5ELUA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
NENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVDLTRFPVTTMYYLTLEAKDGGKKKLYEAKVWVKGYLLEELKHNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
molecule keywords SUMO-Affirmer-S2B3
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eluA00
3LH4A 4CCVA 1N9JA 3KSED 5LC7A 1R4CA 1YVBI 2OCTA 3KFQC 5A0OB 3IMAB 4N6V0 1M9GA 3PXMA 5LC6A 1STFI 1FA3A 1NB3I 1PFPA 1A67A 1G96A 1CYVA 3MWZA 1DVDA 1EQKA 1TIJA 1IV9A 3K9MC 1ROAA 1CEWI 1NB5I 1GD3A 1MOLA 3SVAA 4LZIA 1MNLA 4N6LA 2W9QA 3PYJA 3GAXA 3L0RA 3S67A 4EYCA 4N6OB 5ELUA 3QRDA 3PS8A 1DVCA 5ELJA 2W9PA 3UL6A 4ZM8A 4N6UA 1N5PA 1GD4A 3Q2PA 4N6TA 4N6NB 1CYUA 1A90A 4N6MA 3UL5A 1RN7A 4IT7A 2BO9B 4TX4A 1IV7A 1LXEA 2KXGA 2CH9A 1WNHA 2O9UX 1KWIA 1FUWA 3NX0A 5EQLA 1N5HA
chains in the Genus database with same CATH superfamily
5GSPA 5HGRA 1VQ83 1GOVA 3OX9A 2OCTA 1RGEA 1UCLA 1DYUA 4JF8A 3RDEA 2XSOB 3X3ZA 5FGOA 3EJVA 1JBSA 1Q40A 3DGNA 1SJWA 1AVLA 3WHOA 4K1VA 3F9SA 1YNVX 3MG2A 1BUJA 3GZRA 5BU4A 3N8BA 1IQYA 4QWTA 3V98A 1W02A 3BU4A 3MYTA 1OACA 1B27A 1A2PA 2BHMA 5CXOA 2KF3A 1JN5B 4J9AA 2HMJB 4HM1B 7RNTA 2W9PA 1I8VA 1ULJB 1YVSA 3F7XA 3Q2PA 4HM2B 2BMQB 4KZ1A 4N6TA 1BAOA 1BU4A 1JB2A 3LMLA 3NV0A 2ZL8A 3X3XA 1DMNA 2M7OA 1IDPA 2D42A 2INXA 4IIAA 1WNHA 1NDOB 3DZLA 4RBNA 1VQO3 1DMQA 1BRGA 4KFDA 5EQLA 1LOWA 1Q9EA 2CFWA 3CU3A 3VSYA 5M19A 1RGKA 3GZBA 3KE7A 1O7NB 1W6CA 1AQZA 5IEOA 1VQ73 1M9GA 1HU9A 1B2SA 2GEXA 4FCJA 1V74A 3DGLA 1K41A 3SOAA 1E3VA 1CYVA 1LVNA 1BANA 1K9M4 2OTJ3 3DH2A 1SARA 1ROAA 1E3RA 1RNTA 2BU4A 3CNXA 4X2HA 3KN4A 1O7MB 3Q90A 4HZBB 1RLSA 3L0RA 2WOFA 4AKYA 2CWTA 2CG1A 4EW5A 4K61A 1NJI4 4HJLB 1MWUA 1VZZA 4N6UA 1RRLA 3LT9A 1RN1A 1IVWA 3SEDA 3MKIA 2XFSA 4XDVA 2CX0A 3D5GA 1TRPA 1A2VA 4IT7A 1LXEA 2KXGA 3K63A 3FF0A 1LQMB 2LYXA 1I3IA 1FZUA 1AY7A 3AHWA 3KIIA 2Y73A 1K734 1UGIA 5CK6A 2W04A 1LOVA 3KKGA 3EN8A 3UNLA 2JQ5A 1RGCA 3PXMA 3ECFA 1QVG2 1LOXA 1TP6A 4HM8B 1B20A 4R1KA 3NQYA 3X42A 3OWYA 3F7SA 1NNVA 1JNQA 3PZWA 1GSPA 1BNEA 2AAEA 2FXTA 1W7CA 4OK0A 1GOYA 3BNEA 1E97A 3S67A 2K0MA 2OWPA 2XEPA 4XB5A 3ER7A 1GD4A 1G02A 3FCSB 1CYUA 3FLJA 3BIRA 3FZWA 1CH0A 1F8NA 1OH0A 2R41A 1ZS7A 3NBRA 2CH9A 1UUVB 1RGHA 1FUTA 1K28A 1KWIA 3ZG0A 5D82A 1Q814 2P0XA 5IENA 2UGIA 3LH4A 2OTL3 3CXC2 2XRXB 4XBTA 5EVHA 3NM7A 1HZ1A 1IT7A 1TFOA 3URPA 3NHXA 3FG1A 1G96A 3CCM3 2CW9A 3FG3A 1O7HB 2XF3A 3FSDA 1TIJA 3LOYA 3B8LA 5AI1A 5IERA 1GY6A 2MF7A 3G0KA 1MNLA 3A76A 3BLZA 1GYBA 6GSPA 1VQ53 1BUQA 1AR0A 3U97A 4CDLA 3UB1A 3K7CA 1A90A 4RNZA 2IMJA 1O7GB 2FGTA 4FMCA 5DREA 1FUSA 2Z76A 4KFFA 5AYSC 2XGLA 3D4AA 4AEQA 3X41A 3T8NA 4HM5B 3N54B 3BNCA 3CCJ3 3H3HA 1C7HA 1MWSA 4O8SA 3HK4A 1ASKA 2WGQA 3KSED 9RNTA 1I2FA 3SXXA 3T8UA 2CG0A 3PGBA 3B7CA 1RN4A 3EN1B 3O8YA 2YX9A 3DMCA 2GSPA 1Q824 3EBTA 3EB8A 4MMZB 1A2KA 3OWUA 1RGFA 2BT3A 4N6LA 3JUQA 1RGAA 2XFTA 4BTXA 2ML6A 4OUQA 3M8CA 3RNTA 1VQ63 1I2GA 1RKYA 2H0IA 1N5PA 1QAKA 3B4PA 3D3LA 2C4BA 1B3SA 3X3YA 3F8HA 4DKIA 1JZOA 1W2ZA 3PCSA 3HIGA 4TX4A 1IV7A 2CX1A 3DY5A 4R9LA 3U1WA 1AVKA 1UGHI 3KSPA 3JVCA 3F40A 1CQSA 3GSPA 1VQN3 3KFQC 4WHAA 1FGTA 1BIRA 1JRQA 1PFPA 3K5TA 4U13A 5AIHA 3S28A 2KCDA 3CCU3 3KCHA 4IPBA 1VQ93 5FW5A 3ZFZA 1K8A4 1U5OA 2P09A 2RCDA 3IJEB 3SVAA 1FYSA 1PU4A 2HMOB 1IYYA 3CC73 1BRNL 3CD63 2SARA 2SBLA 1MGRA 3MG3A 4LMIA 3FKAA 1KSIA 4WYKA 1OGZA 1EUIC 2F98A 3JUPA 4HM7B 4GL6A 4WYKB 3CCR3 4CJNA 8CHOA 1LQGC 4K1UA 5D81A 1JBRA 1DETA 4R80A 3GWRA 2F99A 1IK3A 3ZG5A 4BTYA 1LOYA 5CF1A 3BNBA 4RZMA 2GU3A 4BTWA 3SOYA 1GOUA 1ROVA 2CWVA 3WOFB 1BRJA 4HYZA 1D6ZA 4MEIA 1VQL3 5KP4A 1VQ43 3AHSA 5CF2A 4HAAA 2GEYA 2AADA 1YGEA 4KT3B 1IQ8A 2ZHXB 8RNTA 1IU7A 4NHFA 3SYUA 2MC8A 3ALAA 4XDWA 3PS8A 2XR8B 3A5EA 3UL6A 3WDGB 1WTHA 1N9EA 2IY2A 3D9RA 1VQP3 1RGGA 2H0GA 1RMSA 1BOXA 