5ELUA

Isoform-specific inhibition of sumo-dependent protein-protein interactions
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
NENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVDLTRFPVTTMYYLTLEAKDGGKKKLYEAKVWVKGYLLEELKHNFKELQEFKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Signaling protein
molecule keywords SUMO-Affirmer-S2B3
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5eluA00
1FUWA 1N9JA 2BO9B 1IV7A 3Q2PA 3MWZA 1R4CA 1CYUA 1G96A 1CYVA 1CEWI 1N5HA 1TIJA 1DVCA 2O9UX 3PXMA 5LC7A 3KSED 4EYCA 1MNLA 4N6OB 3PS8A 1GD3A 3UL6A 1A90A 1DVDA 2W9QA 3KFQC 5EQLA 4N6UA 1KWIA 2W9PA 1STFI 4CCVA 1RN7A 4N6NB 1ROAA 1M9GA 1MOLA 1NB3I 1N5PA 3LH4A 1FA3A 2KXGA 5LC6A 1IV9A 2OCTA 3GAXA 2CH9A 1LXEA 3K9MC 3L0RA 1YVBI 4N6LA 3UL5A 5A0OB 1WNHA 5ELUA 4N6MA 4IT7A 4ZM8A 4N6V0 3NX0A 3IMAB 4N6TA 3PYJA 1EQKA 3SVAA 4LZIA 5ELJA 1GD4A 3S67A 4TX4A 1A67A 3QRDA 1PFPA 1NB5I
chains in the Genus database with same CATH superfamily
2WOFA 1IVVA 3BNEA 2LYXA 2P0XA 3OXAA 5I97A 2HMMB 3DXOA 3DGYA 1CEWI 2D1WA 3DUKA 4KFEA 1JN5A 4XM4A 2BU4A 1RRHA 1JNQA 1GMQA 1AV4A 1B3SA 2Y73A 1IU7A 1KWIA 3DZLA 4CDLA 4G1MB 1FYSA 3NQYA 3WA3A 1IV9A 4L8OA 1HYFA 1YI23 1GMPA 5CXOA 3BNCA 1G0TA 1IT8A 4J5KA 1MGWA 1PY3A 3E99A 3GZRA 1YJN3 3D9RA 1LVNA 1J2BA 1UCLA 1GOUA 3U1WA 3D79A 2OOVC 3AHSA 1AVKA 2XFTA 1LOYA 2JDIH 3X3YA 1GOVA 1GOYA 4O02B 4MMXB 1BNFA 2F56A 1PU4A 2CFKA 1CYVA 1B2SA 3NBJA 1BRJA 1RN4A 1SJWA 2GEXA 2HMLB 1BRHA 4HZ9B 3CPW2 1QJGA 2D42A 3RNTA 3GWRA 1T2IA 1NJI4 3RDEA 3CD63 1MWTA 1FGRA 1O7PB 2Z77A 3FCSB 3FG3A 5DRVA 3Q90A 2RSXA 4XBTA 5FW5A 4HM2B 3UB1A 1S5AA 3OWUA 1Q7Y4 1L5GB 1YJW3 5JPUA 4KZ1A 2L4VA 1Q814 1I3IA 4HZBB 3CCL3 1I8VA 1NNVA 3GRDA 1E97A 1N9EA 1OCVA 2F86B 4N6TA 4ZM8A 5BU4A 6STDA 2BMRB 3BNBA 3FLJA 1O7GB 1RJOA 1ROVA 1W6CA 2KF3A 3FF0A 1OUNA 3NXJA 3WMDA 1Q824 1VQ43 2XH9A 1W5ZA 4BL3A 1MNLA 3CCE3 2FXTA 1A2VA 1Q9EA 2KRTA 3G8ZA 2W9PA 3F8XA 3ZG5A 2INXA 1JKGA 1FW7A 1V57A 1BSCA 3N8BA 4OK0A 3BB9A 2OCTA 3LMLA 3SLUA 2YFJB 5EVHA 