJD A;  5IG4 A;  5AII A;  5IG0 A;  1R4Y A;  3D9R A;  2Z7A A;  1UI7 A;  1BRH A;  3NBB A;  4N6N B;  3G71 3;  2E2T A;  1Q81 4;  3BIR A;  3NUV A;  5KP1 A;  3I55 3;  2BNG A;  4HVN A;  2YFJ B;  2Z76 A;  3KSP A;  2CFD A;  3V99 A;  2KF4 A;  1FGR A;  1ZGX A;  3EJV A;  3F40 A;  4K1U A;  2LQV A;  3HII A;  3PCR A;  1HZ1 A;  2XFT A;  3DGY A;  3G16 A;  1B20 A;  4HM3 B;  1RDS A;  4HAA A;  4N6O B;  1T2I A;  1KD1 4;  1GS3 A;  1EG9 B;  1GMQ A;  3PGB A;  1RN1 A;  1K9M 4;  4X2O A;  4BTW A;  1WQL B;  3AMO A;  3BLZ A;  3GZB A;  4IPB A;  1AVK A;  1PFP A;  2XSO B;  1RMS A;  4NHF A;  3MSO A;  2HMN B;  3CME 3;  4WYK B;  3JUP A;  1IT7 A;  1MGW A;  2OQE C;  3MHE A;  1LOV A;  1IU7 A;  1OAC A;  3EB8 A;  1VQ9 3;  1LOY A;  4CJN A;  1KC8 4;  1EUI C;  5CF1 A;  2CC3 A;  3BB9 A;  5AIF A;  4MMZ B;  2INX A;  1VQO 3;  3X3Z A;  1E97 A;  4WHA A;  1IVV A;  4EW5 A;  2CWV A;  2KF5 A;  2H0H A;  3Q1C A;  1OPY A;  1RGG A;  2D1W A;  1RCK A;  2HMK B;  3D79 A;  3K0Z A;  3GZR A;  2YFL B;  1B2S A;  1OGZ A;  2GBW B;  1FZU A;  1QMA A;  1TRQ A;  2K0M A;  4GHO A;  1W7C A;  1I8V A;  1IQX A;  2Y74 A;  4WYK A;  3FG3 A;  3K9M C;  3DGO A;  4EV2 A;  1RKY A;  1UCL A;  1B21 A;  3JUN A;  1RGH A;  4HM0 B;  1GSP A;  1W5Z A;  1B27 A;  3KII A;  3O8Y A;  1IV9 A;  2C4B A;  2F99 A;  5DRV A;  1T5Y A;  1LQG C;  2W6J H;  3T0U A;  4L7K A;  2UGI A;  3KN4 A;  3MPH A;  4BL2 A;  1BNR A;  1BNE A;  1N8Q A;  3X3Y A;  4EBG A;  1RHL A;  1UCK A;  1VZZ A;  1I3I A;  1SIH A;  1FGQ A;  1A67 A;  1OHP A;  1W4N A;  1KSI A;  2E2V A;  1JN5 B;  3LTD A;  4HM7 B;  1G96 A;  1K41 A;  1I0V A;  2RFR A;  2CFK A;  3Q2P A;  4HM2 B;  1S72 3;  1G02 A;  4BU4 A;  3BNB A;  3H3H A;  4QWT A;  1GYB A;  1GY6 A;  4MMX B;  1OF5 B;  2OTJ 3;  1NO3 A;  1AVL A;  1M90 4;  1UI8 A;  4FCJ A;  1AR0 A;  2P0M A;  2CH9 A;  4WWU C;  1LOX A;  4LZI A;  1FGM A;  2F5W A;  5EQL A;  2A15 A;  1JKG B;  1JRQ A;  3SLU A;  3V98 A;  1DET A;  3OX9 A;  4ZM8 A;  3OXA A;  3RGA A;  5AEW B;  3MYT A;  1W6C A;  3N9H A;  3NBR A;  3NBJ A;  2QEX 3;  1X1W A;  1YIJ 3;  5ELJ A;  1IQ8 A;  5LC6 A;  4CDL A;  8RNT A;  2ZDJ A;  2ZL8 A;  3MWZ A;  2IYJ A;  4FMA A;  3AGN A;  1GMP A;  1RRH A;  1DMN A;  1X1X A;  2KF6 A;  2UX0 A;  