1QVF2 4K90B 2R4IA 1MWTA 3H51A 4PEJA 1GS3A 5G1KA 2KF4A 2KRTA 4STDA 5RNTA 1RCKA 1YVBI 1M1XB 1D6UA 2K54A 3CCL3 1HKXA 3N9HA 5IW9A 2A15A 5IG5A 2W0QA 3BB9A 4HZ9B 4EC6A 3PYJA 3CC43 1FGQA 3EX9A 1I70A 2QA43 1VQQA 2C11A 4CPKA 3NM2A 6STDA 1WMPA 1W01A 2IUJA 3UJMA 1OUNA 2L4VA 3HIIA 2BMRB 1MWRA 1QAFA 2OQEA 2F4YA 5EEOA 4O02B 1RNBA 2HMLB 5M18A 1BSAA 1US1A 3QK9A 4FCMA 4LEHA 1I0XA 3HZPA 1N8QA 5IG0A 2GBWB 3E99A 4NREA 1I0VA 1R4CA 4O3VA 2W03A 1KC84 2RGQA 1T5YA 4RNTA 1C54A 2XSHB 2XH9A 1Z1SA 3DXOA 3Q1CA 4L8OA 4LSOA 3MG1A 4AKZA 1X1XA 3SX1A 5AIGA 3JUOA 1Q864 1JN5A 2OOVA 3WOEB 3CCE3 2W2CA 4GSPA 2CHCA 2F5MA 1HYFA 2ZDJA 4FMBA 4HM0B 1G0TA 4N6NB 1UCJA 4FMDA 5G2GA 4N6MA 3LYGA 4GHOA 5BVBA 1RHLA 3UL5A 1YIJ3 2HMNB 4H61A 3D5IA 4MMYB 1T2IA 1UW1A 1ZGXA 1FUWA 5AIIA 1W5ZA 1SIIA 1FW7A 2B24B 2YFIB 4L7KA 5AEUB 7GSPA 3OW22 1JV2B 2Z7AA 2CFLA 3FF2A 4BL2A 4N3VA 1YJW3 1YHQ3 1BRIA 1OPYA 1OF5B 1STFI 1NO3A 2BIRA 1TFKA 6RNTA 3EE1A 2CFKA 3NQZA 3G713 1B2MA 4XM4A 4EV2A 1S5AA 2YFJB 1MOLA 3LTDA 1PY3A 4EBGA 2L1SA 1BNIA 2QIYA 5JPUA 3LTCA 1RGLA 1DVCA 5ELJA 2W56A 5AYRB 1B21A 2WOHA 3S27A 3VGNA 1BNFA 2KF6A 1DE3A 2RNTA 3GZYB 2CFDA 1SIHA 1S723 2C10A 1B2XA 3AMOB 1I2EA 5CLKA 1N9JA 4ILFA 4WP5A 1BGSA 3AMOA 3G6E3 3I0YA 4HM3B 5JBSA 1OHOA 1X1UA 2CIUA 2IYJA 3ROBA 1A67A 2OOVC 3WA3A 4KFEA 1Q42A 3AGNA 2H0HA 2E2VA 3K9MC 3NV0B 1STDA 1OCVA 2W56B 3JUMA 1TJDA 3CNMA 5D83A 1X1YA 2STDA 2Z77A 3STDA 1O7PB 1YJ93 4J8TA 1OHPA 3WMDA 1ZO2A 1ZX2A 3OXAA 1IVUA 3NXJA 1RN7A 1U8CB 1RRHA 1O7WB 4I4KA 1VQM3 3MHEA 4RNYA 4HOHA 1RTUA 2I9WA 1SQWA 2P05A 2GBXB 1N5HA 4CCVA 2OQEC 3T0UA 1KQS2 2WO0A 2Z6BA 1LNHA 4OVMA 5LC6A 5IG3A 1JB4A 1LNIA 1BSCA 2W6JH 3BNDA 4KVHA 3X40A 2O3OA 1I3FA 3DUKA 4XBXA 1EQKA 1Y4KA 3HOHA 1GY7A 3HX8A 4H3UA 5DRVA 3EF8A 1M1K4 1TRQA 4BL3A 1RJOA 4HBRA 1UI7A 1WQLB 3KZTA 3CPOA 3LT8A 4FMAA 1BNSA 2Q07A 3HI7A 3NBJA 3LXUX 1EEJA 2HMMB 1YI23 2BO9B 1W4NA 2E2UA 4HM6B 2BMOB 3WODG 1VQK3 1UCIA 1W2B2 5HOHA 3OV4A 2YFLB 2F56A 2XGNA 5LC7A 2UUGC 2P0MA 3G8ZA 5BIRA 4N6V0 4LGQA 5AIFA 3LTAA 3CC23 3CME3 3V92A 1JB5A 3WR2A 1DVDA 3K0ZA 1OHSA 4J5KA 2PZVA 3WA2X 1R4YA 3CPW2 4WFOA 2KF5A 2W9QA 4G1MB 2GU1A 4R9KA 1FGRA 1UCKA 2RBIA 1IQXA 2CFGA 3DM8A 2QGUA 1TTOA 3OWSA 2QEX3 1T3BA 1V57A 2IUKA 1TUHA 1JKGA 4NPBA 1UI8A 1EKMA 1JKGB 1FGMA 1GY5A 3FG4A 4Q53A 5JPPA 3CCQ3 4JRFA 1BNGA 3DGOA 3NUVA 3GRDA 2KAAA 1W00A 5STDA 1L5GB 3Q3FA 4I5QA 1YIT3 3LZAA 5IG4A 1TU5A 2K3DA 3RGRA 1M904 1NB3I 5KP1A 2V1LA 4HVNA 3EC9A 1IV9A 1BRHA 2IA7A 1CEWI 1B2ZA 1X1WA 2HMKB 3EBYA 1BSEA 4EXRA 5BXQA 3PCRA 1KD14 3DGYA 2Y74A 1QALA 3DGMA 4N6OB 5ELUA 1IT8A 3D79A 3MSOA 1GMQA 4R4KA 1RDSA 4L8PA 1QMAA 3CCS3 1WMOA 3RGAA 1UDII 3FGYA 2RSXA 4WWUC 3AGOA 4FR9A 3G4S3 3IPTA 4ORLA 1BSBA 3EHCA 2D1WA 5A0OB 3EQQB 3IMAB 1FA3A 2LQVA 1RCLA 2RFRA 4XBYA 5I97A 1GMPA 3MWZA 3CCV3 2CK3H 5M1AA 3GZXB 5AEWB 5KP3A 1RSNA 7STDA 3V99A 5IEPA 1N8R4 1GD3A 1IVXA 1MGWA 1V58A 4BU4A 1FGOA 3GAXA 1JJ22 1JZDA 3QRDA 1QJGA 3CMA3 3MPHA 2FNQA 1D6YA 5G1LA 5TGNA 3TDGA 4ZM8A 3LTBA 4X2OA 1PYLA 2CWUA 4BIRA 2E2TA 2F5WA 4EV5A 2B1XB 4MMXB 1NWWA 1BVIA 1OGXA 3NX0A 2GXFA 4HM4B 4J5GA 4O2HA 1Q7Y4 1JBTA 1J2BA 1ISKA 1Q7HA 1BNRA 3S5CA 1W6YA 1B2UA 2ZA4A 1EA2A 1AV4A 2WGOA 3JUNA 1ULIB 1YJN3 1EG9B 3I553 1GMRA 1UUWB 1Q40B 2CKFB 1NB5I 2P38A 4LZIA 3J7Yd 1NU3A 3S29A 4EYCA 3SLUA 1DMMA 1BSDA 1WMNA 1YGWA 1OF5A 2CC3A 2UX0A 4FCZA 4LYLB 1UUGB 3I563 1BRSA 1T2HA 3F14A 4GB5A 1W6GA 2F86B 4MJDA 1LRAA 3G16A 2HOHA 5IF6A 2ML5A 3FH1A 2BNGA 2O9UX 1BNJA 1SPUA 3NBBA 4HKVB 3F8XA 1BRKA 2J8XB 3VF1A 3B4OA 2JDIH 2PNCA 1IVVA
chains in the Genus database with same CATH topology
5HGRA 1VQ83 3OX9A 2OCTA 1DYUA 4JF8A 3RDEA 2XSOB 3X3ZA 5FGOA 3EJVA 1Q40A 3DGNA 1SJWA 1AVLA 4K1VA 3F9SA 3MG2A 3GZRA 3N8BA 1IQYA 4QWTA 3V98A 1W02A 3MYTA 1OACA 5CXOA 2BHMA 1JN5B 4J9AA 2HMJB 4HM1B 2W9PA 1ULJB 3F7XA 4HM2B 3Q2PA 4KZ1A 2BMQB 4N6TA 1JB2A 3LMLA 3NV0A 2ZL8A 3X3XA 1DMNA 2M7OA 1IDPA 2D42A 2INXA 4IIAA 1WNHA 1NDOB 3DZLA 4RBNA 1VQO3 1DMQA 4KFDA 5EQLA 2CFWA 3CU3A 3VSYA 3GZBA 3KE7A 1O7NB 1W6CA 5IEOA 1VQ73 1M9GA 1HU9A 2GEXA 4FCJA 3SOAA 3DGLA 1V74A 1K41A 1E3VA 1CYVA 1LVNA 1K9M4 2OTJ3 1ROAA 1E3RA 3CNXA 4X2HA 3KN4A 1O7MB 3Q90A 4HZBB 3L0RA 2WOFA 4AKYA 2CWTA 2CG1A 4K61A 1NJI4 4HJLB 1VZZA 4N6UA 1RRLA 3LT9A 1IVWA 3SEDA 3MKIA 2XFSA 4XDVA 4IT7A 1A2VA 1LXEA 2KXGA 3K63A 3FF0A 2LYXA 3KIIA 2Y73A 1K734 5CK6A 2W04A 3KKGA 3EN8A 3UNLA 2JQ5A 3PXMA 3ECFA 1QVG2 1LOXA 1TP6A 4HM8B 4R1KA 3NQYA 3X42A 3OWYA 3F7SA 3PZWA 1JNQA 2FXTA 1W7CA 4OK0A 3BNEA 3S67A 1E97A 2K0MA 2OWPA 2XEPA 4XB5A 3ER7A 1GD4A 3FCSB 1CYUA 3FLJA 3FZWA 1F8NA 1OH0A 3NBRA 2CH9A 1UUVB 1KWIA 1K28A 5D82A 1Q814 2P0XA 5IENA 2OTL3 3LH4A 3CXC2 2XRXB 4XBTA 5EVHA 3NM7A 1IT7A 1TFOA 3NHXA 3FG1A 1G96A 3CCM3 2CW9A 3FG3A 1O7HB 2XF3A 3FSDA 1TIJA 3LOYA 3B8LA 5AI1A 5IERA 1GY6A 2MF7A 3G0KA 1MNLA 3A76A 3BLZA 1GYBA 1BUQA 1VQ53 1AR0A 3U97A 4CDLA 3UB1A 3K7CA 1A90A 4RNZA 2IMJA 1O7GB 2FGTA 4FMCA 5DREA 2Z76A 4KFFA 5AYSC 2XGLA 4AEQA 3X41A 3T8NA 4HM5B 3N54B 3BNCA 3CCJ3 3H3HA 1C7HA 4O8SA 3HK4A 1ASKA 2WGQA 3KSED 3SXXA 3T8UA 2CG0A 3PGBA 3B7CA 3EN1B 3O8YA 2YX9A 3DMCA 1Q824 3EBTA 3EB8A 4MMZB 1A2KA 3OWUA 2BT3A 4N6LA 3JUQA 2XFTA 4BTXA 2ML6A 4OUQA 3M8CA 1VQ63 1RKYA 1N5PA 1QAKA 3B4PA 3D3LA 3X3YA 3F8HA 1W2ZA 3PCSA 3HIGA 4TX4A 1IV7A 4R9LA 3DY5A 3U1WA 1AVKA 3KSPA 3JVCA 3F40A 1CQSA 1VQN3 3KFQC 4WHAA 1FGTA 3K5TA 1JRQA 1PFPA 3S28A 4U13A 5AIHA 3CCU3 2KCDA 1VQ93 4IPBA 5FW5A 1K8A4 1U5OA 2P09A 2RCDA 3IJEB 3SVAA 1PU4A 2HMOB 3CC73 3CD63 2SBLA 3MG3A 4LMIA 3FKAA 1KSIA 4WYKA 1OGZA 2F98A 3JUPA 4HM7B 4GL6A 4WYKB 3CCR3 8CHOA 4K1UA 5D81A 4R80A 3GWRA 2F99A 1IK3A 4BTYA 5CF1A 3BNBA 4RZMA 2GU3A 4BTWA 3SOYA 1ROVA 2CWVA 3WOFB 4HYZA 1D6ZA 4MEIA 1VQL3 5KP4A 1VQ43 5CF2A 2GEYA 1YGEA 1IQ8A 1IU7A 4NHFA 2MC8A 3ALAA 4XDWA 3PS8A 2XR8B 3UL6A 3WDGB 1WTHA 1N9EA 3D9RA 1VQP3 1QVF2 4K90B 2R4IA 4PEJA 3H51A 1GS3A 2KRTA 4STDA 1YVBI 1M1XB 1D6UA 2K54A 3CCL3 1HKXA 3N9HA 5IW9A 2A15A 5IG5A 2W0QA 3BB9A 4HZ9B 4EC6A 3PYJA 3CC43 1FGQA 3EX9A 2QA43 2C11A 3NM2A 6STDA 1WMPA 1W01A 2IUJA 3UJMA 1OUNA 2L4VA 3HIIA 2BMRB 1QAFA 2OQEA 5EEOA 4O02B 2HMLB 1US1A 3QK9A 4FCMA 4LEHA 3HZPA 1N8QA 5IG0A 2GBWB 3E99A 4NREA 1R4CA 4O3VA 2W03A 1KC84 2RGQA 1T5YA 2XSHB 2XH9A 1Z1SA 3DXOA 3Q1CA 4L8OA 4LSOA 3MG1A 4AKZA 3SX1A 5AIGA 3JUOA 1Q864 1JN5A 2OOVA 3WOEB 3CCE3 2W2CA 2CHCA 2ZDJA 4FMBA 4HM0B 4N6NB 4FMDA 5G2GA 4N6MA 3LYGA 5BVBA 3UL5A 1YIJ3 2HMNB 4H61A 4MMYB 1UW1A 1FUWA 5AIIA 1W5ZA 1SIIA 2B24B 2YFIB 4L7KA 5AEUB 1YHQ3 3OW22 1JV2B 2Z7AA 2CFLA 3FF2A 4N3VA 1YJW3 1OPYA 1OF5B 1STFI 1NO3A 1TFKA 3EE1A 2CFKA 3NQZA 3G713 4XM4A 4EV2A 1S5AA 2YFJB 1MOLA 3LTDA 4EBGA 2QIYA 5JPUA 3LTCA 1DVCA 5ELJA 2W56A 5AYRB 2WOHA 3S27A 3VGNA 3GZYB 2CFDA 1SIHA 1S723 2C10A 3AMOB 5CLKA 1N9JA 4WP5A 3AMOA 3G6E3 3I0YA 4HM3B 5JBSA 1OHOA 2CIUA 3ROBA 1A67A 2OOVC 3WA3A 4KFEA 1Q42A 2E2VA 3K9MC 3NV0B 1STDA 1OCVA 2W56B 3JUMA 3CNMA 5D83A 2STDA 2Z77A 3STDA 1O7PB 1YJ93 4J8TA 1OHPA 3WMDA 1ZO2A 1ZX2A 3OXAA 1IVUA 3NXJA 1RN7A 1U8CB 1RRHA 1O7WB 4I4KA 1VQM3 3MHEA 4RNYA 2I9WA 1SQWA 2P05A 2GBXB 1N5HA 4CCVA 2OQEC 3T0UA 1KQS2 2WO0A 2Z6BA 1LNHA 4OVMA 5LC6A 5IG3A 1JB4A 2W6JH 3BNDA 4KVHA 3X40A 2O3OA 3DUKA 4XBXA 1EQKA 1Y4KA 1GY7A 3HX8A 4H3UA 5DRVA 3EF8A 1M1K4 1RJOA 4HBRA 1UI7A 1WQLB 3KZTA 3CPOA 3LT8A 4FMAA 2Q07A 3HI7A 3NBJA 3LXUX 2HMMB 1YI23 2BO9B 1W4NA 2E2UA 4HM6B 2BMOB 3WODG 1VQK3 1W2B2 3OV4A 2YFLB 5LC7A 2XGNA 2P0MA 3G8ZA 4N6V0 4LGQA 5AIFA 3LTAA 3CC23 3CME3 3V92A 1JB5A 1DVDA 3K0ZA 1OHSA 2PZVA 3WA2X 3CPW2 4WFOA 2W9QA 4G1MB 2GU1A 4R9KA 1FGRA 1IQXA 2CFGA 3DM8A 2QGUA 3OWSA 2QEX3 2IUKA 1TUHA 1JKGA 1UI8A 1EKMA 1JKGB 1FGMA 1GY5A 3FG4A 4Q53A 