2F56 A;  3LT8 A;  1D6Y A;  1VQN 3;  1GY5 A;  4N6V 0;  3ECF A;  5GSP A;  1J2B A;  1VQK 3;  1M1K 4;  2HMJ B;  1WMO A;  3EX9 A;  1N5P A;  2CIU A;  1IQY A;  3PXM A;  3KKG A;  1Y4K A;  4X2H A;  1CH0 A;  1O7G B;  4CPK A;  3VGN A;  3HX8 A;  4RNT A;  2UUG C;  2OQE A;  1RSN A;  1QAK A;  3GWR A;  5RNT A;  1UCI A;  5STD A;  1QVG 2;  2XR8 B;  1JB5 A;  3MG1 A;  3HZP A;  3RNT A;  5IER A;  2IA7 A;  1E3R A;  1S5A A;  5JBS A;  3WOE B;  2RGQ A;  1FUT A;  2CWU A;  3A76 A;  3WHO A;  3EQQ B;  4OK0 A;  3FG1 A;  1CYV A;  1X1Y A;  1OHO A;  3IPT A;  3DH2 A;  4LGQ A;  1IT8 A;  1RLS A;  1I70 A;  1KWI A;  3HIG A;  2OOV A;  1BGS A;  3X42 A;  1VQ6 3;  3DY5 A;  3FG4 A;  3VSY A;  3CU3 A;  3FZW A;  1W01 A;  4JRF A;  3OW2 2;  3ALA A;  3T8U A;  2P38 A;  1A2K A;  1RGK A;  1YNV X;  4IIA A;  3UL6 A;  3S67 A;  1I3F A;  1SPU A;  3LT9 A;  1US1 A;  1VQM 3;  1YIT 3;  1PY3 A;  2OTL 3;  1A90 A;  7STD A;  3FGY A;  3OWY A;  2JQ5 A;  3SOA A;  2CFG A;  5IF6 A;  2K54 A;  3EBT A;  3CPW 2;  2XGL A;  1HKX A;  2O3O A;  4HKV B;  1QAL A;  1B2X A;  3GAX A;  2O9U X;  5BIR A;  5EVH A;  4RNY A;  5G1L A;  5A0O B;  1FA3 A;  4HM4 B;  4HZ9 B;  4HZB B;  2W0Q A;  3AHS A;  1VQP 3;  3CCQ 3;  2I9W A;  1TIJ A;  1BIR A;  1U5O A;  3FF2 A;  3MKI A;  3JUO A;  4AEQ A;  3CC7 3;  3B4O A;  1MWR A;  3MG2 A;  5AEU B;  1EKM A;  2AAD A;  5KP3 A;  2Z77 A;  1YJW 3;  1RCL A;  1OF5 A;  3F7X A;  4J5G A;  3E99 A;  3X41 A;  1BRK A;  4ILF A;  1BSB A;  1NNV A;  2YX9 A;  3CCM 3;  1W2B 2;  5BXQ A;  1CQS A;  1TFK A;  1A2V A;  1V58 A;  5CLK A;  3S28 A;  2L1S A;  4HM1 B;  3I0Y A;  1Q82 4;  2WOH A;  3CCL 3;  3WR2 A;  2XSH B;  3EBY A;  4EYC A;  2KF3 A;  5IEN A;  1BSE A;  1W2Z A;  2CWT A;  3FCS B;  4HM6 B;  4R9K A;  4STD A;  3FLJ A;  3PS8 A;  2GU3 A;  4KT3 B;  5HOH A;  2BO9 B;  1STF I;  1VQQ A;  2QA4 3;  3LYG A;  5CXO A;  2CFL A;  2W03 A;  4AKZ A;  1QAF A;  4RZM A;  1BRS A;  2XGN A;  1I2F A;  3CPO A;  5IEO A;  3ZG0 A;  1FUS A;  3UL5 A;  1JBT A;  3DZL A;  5DRE A;  2PZV A;  4K61 A;  5D83 A;  2F4Y A;  4KZ1 A;  4N6M A;  5FW5 A;  2L4V A;  4CCV A;  2CHC A;  1DMM A;  3CCU 3;  1B2U A;  1LOW A;  5AI1 A;  7RNT A;  3VF1 A;  1KQS 2;  1W6Y A;  1VQL 3;  4TX4 A;  1JBR A;  3A5E A;  