5JPPA 3CCQ3 4JRFA 3DGOA 3NUVA 3GRDA 1W00A 5STDA 1L5GB 1YIT3 3LZAA 5IG4A 1TU5A 3RGRA 1M904 1NB3I 5KP1A 2V1LA 4HVNA 3EC9A 1IV9A 2IA7A 1CEWI 4EXRA 3EBYA 2HMKB 5BXQA 1KD14 3PCRA 2Y74A 1QALA 3DGMA 4N6OB 5ELUA 1IT8A 3MSOA 4R4KA 4L8PA 1QMAA 3CCS3 1WMOA 3RGAA 3FGYA 2RSXA 4WWUC 4FR9A 3G4S3 3IPTA 4ORLA 3EHCA 2D1WA 5A0OB 3EQQB 3IMAB 1FA3A 2LQVA 2RFRA 4XBYA 5I97A 3MWZA 3CCV3 2CK3H 3GZXB 5AEWB 5KP3A 7STDA 5IEPA 3V99A 1N8R4 1GD3A 1IVXA 1FGOA 3GAXA 1JJ22 3QRDA 1QJGA 3CMA3 3MPHA 2FNQA 1D6YA 5TGNA 3TDGA 4ZM8A 3LTBA 4X2OA 2CWUA 2E2TA 4EV5A 2B1XB 4MMXB 1NWWA 1OGXA 3NX0A 2GXFA 4HM4B 1Q7Y4 4O2HA 1J2BA 1ISKA 3S5CA 1W6YA 1EA2A 1AV4A 2WGOA 3JUNA 1ULIB 1YJN3 1EG9B 3I553 1UUWB 1Q40B 2CKFB 1NB5I 2P38A 4LZIA 3J7Yd 1NU3A 3S29A 4EYCA 3SLUA 1DMMA 1WMNA 4FCZA 1OF5A 2CC3A 2UX0A 3I563 3F14A 4GB5A 1W6GA 2F86B 4MJDA 3G16A 5IF6A 2ML5A 3FH1A 2BNGA 2O9UX 1SPUA 3NBBA 4HKVB 3F8XA 3VF1A 3B4OA 2JDIH 2PNCA 1IVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH4 A;  4CCV A;  1N9J A;  3KSE D;  5LC7 A;  1R4C A;  1YVB I;  2OCT A;  3KFQ C;  5A0O B;  3IMA B;  4N6V 0;  1M9G A;  3PXM A;  5LC6 A;  1STF I;  1FA3 A;  1NB3 I;  1PFP A;  1A67 A;  1G96 A;  1CYV A;  3MWZ A;  1DVD A;  1EQK A;  1TIJ A;  1IV9 A;  3K9M C;  1ROA A;  1CEW I;  1NB5 I;  1GD3 A;  1MOL A;  3SVA A;  4LZI A;  1MNL A;  4N6L A;  2W9Q A;  3PYJ A;  3GAX A;  3L0R A;  3S67 A;  4EYC A;  4N6O B;  5ELU A;  3QRD A;  3PS8 A;  1DVC A;  5ELJ A;  2W9P A;  3UL6 A;  4ZM8 A;  4N6U A;  1N5P A;  1GD4 A;  3Q2P A;  4N6T A;  4N6N B;  1CYU A;  1A90 A;  4N6M A;  3UL5 A;  1RN7 A;  4IT7 A;  2BO9 B;  4TX4 A;  1IV7 A;  1LXE A;  2KXG A;  2CH9 A;  1WNH A;  2O9U X;  1KWI A;  1FUW A;  3NX0 A;  5EQL A;  1N5H A; 
#chains in the Genus database with same CATH topology
 5GSP A;  5HGR A;  1VQ8 3;  1GOV A;  3OX9 A;  2OCT A;  1RGE A;  1UCL A;  1DYU A;  4JF8 A;  3RDE A;  2XSO B;  3X3Z A;  5FGO A;  3EJV A;  1JBS A;  1Q40 A;  3DGN A;  1SJW A;  1AVL A;  3WHO A;  4K1V A;  3F9S A;  1YNV X;  3MG2 A;  1BUJ A;  3GZR A;  5BU4 A;  3N8B A;  1IQY A;  4QWT A;  3V98 A;  1W02 A;  3BU4 A;  3MYT A;  1OAC A;  1B27 A;  1A2P A;  2BHM A;  5CXO A;  2KF3 A;  1JN5 B;  4J9A A;  2HMJ B;  4HM1 B;  7RNT A;  2W9P A;  1I8V A;  1ULJ B;  1YVS A;  3F7X A;  3Q2P A;  4HM2 B;  2BMQ B;  4KZ1 A;  4N6T A;  1BAO A;  1BU4 A;  1JB2 A;  3LML A;  3NV0 A;  2ZL8 A;  3X3X A;  1DMN A;  2M7O A;  1IDP A;  2D42 A;  2INX A;  4IIA A;  1WNH A;  1NDO B;  3DZL A;  4RBN A;  1VQO 3;  1DMQ A;  1BRG A;  4KFD A;  5EQL A;  1LOW A;  1Q9E A;  2CFW A;  3CU3 A;  3VSY A;  5M19 A;  1RGK A;  3GZB A;  3KE7 A;  1O7N B;  1W6C A;  1AQZ A;  5IEO A;  1VQ7 3;  1M9G A;  1HU9 A;  1B2S A;  2GEX A;  4FCJ A;  1V74 A;  3DGL A;  1K41 A;  3SOA A;  1E3V A;  1CYV A;  1LVN A;  1BAN A;  1K9M 4;  2OTJ 3;  3DH2 A;  1SAR A;  1ROA A;  1E3R A;  1RNT A;  2BU4 A;  3CNX A;  4X2H A;  3KN4 A;  1O7M B;  3Q90 A;  4HZB B;  1RLS A;  3L0R A;  2WOF A;  4AKY A;  2CWT A;  2CG1 A;  4EW5 A;  4K61 A;  1NJI 4;  4HJL B;  1MWU A;  1VZZ A;  4N6U A;  1RRL A;  3LT9 A;  1RN1 A;  1IVW A;  3SED A;  3MKI A;  2XFS A;  4XDV A;  2CX0 A;  3D5G A;  1TRP A;  1A2V A;  4IT7 A;  1LXE A;  2KXG A;  3K63 A;  3FF0 A;  1LQM B;  2LYX A;  1I3I A;  1FZU A;  1AY7 A;  3AHW A;  3KII A;  2Y73 A;  1K73 4;  1UGI A;  5CK6 A;  2W04 A;  1LOV A;  3KKG A;  3EN8 A;  3UNL A;  2JQ5 A;  1RGC A;  3PXM A;  3ECF A;  1QVG 2;  1LOX A;  1TP6 A;  4HM8 B;  1B20 A;  4R1K A;  3NQY A;  3X42 A;  3OWY A;  3F7S A;  1NNV A;  1JNQ A;  3PZW A;  1GSP A;  1BNE A;  2AAE A;  2FXT A;  1W7C A;  4OK0 A;  1GOY A;  3BNE A;  1E97 A;  3S67 A;  2K0M A;  2OWP A;  2XEP A;  4XB5 A;  3ER7 A;  1GD4 A;  1G02 A;  3FCS B;  1CYU A;  3FLJ A;  3BIR A;  3FZW A;  1CH0 A;  1F8N A;  1OH0 A;  2R41 A;  1ZS7 A;  3NBR A;  2CH9 A;  1UUV B;  1RGH A;  1FUT A;  1K28 A;  1KWI A;  3ZG0 A;  5D82 A;  1Q81 4;  2P0X A;  5IEN A;  2UGI A;  3LH4 A;  2OTL 3;  3CXC 2;  2XRX B;  4XBT A;  5EVH A;  3NM7 A;  1HZ1 A;  1IT7 A;  1TFO A;  3URP A;  3NHX A;  3FG1 A;  1G96 A;  3CCM 3;  2CW9 A;  3FG3 A;  1O7H B;  2XF3 A;  3FSD A;  1TIJ A;  3LOY A;  3B8L A;  5AI1 A;  5IER A;  1GY6 A;  2MF7 A;  3G0K A;  1MNL A;  3A76 A;  3BLZ A;  1GYB A;  6GSP A;  1VQ5 3;  1BUQ A;  1AR0 A;  3U97 A;  4CDL A;  3UB1 A;  3K7C A;  1A90 A;  4RNZ A;  2IMJ A;  1O7G B;  2FGT A;  4FMC A;  5DRE A;  1FUS A;  2Z76 A;  4KFF A;  5AYS C;  2XGL A;  3D4A A;  4AEQ A;  3X41 A;  3T8N A;  4HM5 B;  3N54 B;  3BNC A;  3CCJ 3;  3H3H A;  1C7H A;  1MWS A;  4O8S A;  3HK4 A;  1ASK A;  2WGQ A;  3KSE D;  9RNT A;  1I2F A;  3SXX A;  3T8U A;  2CG0 A;  3PGB A;  3B7C A;  1RN4 A;  3EN1 B;  3O8Y A;  2YX9 A;  3DMC A;  2GSP A;  1Q82 4;  3EBT A;  3EB8 A;  4MMZ B;  1A2K A;  3OWU A;  1RGF A;  2BT3 A;  4N6L A;  3JUQ A;  1RGA A;  2XFT A;  4BTX A;  2ML6 A;  4OUQ A;  3M8C A;  3RNT A;  1VQ6 3;  1I2G A;  1RKY A;  2H0I A;  1N5P A;  1QAK A;  3B4P A;  3D3L A;  2C4B A;  1B3S A;  3X3Y A;  3F8H A;  4DKI A;  1JZO A;  1W2Z A;  3PCS A;  3HIG A;  4TX4 A;  1IV7 A;  2CX1 A;  3DY5 A;  4R9L A;  3U1W A;  1AVK A;  1UGH I;  3KSP A;  3JVC A;  3F40 A;  1CQS A;  3GSP A;  1VQN 3;  3KFQ C;  4WHA A;  1FGT A;  1BIR A;  1JRQ A;  1PFP A;  3K5T A;  4U13 A;  5AIH A;  3S28 A;  2KCD A;  3CCU 3;  3KCH A;  4IPB A;  1VQ9 3;  5FW5 A;  3ZFZ A;  1K8A 4;  1U5O A;  2P09 A;  2RCD A;  3IJE B;  3SVA A;  1FYS A;  1PU4 A;  2HMO B;  1IYY A;  3CC7 3;  1BRN L;  3CD6 3;  2SAR A;  2SBL A;  1MGR A;  3MG3 A;  4LMI A;  3FKA A;  1KSI A;  4WYK A;  1OGZ A;  1EUI C;  2F98 A;  3JUP A;  4HM7 B;  4GL6 A;  4WYK B;  3CCR 3;  4CJN A;  8CHO A;  1LQG C;  4K1U A;  5D81 A;  1JBR A;  1DET A;  4R80 A;  3GWR A;  2F99 A;  1IK3 A;  3ZG5 A;  4BTY A;  1LOY A;  5CF1 A;  3BNB A;  4RZM A;  2GU3 A;  4BTW A;  3SOY A;  1GOU A;  1ROV A;  2CWV A;  3WOF B;  1BRJ A;  4HYZ A;  1D6Z A;  4MEI A;  1VQL 3;  5KP4 A;  1VQ4 3;  3AHS A;  5CF2 A;  4HAA A;  2GEY A;  2AAD A;  1YGE A;  4KT3 B;  1IQ8 A;  2ZHX B;  8RNT A;  1IU7 A;  4NHF A;  3SYU A;  2MC8 A;  3ALA A;  4XDW A;  3PS8 A;  2XR8 B;  3A5E A;  3UL6 A;  3WDG B;  1WTH A;  1N9E A;  2IY2 A;  3D9R A;  1VQP 3;  1RGG A;  2H0G A;  1RMS A;  1BOX A;  1QVF 2;  4K90 B;  2R4I A;  1MWT A;  3H51 A;  4PEJ A;  1GS3 A;  5G1K A;  2KF4 A;  2KRT A;  4STD A;  5RNT A;  1RCK A;  1YVB I;  1M1X B;  1D6U A;  2K54 A;  3CCL 3;  1HKX A;  3N9H A;  5IW9 A;  2A15 A;  5IG5 A;  2W0Q A;  3BB9 A;  4HZ9 B;  4EC6 A;  3PYJ A;  3CC4 3;  1FGQ A;  3EX9 A;  1I70 A;  2QA4 3;  1VQQ A;  2C11 A;  4CPK A;  3NM2 A;  6STD A;  1WMP A;  1W01 A;  2IUJ A;  3UJM A;  1OUN A;  2L4V A;  3HII A;  2BMR B;  1MWR A;  1QAF A;  2OQE A;  2F4Y A;  5EEO A;  4O02 B;  1RNB A;  2HML B;  5M18 A;  1BSA A;  1US1 A;  3QK9 A;  4FCM A;  4LEH A;  1I0X A;  3HZP A;  1N8Q A;  5IG0 A;  2GBW B;  3E99 A;  4NRE A;  1I0V A;  1R4C A;  4O3V A;  2W03 A;  1KC8 4;  2RGQ A;  1T5Y A;  4RNT A;  1C54 A;  2XSH B;  2XH9 A;  1Z1S A;  3DXO A;  3Q1C A;  4L8O A;  4LSO A;  3MG1 A;  4AKZ A;  1X1X A;  3SX1 A;  5AIG A;  3JUO A;  1Q86 4;  1JN5 A;  2OOV A;  3WOE B;  3CCE 3;  2W2C A;  4GSP A;  2CHC A;  2F5M A;  1HYF A;  2ZDJ A;  4FMB A;  4HM0 B;  1G0T A;  4N6N B;  1UCJ A;  4FMD A;  5G2G A;  4N6M A;  3LYG A;  4GHO A;  5BVB A;  1RHL A;  3UL5 A;  1YIJ 3;  2HMN B;  4H61 A;  3D5I A;  4MMY B;  1T2I A;  1UW1 A;  1ZGX A;  1FUW A;  5AII A;  1W5Z A;  1SII A;  1FW7 A;  2B24 B;  2YFI B;  4L7K A;  5AEU B;  7GSP A;  3OW2 2;  1JV2 B;  2Z7A A;  2CFL A;  3FF2 A;  4BL2 A;  4N3V A;  1YJW 3;  1YHQ 3;  1BRI A;  1OPY A;  1OF5 B;  1STF I;  1NO3 A;  2BIR A;  1TFK A;  6RNT A;  3EE1 A;  2CFK A;  