1RGF A;  3CMA 3;  3CC2 3;  1C54 A;  1GMR A;  5M1A A;  5KP4 A;  1JB4 A;  1RN7 A;  1BSC A;  1Q40 B;  1O7N B;  3KE7 A;  4FCM A;  5IG3 A;  3V92 A;  4DKI A;  1MNL A;  1DE3 A;  5HGR A;  2BU4 A;  1FUW A;  2RSX A;  3ZFZ A;  3CCS 3;  4XDV A;  4PEJ A;  1HU9 A;  4GB5 A;  4MEI A;  1O7P B;  2CX0 A;  1BVI A;  2KXG A;  3DXO A;  4FR9 A;  4KVH A;  1L5G B;  1LNI A;  2GEY A;  1GD4 A;  3CXC 2;  1FGO A;  1RNT A;  2KAA A;  3H51 A;  3IMA B;  3Q3F A;  4XBT A;  4NRE A;  4XBX A;  2IY2 A;  1I0X A;  2RCD A;  3RGR A;  3B4P A;  2ZA4 A;  4MMY B;  3OWU A;  1BOX A;  1AY7 A;  3FF0 A;  4R4K A;  4FMC A;  5TGN A;  1BSA A;  2F86 B;  2E2U A;  3G4S 3;  1LNH A;  2CX1 A;  4HJL B;  4XBY A;  2OOV C;  1BRJ A;  1Z1S A;  3Q90 A;  4MJD A;  1NDO B;  1UW1 A;  3F7S A;  1MWU A;  3LTA A;  3LOY A;  3RDE A;  1JJ2 2;  4J8T A;  3UJM A;  1MWS A;  1RGA A;  1FGT A;  3KZT A;  4LYL B;  2CK3 H;  2RBI A;  1CYU A;  1LRA A;  1JZD A;  1Q7Y 4;  3LTB A;  3F14 A;  2W2C A;  2W9P A;  1ULI B;  1N9J A;  4ORL A;  2FNQ A;  1UCJ A;  5AYR B;  3NX0 A;  3BNE A;  4I5Q A;  4O2H A;  1BUQ A;  1M9G A;  1ROA A;  1BRG A;  3SYU A;  2GXF A;  4XM4 A;  2QGU A;  3U97 A;  1RRL A;  1O7H B;  1BUJ A;  4LEH A;  4OVM A;  4Q53 A;  1MOL A;  3EE1 A;  6STD A;  4BTY A;  1IVW A;  3CNM A;  1E3V A;  2WGO A;  1IK3 A;  3OWS A;  4I4K A;  3X40 A;  3S27 A;  2XH9 A;  4GSP A;  1TP6 A;  2XF3 A;  1ZS7 A;  3EN8 A;  2SBL A;  4H3U A;  5D82 A;  5I97 A;  5M19 A;  1NU3 A;  3S5C A;  1YGW A;  4L8O A;  1ROV A;  4J5K A;  5IEP A;  2HML B;  3WA3 A;  2W04 A;  3DUK A;  3CCV 3;  2XFS A;  2WOF A;  2R41 A;  1WTH A;  1M1X B;  2P05 A;  4RNZ A;  3EHC A;  1MGR A;  1SII A;  2C10 A;  3AGO A;  3HOH A;  4N6L A;  4R80 A;  2MC8 A;  1I2G A;  1RGE A;  1SAR A;  1NB5 I;  4U13 A;  3T8N A;  1GY7 A;  5CK6 A;  2Z6B A;  2MF7 A;  1W00 A;  3NQZ A;  2FGT A;  1BRN L;  4IT7 A;  3F8X A;  3B7C A;  1OCV A;  1RNB A;  2W56 A;  2ZHX B;  4EV5 A;  2LYX A;  2AAE A;  1BU4 A;  1YJN 3;  3CD6 3;  1ZO2 A;  3FH1 A;  1BNJ A;  3DGM A;  3IJE B;  3CCR 3;  2GU1 A;  3CNX A;  4EXR A;  1DMQ A;  5BU4 A;  1IVX A;  4LMI A;  3PCS A;  5AIG A;  3EC9 A;  2R4I A;  2W9Q A;  3I56 3;  1IVU A;  3HK4 A;  1TUH A;  3BU4 A;  1AQZ A;  4K90 B;  1GOY A;  1RGL A;  