3NQZ A;  3G71 3;  1B2M A;  4XM4 A;  4EV2 A;  1S5A A;  2YFJ B;  1MOL A;  3LTD A;  1PY3 A;  4EBG A;  2L1S A;  1BNI A;  2QIY A;  5JPU A;  3LTC A;  1RGL A;  1DVC A;  5ELJ A;  2W56 A;  5AYR B;  1B21 A;  2WOH A;  3S27 A;  3VGN A;  1BNF A;  2KF6 A;  1DE3 A;  2RNT A;  3GZY B;  2CFD A;  1SIH A;  1S72 3;  2C10 A;  1B2X A;  3AMO B;  1I2E A;  5CLK A;  1N9J A;  4ILF A;  4WP5 A;  1BGS A;  3AMO A;  3G6E 3;  3I0Y A;  4HM3 B;  5JBS A;  1OHO A;  1X1U A;  2CIU A;  2IYJ A;  3ROB A;  1A67 A;  2OOV C;  3WA3 A;  4KFE A;  1Q42 A;  3AGN A;  2H0H A;  2E2V A;  3K9M C;  3NV0 B;  1STD A;  1OCV A;  2W56 B;  3JUM A;  1TJD A;  3CNM A;  5D83 A;  1X1Y A;  2STD A;  2Z77 A;  3STD A;  1O7P B;  1YJ9 3;  4J8T A;  1OHP A;  3WMD A;  1ZO2 A;  1ZX2 A;  3OXA A;  1IVU A;  3NXJ A;  1RN7 A;  1U8C B;  1RRH A;  1O7W B;  4I4K A;  1VQM 3;  3MHE A;  4RNY A;  4HOH A;  1RTU A;  2I9W A;  1SQW A;  2P05 A;  2GBX B;  1N5H A;  4CCV A;  2OQE C;  3T0U A;  1KQS 2;  2WO0 A;  2Z6B A;  1LNH A;  4OVM A;  5LC6 A;  5IG3 A;  1JB4 A;  1LNI A;  1BSC A;  2W6J H;  3BND A;  4KVH A;  3X40 A;  2O3O A;  1I3F A;  3DUK A;  4XBX A;  1EQK A;  1Y4K A;  3HOH A;  1GY7 A;  3HX8 A;  4H3U A;  5DRV A;  3EF8 A;  1M1K 4;  1TRQ A;  4BL3 A;  1RJO A;  4HBR A;  1UI7 A;  1WQL B;  3KZT A;  3CPO A;  3LT8 A;  4FMA A;  1BNS A;  2Q07 A;  3HI7 A;  3NBJ A;  3LXU X;  1EEJ A;  2HMM B;  1YI2 3;  2BO9 B;  1W4N A;  2E2U A;  4HM6 B;  2BMO B;  3WOD G;  1VQK 3;  1UCI A;  1W2B 2;  5HOH A;  3OV4 A;  2YFL B;  2F56 A;  2XGN A;  5LC7 A;  2UUG C;  2P0M A;  3G8Z A;  5BIR A;  4N6V 0;  4LGQ A;  5AIF A;  3LTA A;  3CC2 3;  3CME 3;  3V92 A;  1JB5 A;  3WR2 A;  1DVD A;  3K0Z A;  1OHS A;  4J5K A;  2PZV A;  3WA2 X;  1R4Y A;  3CPW 2;  4WFO A;  2KF5 A;  2W9Q A;  4G1M B;  2GU1 A;  4R9K A;  1FGR A;  1UCK A;  2RBI A;  1IQX A;  2CFG A;  3DM8 A;  2QGU A;  1TTO A;  3OWS A;  2QEX 3;  1T3B A;  1V57 A;  2IUK A;  1TUH A;  1JKG A;  4NPB A;  1UI8 A;  1EKM A;  1JKG B;  1FGM A;  1GY5 A;  3FG4 A;  4Q53 A;  5JPP A;  3CCQ 3;  4JRF A;  1BNG A;  3DGO A;  3NUV A;  3GRD A;  2KAA A;  1W00 A;  5STD A;  1L5G B;  3Q3F A;  4I5Q A;  1YIT 3;  3LZA A;  5IG4 A;  1TU5 A;  2K3D A;  3RGR A;  1M90 4;  1NB3 I;  5KP1 A;  2V1L A;  4HVN A;  3EC9 A;  1IV9 A;  1BRH A;  2IA7 A;  1CEW I;  1B2Z A;  1X1W A;  2HMK B;  3EBY A;  1BSE A;  4EXR A;  5BXQ A;  3PCR A;  1KD1 4;  3DGY A;  2Y74 A;  1QAL A;  3DGM A;  4N6O B;  5ELU A;  1IT8 A;  3D79 A;  3MSO A;  1GMQ A;  4R4K A;  1RDS A;  4L8P A;  1QMA A;  3CCS 3;  1WMO A;  3RGA A;  1UDI I;  3FGY A;  2RSX A;  4WWU C;  3AGO A;  4FR9 A;  3G4S 3;  3IPT A;  4ORL A;  1BSB A;  3EHC A;  2D1W A;  5A0O B;  3EQQ B;  3IMA B;  1FA3 A;  2LQV A;  1RCL A;  2RFR A;  4XBY A;  5I97 A;  1GMP A;  3MWZ A;  3CCV 3;  2CK3 H;  5M1A A;  3GZX B;  5AEW B;  5KP3 A;  1RSN A;  7STD A;  3V99 A;  5IEP A;  1N8R 4;  1GD3 A;  1IVX A;  1MGW A;  1V58 A;  4BU4 A;  1FGO A;  3GAX A;  1JJ2 2;  1JZD A;  3QRD A;  1QJG A;  3CMA 3;  3MPH A;  2FNQ A;  1D6Y A;  5G1L A;  5TGN A;  3TDG A;  4ZM8 A;  3LTB A;  4X2O A;  1PYL A;  2CWU A;  4BIR A;  2E2T A;  2F5W A;  4EV5 A;  2B1X B;  4MMX B;  1NWW A;  1BVI A;  1OGX A;  3NX0 A;  2GXF A;  4HM4 B;  4J5G A;  4O2H A;  1Q7Y 4;  1JBT A;  1J2B A;  1ISK A;  1Q7H A;  1BNR A;  3S5C A;  1W6Y A;  1B2U A;  2ZA4 A;  1EA2 A;  1AV4 A;  2WGO A;  3JUN A;  1ULI B;  1YJN 3;  1EG9 B;  3I55 3;  1GMR A;  1UUW B;  1Q40 B;  2CKF B;  1NB5 I;  2P38 A;  4LZI A;  3J7Y d;  1NU3 A;  3S29 A;  4EYC A;  3SLU A;  1DMM A;  1BSD A;  1WMN A;  1YGW A;  1OF5 A;  2CC3 A;  2UX0 A;  4FCZ A;  4LYL B;  1UUG B;  3I56 3;  1BRS A;  1T2H A;  3F14 A;  4GB5 A;  1W6G A;  2F86 B;  4MJD A;  1LRA A;  3G16 A;  2HOH A;  5IF6 A;  2ML5 A;  3FH1 A;  2BNG A;  2O9U X;  1BNJ A;  1SPU A;  3NBB A;  4HKV B;  3F8X A;  1BRK A;  2J8X B;  3VF1 A;  3B4O A;  2JDI H;  2PNC A;  1IVV A; 