2CKF B;  3DMC A;  1TU5 A;  1FYS A;  1Q40 A;  2D42 A;  1SQW A;  3WOD G;  2GBX B;  1UUW B;  1YVS A;  2QIY A;  3D3L A;  3JUQ A;  4RBN A;  3LXU X;  2KCD A;  1O7W B;  3GSP A;  3NXJ A;  4HYZ A;  1C7H A;  1JN5 A;  3WA2 X;  1EEJ A;  2BIR A;  3WOF B;  4HM8 B;  1RTU A;  2Q07 A;  3KSE D;  3BNC A;  2GEX A;  4KFF A;  5CF2 A;  3F8H A;  3NV0 A;  3N54 B;  3D4A A;  5JPU A;  1UDI I;  1YVB I;  1RN4 A;  5AIH A;  1DVD A;  1DVC A;  3ZG5 A;  4J9A A;  3SXX A;  2H0I A;  1D6Z A;  3JUM A;  1LQM B;  1MWT A;  2C11 A;  3QRD A;  2BMO B;  2F98 A;  1U8C B;  1YI2 3;  5G2G A;  3BND A;  3D5G A;  2HMO B;  3HI7 A;  2W56 B;  3X3X A;  7GSP A;  4O8S A;  1R4C A;  2Y73 A;  4R1K A;  1VQ4 3;  4EC6 A;  1BNI A;  1WMN A;  3LH4 A;  3G8Z A;  3NHX A;  3KCH A;  1N5H A;  4XDW A;  3S29 A;  5JPP A;  3J7Y d;  1B3S A;  3SED A;  1PU4 A;  5BVB A;  1Q86 4;  3N8B A;  6GSP A;  1YHQ 3;  2M7O A;  3ROB A;  2IMJ A;  1I2E A;  4G1M B;  3LZA A;  5IG5 A;  3GRD A;  1IV7 A;  4R9L A;  1Q7H A;  4WP5 A;  2XRX B;  5ELU A;  1CEW I;  2J8X B;  1B2Z A;  5IW9 A;  6RNT A;  3SVA A;  3AHW A;  1SJW A;  1IYY A;  1K28 A;  1EQK A;  3NV0 B;  1PYL A;  1RJO A;  3AMO B;  3CC4 3;  1UUG B;  2CW9 A;  3G0K A;  3M8C A;  3QK9 A;  3EF8 A;  1OH0 A;  1IDP A;  2PNC A;  4LSO A;  2JDI H;  1Q42 A;  3SOY A;  1ZX2 A;  4N6T A;  1RGC A;  3PZW A;  3JVC A;  2BHM A;  1YGE A;  2H0G A;  1NB3 I;  3DGL A;  2YFI B;  1G0T A;  1D6U A; 
#chains in the Genus database with same CATH homology
 1GD3 A;  3NM7 A;  4FCZ A;  3OV4 A;  2STD A;  3G6E 3;  4KFD A;  1EA2 A;  3ER7 A;  4OUQ A;  3WDG B;  4O02 B;  1QJG A;  4BTX A;  1OUN A;  4JF8 A;  1N8R 4;  2IUK A;  5AYS C;  1VQ8 3;  4AKY A;  1DYU A;  5EEO A;  3WMD A;  4N6U A;  2ML6 A;  3EN1 B;  3U1W A;  1K8A 4;  3SX1 A;  3DGN A;  2WO0 A;  2ML5 A;  1JKG A;  5FGO A;  2BT3 A;  1VQ7 3;  2BMR B;  2BMQ B;  1O7M B;  1STD A;  4FMD A;  4HBR A;  4KFE A;  1V74 A;  1K73 4;  3CCJ 3;  1OHS A;  1NJI 4;  2OWP A;  4O3V A;  4XB5 A;  3L0R A;  1ISK A;  3K5T A;  3F9S A;  2KRT A;  2WGQ A;  4GL6 A;  2OCT A;  1VQ5 3;  1JB2 A;  2CG0 A;  1N9E A;  1QVF 2;  3B8L A;  3K7C A;  1AV4 A;  2B24 B;  3DM8 A;  2HMM B;  2XEP A;  3NM2 A;  1W6G A;  3KFQ C;  4HM5 B;  2B1X B;  2V1L A;  4L8P A;  1W02 A;  2P0X A;  3LML A;  3PYJ A;  2P09 A;  1WNH A;  5D81 A;  1LXE A;  1NWW A;  1UUV B;  3FSD A;  1F8N A;  1WMP A;  8CHO A;  3FKA A;  4H61 A;  4FMB A;  3GZX B;  3NQY A;  1LVN A;  1JV2 B;  3GZY B;  2FXT A;  5LC7 A;  1ULJ B;  3UB1 A;  3MG3 A;  1OGX A;  3TDG A;  3CCE 3;  2IUJ A;  2CFW A;  1JNQ A;  4WFO A;  4K1V A;  1YJ9 3;  3K63 A;  1ASK A;  1TFO A;  4N3V A;  2CG1 A;  3STD A;  3UNL A;  3LTC A;  5IG4 A;  5AII A;  5IG0 A;  3D9R A;  2Z7A A;  1UI7 A;  3NBB A;  4N6N B;  3G71 3;  2E2T A;  1Q81 4;  3NUV A;  5KP1 A;  3I55 3;  2BNG A;  4HVN A;  2YFJ B;  2Z76 A;  3KSP A;  2CFD A;  3V99 A;  1FGR A;  3F40 A;  3EJV A;  4K1U A;  2LQV A;  3HII A;  3PCR A;  2XFT A;  3G16 A;  4HM3 B;  4N6O B;  1KD1 4;  1GS3 A;  1EG9 B;  3PGB A;  1K9M 4;  4X2O A;  4BTW A;  1WQL B;  3AMO A;  3BLZ A;  3GZB A;  4IPB A;  1AVK A;  1PFP A;  2XSO B;  4NHF A;  3MSO A;  2HMN B;  3CME 3;  4WYK B;  3JUP A;  1IT7 A;  2OQE C;  3MHE A;  1OAC A;  1IU7 A;  3EB8 A;  1VQ9 3;  1KC8 4;  5CF1 A;  2CC3 A;  3BB9 A;  5AIF A;  4MMZ B;  2INX A;  1VQO 3;  3X3Z A;  1E97 A;  4WHA A;  1IVV A;  2CWV A;  3Q1C A;  1OPY A;  2D1W A;  2HMK B;  3K0Z A;  3GZR A;  2YFL B;  1OGZ A;  2GBW B;  1QMA A;  2K0M A;  1W7C A;  1IQX A;  2Y74 A;  4WYK A;  3FG3 A;  3K9M C;  3DGO A;  4EV2 A;  1RKY A;  3JUN A;  4HM0 B;  1W5Z A;  3KII A;  3O8Y A;  1IV9 A;  5DRV A;  2F99 A;  3T0U A;  1T5Y A;  2W6J H;  4L7K A;  3KN4 A;  3MPH A;  1N8Q A;  3X3Y A;  4EBG A;  1VZZ A;  1SIH A;  1FGQ A;  1A67 A;  1OHP A;  1W4N A;  1KSI A;  2E2V A;  1JN5 B;  3LTD A;  4HM7 B;  1K41 A;  1G96 A;  2RFR A;  2CFK A;  3Q2P A;  4HM2 B;  1S72 3;  3BNB A;  3H3H A;  4QWT A;  1GYB A;  1GY6 A;  4MMX B;  1OF5 B;  2OTJ 3;  1NO3 A;  1AVL A;  1M90 4;  1UI8 A;  4FCJ A;  1AR0 A;  2P0M A;  2CH9 A;  4WWU C;  1LOX A;  4LZI A;  1FGM A;  5EQL A;  2A15 A;  1JKG B;  1JRQ A;  3SLU A;  3V98 A;  3OX9 A;  4ZM8 A;  3OXA A;  3RGA A;  5AEW B;  3MYT A;  1W6C A;  3N9H A;  3NBR A;  3NBJ A;  2QEX 3;  1YIJ 3;  5ELJ A;  1IQ8 A;  5LC6 A;  4CDL A;  2ZDJ A;  2ZL8 A;  3MWZ A;  4FMA A;  1RRH A;  1DMN A;  2UX0 A;  3LT8 A;  1D6Y A;  1VQN 3;  1GY5 A;  4N6V 0;  3ECF A;  1J2B A;  1VQK 3;  1M1K 4;  2HMJ B;  1WMO A;  3EX9 A;  1N5P