#chains in the Genus database with same CATH homology
 5HGR A;  1VQ8 3;  3OX9 A;  2OCT A;  1DYU A;  4JF8 A;  3RDE A;  2XSO B;  3X3Z A;  5FGO A;  3EJV A;  1Q40 A;  3DGN A;  1SJW A;  1AVL A;  4K1V A;  3F9S A;  3MG2 A;  3GZR A;  3N8B A;  1IQY A;  4QWT A;  3V98 A;  1W02 A;  3MYT A;  1OAC A;  5CXO A;  2BHM A;  1JN5 B;  4J9A A;  2HMJ B;  4HM1 B;  2W9P A;  1ULJ B;  3F7X A;  4HM2 B;  3Q2P A;  4KZ1 A;  2BMQ B;  4N6T A;  1JB2 A;  3LML A;  3NV0 A;  2ZL8 A;  3X3X A;  1DMN A;  2M7O A;  1IDP A;  2D42 A;  2INX A;  4IIA A;  1WNH A;  1NDO B;  3DZL A;  4RBN A;  1VQO 3;  1DMQ A;  4KFD A;  5EQL A;  2CFW A;  3CU3 A;  3VSY A;  3GZB A;  3KE7 A;  1O7N B;  1W6C A;  5IEO A;  1VQ7 3;  1M9G A;  1HU9 A;  2GEX A;  4FCJ A;  3SOA A;  3DGL A;  1V74 A;  1K41 A;  1E3V A;  1CYV A;  1LVN A;  1K9M 4;  2OTJ 3;  1ROA A;  1E3R A;  3CNX A;  4X2H A;  3KN4 A;  1O7M B;  3Q90 A;  4HZB B;  3L0R A;  2WOF A;  4AKY A;  2CWT A;  2CG1 A;  4K61 A;  1NJI 4;  4HJL B;  1VZZ A;  4N6U A;  1RRL A;  3LT9 A;  1IVW A;  3SED A;  3MKI A;  2XFS A;  4XDV A;  4IT7 A;  1A2V A;  1LXE A;  2KXG A;  3K63 A;  3FF0 A;  2LYX A;  3KII A;  2Y73 A;  1K73 4;  5CK6 A;  2W04 A;  3KKG A;  3EN8 A;  3UNL A;  2JQ5 A;  3PXM A;  3ECF A;  1QVG 2;  1LOX A;  1TP6 A;  4HM8 B;  4R1K A;  3NQY A;  3X42 A;  3OWY A;  3F7S A;  3PZW A;  1JNQ A;  2FXT A;  1W7C A;  4OK0 A;  3BNE A;  3S67 A;  1E97 A;  2K0M A;  2OWP A;  2XEP A;  4XB5 A;  3ER7 A;  1GD4 A;  3FCS B;  1CYU A;  3FLJ A;  3FZW A;  1F8N A;  1OH0 A;  3NBR A;  2CH9 A;  1UUV B;  1KWI A;  1K28 A;  5D82 A;  1Q81 4;  2P0X A;  5IEN A;  2OTL 3;  3LH4 A;  3CXC 2;  2XRX B;  4XBT A;  5EVH A;  3NM7 A;  1IT7 A;  1TFO A;  3NHX A;  3FG1 A;  1G96 A;  3CCM 3;  2CW9 A;  3FG3 A;  1O7H B;  2XF3 A;  3FSD A;  1TIJ A;  3LOY A;  3B8L A;  5AI1 A;  5IER A;  1GY6 A;  2MF7 A;  3G0K A;  1MNL A;  3A76 A;  3BLZ A;  1GYB A;  1BUQ A;  1VQ5 3;  1AR0 A;  3U97 A;  4CDL A;  3UB1 A;  3K7C A;  1A90 A;  4RNZ A;  2IMJ A;  1O7G B;  2FGT A;  4FMC A;  5DRE A;  2Z76 A;  4KFF A;  5AYS C;  2XGL A;  4AEQ A;  3X41 A;  3T8N A;  4HM5 B;  3N54 B;  3BNC A;  3CCJ 3;  3H3H A;  1C7H A;  4O8S A;  3HK4 A;  1ASK A;  2WGQ A;  3KSE D;  3SXX A;  3T8U A;  2CG0 A;  3PGB A;  3B7C A;  3EN1 B;  3O8Y A;  2YX9 A;  3DMC A;  1Q82 4;  3EBT A;  3EB8 A;  4MMZ B;  1A2K A;  3OWU A;  2BT3 A;  4N6L A;  3JUQ A;  2XFT A;  4BTX A;  2ML6 A;  4OUQ A;  3M8C A;  1VQ6 3;  1RKY A;  1N5P A;  1QAK A;  3B4P A;  3D3L A;  3X3Y A;  3F8H A;  1W2Z A;  3PCS A;  3HIG A;  4TX4 A;  1IV7 A;  4R9L A;  3DY5 A;  3U1W A;  1AVK A;  3KSP A;  3JVC A;  3F40 A;  1CQS A;  1VQN 3;  3KFQ C;  4WHA A;  1FGT A;  3K5T A;  1JRQ A;  1PFP A;  3S28 A;  4U13 A;  5AIH A;  3CCU 3;  2KCD A;  1VQ9 3;  4IPB A;  5FW5 A;  1K8A 4;  1U5O A;  2P09 A;  2RCD A;  3IJE B;  3SVA A;  1PU4 A;  2HMO B;  3CC7 3;  3CD6 3;  2SBL A;  3MG3 A;  4LMI A;  3FKA A;  1KSI A;  4WYK A;  1OGZ A;  2F98 A;  3JUP A;  4HM7 B;  4GL6 A;  4WYK B;  3CCR 3;  8CHO A;  4K1U A;  5D81 A;  4R80 A;  3GWR A;  2F99 A;  1IK3 A;  4BTY A;  5CF1 A;  3BNB A;  4RZM A;  2GU3 A;  4BTW A;  3SOY A;  1ROV A;  2CWV A;  3WOF B;  4HYZ A;  1D6Z A;  4MEI A;  1VQL 3;  5KP4 A;  1VQ4 3;  5CF2 A;  2GEY A;  1YGE A;  1IQ8 A;  1IU7 A;  4NHF A;  2MC8 A;  3ALA A;  4XDW A;  3PS8 A;  2XR8 B;  3UL6 A;  3WDG B;  1WTH A;  1N9E A;  3D9R A;  1VQP 3;  1QVF 2;  4K90 B;  2R4I A;  4PEJ A;  3H51 A;  1GS3 A;  2KRT A;  4STD A;  1YVB I;  1M1X B;  1D6U A;  2K54 A;  3CCL 3;  1HKX A;  3N9H A;  5IW9 A;  2A15 A;  5IG5 A;  2W0Q A;  3BB9 A;  4HZ9 B;  4EC6 A;  3PYJ A;  3CC4 3;  1FGQ A;  3EX9 A;  2QA4 3;  2C11 A;  3NM2 A;  6STD A;  1WMP A;  1W01 A;  2IUJ A;  3UJM A;  1OUN A;  2L4V A;  3HII A;  2BMR