A;  2CIU A;  1IQY A;  3PXM A;  3KKG A;  1Y4K A;  4X2H A;  1O7G B;  3VGN A;  3HX8 A;  2OQE A;  1QAK A;  3GWR A;  5STD A;  1QVG 2;  2XR8 B;  1JB5 A;  3MG1 A;  3HZP A;  5IER A;  2IA7 A;  1E3R A;  1S5A A;  5JBS A;  3WOE B;  2RGQ A;  2CWU A;  3A76 A;  3EQQ B;  4OK0 A;  3FG1 A;  1CYV A;  1OHO A;  3IPT A;  4LGQ A;  1IT8 A;  1KWI A;  3HIG A;  3X42 A;  2OOV A;  1VQ6 3;  3DY5 A;  3FG4 A;  3VSY A;  3CU3 A;  3FZW A;  1W01 A;  4JRF A;  3OW2 2;  3ALA A;  3T8U A;  2P38 A;  1A2K A;  4IIA A;  3UL6 A;  3S67 A;  1SPU A;  3LT9 A;  1US1 A;  1VQM 3;  1YIT 3;  2OTL 3;  1A90 A;  7STD A;  3FGY A;  3OWY A;  2JQ5 A;  3SOA A;  2CFG A;  5IF6 A;  2K54 A;  3EBT A;  3CPW 2;  2XGL A;  1HKX A;  2O3O A;  4HKV B;  1QAL A;  3GAX A;  2O9U X;  5EVH A;  4RNY A;  5A0O B;  1FA3 A;  4HM4 B;  4HZ9 B;  4HZB B;  2W0Q A;  1VQP 3;  3CCQ 3;  2I9W A;  1TIJ A;  3FF2 A;  1U5O A;  3MKI A;  3JUO A;  4AEQ A;  3CC7 3;  3B4O A;  3MG2 A;  5AEU B;  1EKM A;  5KP3 A;  2Z77 A;  1YJW 3;  1OF5 A;  3F7X A;  3E99 A;  3X41 A;  3CCM 3;  2YX9 A;  1W2B 2;  5BXQ A;  1CQS A;  1TFK A;  1A2V A;  5CLK A;  3S28 A;  4HM1 B;  3I0Y A;  1Q82 4;  2WOH A;  3CCL 3;  2XSH B;  3EBY A;  4EYC A;  5IEN A;  1W2Z A;  2CWT A;  3FCS B;  4HM6 B;  4R9K A;  4STD A;  3FLJ A;  3PS8 A;  2GU3 A;  2BO9 B;  1STF I;  2QA4 3;  3LYG A;  5CXO A;  2CFL A;  2W03 A;  4AKZ A;  1QAF A;  4RZM A;  2XGN A;  3CPO A;  5IEO A;  3UL5 A;  3DZL A;  5DRE A;  2PZV A;  4K61 A;  5D83 A;  4KZ1 A;  4N6M A;  5FW5 A;  2L4V A;  4CCV A;  2CHC A;  1DMM A;  3CCU 3;  5AI1 A;  3VF1 A;  1KQS 2;  1W6Y A;  1VQL 3;  4TX4 A;  3CMA 3;  3CC2 3;  5KP4 A;  1JB4 A;  1RN7 A;  1Q40 B;  1O7N B;  3KE7 A;  4FCM A;  5IG3 A;  3V92 A;  1MNL A;  5HGR A;  1FUW A;  2RSX A;  3CCS 3;  4XDV A;  4PEJ A;  1HU9 A;  4GB5 A;  4MEI A;  1O7P B;  3DXO A;  2KXG A;  4FR9 A;  4KVH A;  1L5G B;  2GEY A;  1GD4 A;  3CXC 2;  1FGO A;  3H51 A;  3IMA B;  4XBT A;  4NRE A;  4XBX A;  2RCD A;  3RGR A;  3B4P A;  4MMY B;  3OWU A;  3FF0 A;  4R4K A;  4FMC A;  5TGN A;  2F86 B;  3G4S 3;  2E2U A;  1LNH A;  4HJL B;  4XBY A;  2OOV C;  1Z1S A;  3Q90 A;  4MJD A;  1NDO B;  1UW1 A;  3F7S A;  3LTA A;  3LOY A;  3RDE A;  1JJ2 2;  4J8T A;  3UJM A;  3KZT A;  1FGT