B;  1QAF A;  2OQE A;  5EEO A;  4O02 B;  2HML B;  1US1 A;  3QK9 A;  4FCM A;  4LEH A;  3HZP A;  1N8Q A;  5IG0 A;  2GBW B;  3E99 A;  4NRE A;  1R4C A;  4O3V A;  2W03 A;  1KC8 4;  2RGQ A;  1T5Y A;  2XSH B;  2XH9 A;  1Z1S A;  3DXO A;  3Q1C A;  4L8O A;  4LSO A;  3MG1 A;  4AKZ A;  3SX1 A;  5AIG A;  3JUO A;  1Q86 4;  1JN5 A;  2OOV A;  3WOE B;  3CCE 3;  2W2C A;  2CHC A;  2ZDJ A;  4FMB A;  4HM0 B;  4N6N B;  4FMD A;  5G2G A;  4N6M A;  3LYG A;  5BVB A;  3UL5 A;  1YIJ 3;  2HMN B;  4H61 A;  4MMY B;  1UW1 A;  1FUW A;  5AII A;  1W5Z A;  1SII A;  2B24 B;  2YFI B;  4L7K A;  5AEU B;  1YHQ 3;  3OW2 2;  1JV2 B;  2Z7A A;  2CFL A;  3FF2 A;  4N3V A;  1YJW 3;  1OPY A;  1OF5 B;  1STF I;  1NO3 A;  1TFK A;  3EE1 A;  2CFK A;  3NQZ A;  3G71 3;  4XM4 A;  4EV2 A;  1S5A A;  2YFJ B;  1MOL A;  3LTD A;  4EBG A;  2QIY A;  5JPU A;  3LTC A;  1DVC A;  5ELJ A;  2W56 A;  5AYR B;  2WOH A;  3S27 A;  3VGN A;  3GZY B;  2CFD A;  1SIH A;  1S72 3;  2C10 A;  3AMO B;  5CLK A;  1N9J A;  4WP5 A;  3AMO A;  3G6E 3;  3I0Y A;  4HM3 B;  5JBS A;  1OHO A;  2CIU A;  3ROB A;  1A67 A;  2OOV C;  3WA3 A;  4KFE A;  1Q42 A;  2E2V A;  3K9M C;  3NV0 B;  1STD A;  1OCV A;  2W56 B;  3JUM A;  3CNM A;  5D83 A;  2STD A;  2Z77 A;  3STD A;  1O7P B;  1YJ9 3;  4J8T A;  1OHP A;  3WMD A;  1ZO2 A;  1ZX2 A;  3OXA A;  1IVU A;  3NXJ A;  1RN7 A;  1U8C B;  1RRH A;  1O7W B;  4I4K A;  1VQM 3;  3MHE A;  4RNY A;  2I9W A;  1SQW A;  2P05 A;  2GBX B;  1N5H A;  4CCV A;  2OQE C;  3T0U A;  1KQS 2;  2WO0 A;  2Z6B A;  1LNH A;  4OVM A;  5LC6 A;  5IG3 A;  1JB4 A;  2W6J H;  3BND A;  4KVH A;  3X40 A;  2O3O A;  3DUK A;  4XBX A;  1EQK A;  1Y4K A;  1GY7 A;  3HX8 A;  4H3U A;  5DRV A;  3EF8 A;  1M1K 4;  1RJO A;  4HBR A;  1UI7 A;  1WQL B;  3KZT A;  3CPO A;  3LT8 A;  4FMA A;  2Q07 A;  3HI7 A;  3NBJ A;  3LXU X;  2HMM B;  1YI2 3;  2BO9 B;  1W4N A;  2E2U A;  4HM6 B;  2BMO B;  3WOD G;  1VQK 3;  1W2B 2;  3OV4 A;  2YFL B;  5LC7 A;  2XGN A;  2P0M A;  3G8Z A;  4N6V 0;  4LGQ A;  5AIF A;  3LTA A;  3CC2 3;  3CME 3;  3V92 A;  1JB5 A;  1DVD A;  3K0Z A;  1OHS A;  2PZV A;  3WA2 X;  3CPW 2;  4WFO A;  2W9Q A;  4G1M B;  2GU1 A;  4R9K A;  1FGR A;  1IQX A;  2CFG A;  3DM8 A;  2QGU A;  3OWS A;  2QEX 3;  2IUK A;  1TUH A;  1JKG A;  1UI8 A;  1EKM A;  1JKG B;  1FGM A;  1GY5 A;  3FG4 A;  4Q53 A;  5JPP A;  3CCQ 3;  4JRF A;  3DGO A;  3NUV A;  3GRD A;  1W00 A;  5STD A;  1L5G B;  1YIT 3;  3LZA A;  5IG4 A;  1TU5 A;  3RGR A;  1M90 4;  1NB3 I;  5KP1 A;  2V1L A;  4HVN A;  3EC9 A;  1IV9 A;  2IA7 A;  1CEW I;  4EXR A;  3EBY A;  2HMK B;  5BXQ A;  1KD1 4;  3PCR A;  2Y74 A;  1QAL A;  3DGM A;  4N6O B;  5ELU A;  1IT8 A;  3MSO A;  4R4K A;  4L8P A;  1QMA A;  3CCS 3;  1WMO A;  3RGA A;  3FGY A;  2RSX A;  4WWU C;  4FR9 A;  3G4S 3;  3IPT A;  4ORL A;  3EHC A;  2D1W A;  5A0O B;  3EQQ B;  3IMA B;  1FA3 A;  2LQV A;  2RFR A;  4XBY A;  5I97 A;  3MWZ A;  3CCV 3;  2CK3 H;  3GZX B;  5AEW B;  5KP3 A;  7STD A;  5IEP A;  3V99 A;  1N8R 4;  1GD3 A;  1IVX A;  1FGO A;  3GAX A;  1JJ2 2;  3QRD A;  1QJG A;  3CMA 3;  3MPH A;  2FNQ A;  1D6Y A;  5TGN A;  3TDG A;  4ZM8 A;  3LTB A;  4X2O A;  2CWU A;  2E2T A;  4EV5 A;  2B1X B;  4MMX B;  1NWW A;  1OGX A;  3NX0 A;  2GXF A;  4HM4 B;  1Q7Y 4;  4O2H A;  1J2B A;  1ISK A;  3S5C A;  1W6Y A;  1EA2 A;  1AV4 A;  2WGO A;  3JUN A;  1ULI B;  1YJN 3;  1EG9 B;  3I55 3;  1UUW B;  1Q40 B;  2CKF B;  1NB5 I;  2P38 A;  4LZI A;  3J7Y d;  1NU3 A;  3S29 A;  4EYC A;  3SLU A;  1DMM A;  1WMN A;  4FCZ A;  1OF5 A;  2CC3 A;  2UX0 A;  3I56 3;  3F14 A;  4GB5 A;  1W6G A;  2F86 B;  4MJD A;  3G16 A;  5IF6 A;  2ML5 A;  3FH1 A;  2BNG A;  2O9U X;  1SPU A;  3NBB A;  4HKV B;  3F8X A;  3VF1 A;  3B4O A;  2JDI H;  2PNC A;  1IVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...