A;  1CYU A;  2CK3 H;  1Q7Y 4;  3LTB A;  3F14 A;  2W2C A;  2W9P A;  1ULI B;  1N9J A;  4ORL A;  2FNQ A;  5AYR B;  3NX0 A;  3BNE A;  4O2H A;  1BUQ A;  1M9G A;  1ROA A;  2GXF A;  4XM4 A;  2QGU A;  3U97 A;  1RRL A;  1O7H B;  4LEH A;  4OVM A;  4Q53 A;  3EE1 A;  1MOL A;  6STD A;  4BTY A;  1IVW A;  3CNM A;  1E3V A;  2WGO A;  1IK3 A;  3OWS A;  4I4K A;  3X40 A;  3S27 A;  2XH9 A;  4H3U A;  1TP6 A;  2XF3 A;  5D82 A;  3EN8 A;  2SBL A;  5I97 A;  1NU3 A;  3S5C A;  4L8O A;  1ROV A;  5IEP A;  2HML B;  3WA3 A;  2W04 A;  3DUK A;  3CCV 3;  2XFS A;  2WOF A;  1WTH A;  1M1X B;  2P05 A;  4RNZ A;  3EHC A;  1SII A;  2C10 A;  4N6L A;  4R80 A;  2MC8 A;  1NB5 I;  4U13 A;  3T8N A;  1GY7 A;  5CK6 A;  2Z6B A;  2MF7 A;  1W00 A;  3NQZ A;  2FGT A;  4IT7 A;  3F8X A;  3B7C A;  1OCV A;  2W56 A;  4EV5 A;  2LYX A;  1YJN 3;  3CD6 3;  1ZO2 A;  3FH1 A;  3IJE B;  3DGM A;  3CCR 3;  2GU1 A;  3CNX A;  4EXR A;  1DMQ A;  1IVX A;  4LMI A;  3PCS A;  5AIG A;  3EC9 A;  2R4I A;  2W9Q A;  3I56 3;  1IVU A;  3HK4 A;  1TUH A;  4K90 B;  2CKF B;  3DMC A;  1TU5 A;  3WOD G;  1Q40 A;  2D42 A;  1SQW A;  2GBX B;  1UUW B;  2QIY A;  3D3L A;  3JUQ A;  4RBN A;  3LXU X;  2KCD A;  1O7W B;  3NXJ A;  4HYZ A;  1C7H A;  1JN5 A;  3WA2 X;  3WOF B;  4HM8 B;  2Q07 A;  3KSE D;  3BNC A;  2GEX A;  4KFF A;  5CF2 A;  3F8H A;  3NV0 A;  3N54 B;  5JPU A;  1YVB I;  5AIH A;  1DVD A;  1DVC A;  4J9A A;  3SXX A;  1D6Z A;  3JUM A;  2C11 A;  3QRD A;  2BMO B;  2F98 A;  1U8C B;  1YI2 3;  5G2G A;  3BND A;  3HI7 A;  2HMO B;  2W56 B;  3X3X A;  4O8S A;  1R4C A;  2Y73 A;  4R1K A;  1VQ4 3;  4EC6 A;  1WMN A;  3LH4 A;  3NHX A;  3G8Z A;  5JPP A;  3J7Y d;  1N5H A;  4XDW A;  3S29 A;  3SED A;  1PU4 A;  5BVB A;  1Q86 4;  3N8B A;  1YHQ 3;  2M7O A;  3ROB A;  2IMJ A;  4G1M B;  3LZA A;  5IG5 A;  3GRD A;  1IV7 A;  4R9L A;  4WP5 A;  2XRX B;  5ELU A;  1CEW I;  5IW9 A;  3SVA A;  1SJW A;  1K28 A;  1EQK A;  3NV0 B;  1RJO A;  3AMO B;  3CC4 3;  3QK9 A;  2CW9 A;  3G0K A;  3M8C A;  3EF8 A;  1OH0 A;  1IDP A;  2PNC A;  4LSO A;  2JDI H;  1Q42 A;  3SOY A;  1ZX2 A;  4N6T A;  3PZW A;  3JVC A;  2BHM A;  1YGE A;  1NB3 I;  3DGL A;  2YFI B;  1D6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...