3S28A 1TJDA 3SOAA 1N8R4 3BNDA 4PEJA 1WNHA 1I2GA 3N54B 1FGTA 2RBIA 5ELUA 4GSPA 1VQ63 3EC9A 1RGHA 2E2TA 1W00A 2CX1A 3OWYA 3EHCA 3QRDA 5D81A 1DETA 2GEYA 1CH0A 3HI7A 1FUWA 1IV7A 2ZA4A 2R4IA 1O7WB 4BTYA 1BIRA 4HM7B 1SPUA 1N5HA 5IENA 3EX9A 4R80A 1UUWB 5RNTA 2UX0A 3T8NA 3G6E3 1Y4KA 3X41A 1A90A 4IIAA 4EXRA 1LOWA 5AYSC 3F7XA 3GZXB 4RNZA 1IDPA 1D6YA 3NBRA 1RN7A 1RGLA 1ROAA 1UDII 4N6NB 5CLKA 1NWWA 2CHCA 3WDGB 1I70A 1OGXA 1OPYA 3JVCA 4FMDA 3MG2A 5G1LA 2QGUA 2XF3A 4XBXA 1FUTA 4GB5A 3NHXA 3V99A 3CU3A 1TUHA 4NHFA 3X3ZA 3IMAB 4MJDA 2RCDA 1YIJ3 3CME3 4FMBA 1A67A 1WTHA 1TFKA 4FCJA 1BSEA 3LTDA 1VQ53 1K41A 4EV5A 1X1XA 1UGIA 4FMAA 1LOVA 2CIUA 3DMCA 1AQZA 2P38A 2WGOA 1U5OA 4HVNA 4I4KA 3SXXA 1DMNA 1QAFA 2HOHA 1BSBA 2O9UX 6GSPA 2BNGA 4EYCA 4LYLB 1OHPA 1K734 1RKYA 4X2HA 1STFI 5AI1A 1WQLB 2IMJA 3LH4A 3LZAA 3DH2A 3LTCA 3CCV3 1OF5A 4K1VA 3EBYA 2OQEC 1LQMB 3LYGA 3GAXA 3MPHA 4J5GA 1S723 3K9MC 1RSNA 2XFSA 3DY5A 3MHEA 1ZS7A 3FG1A 4H61A 3K0ZA 3ECFA 4XBYA 3OX9A 3JUMA 2F98A 1SIIA 1MWRA 1T2HA 5KP3A 3CXC2 1GD4A 1W01A 2C4BA 2IY2A 2Q07A 2W0QA 1K28A 3I563 1NB5I 4KFDA 4K90B 2BMQB 4O2HA 3B4PA 2FNQA 2W56A 4BTXA 1I0XA 1I0VA 4RZMA 2H0IA 2WOHA 2LQVA 3MKIA 3OW22 1HZ1A 4XDWA 2XSOB 3OWSA 1MOLA 1NB3I 1I2FA 1MGRA 1B2XA 1FZUA 3PZWA 1VQL3 4L8PA 4OUQA 4ORLA 1BRIA 1JZDA 5AEUB 1WMPA 1Q40B 3AHWA 5G2GA 1K9M4 4N6MA 4XDVA 2AADA 3Q3FA 5IEPA 3BLZA 4X2OA 2CWTA 1JJ22 3IJEB 3UJMA 1JZOA 4RBNA 3DM8A 3U97A 4Q53A 5HOHA 3FG4A 1ASKA 2P05A 1T3BA 1QVF2 4WYKB 3CC73 3V92A 2GXFA 5AEWB 1X1UA 3T0UA 1YHQ3 4HM6B 2YFIB 1R4YA 3KE7A 2MF7A 4MMZB 1ULJB 1HU9A 1LOXA 4BIRA 2W04A 3CCQ3 2KXGA 4HKVB 1FGMA 5BXQA 3S5CA 1VQ73 2IYJA 3KCHA 4XB5A 8CHOA 2RGQA 1JRQA 3LTBA 2Z6BA 3EF8A 3LT9A 2J8XB 4WWUC 3RGRA 4LEHA 3CCS3 1EQKA 5AIIA 2ML5A 3DGLA 4EC6A 3I0YA 2HMJB 1UUGB 4FMCA 5JPPA 1IK3A 1IT7A 1VQP3 1G96A 4R1KA 3NV0A 2UGIA 1G02A 2ML6A 5IG3A 4FCMA 1OHOA 1EEJA 4CPKA 1EUIC 3VGNA 1JBSA 5M18A 4MEIA 3AGOA 1X1WA 1JV2B 3JUPA 3DGMA 1HKXA 3DGOA 4BTWA 1RMSA 1UI8A 2F5MA 5GSPA 4NPBA 1KC84 1PYLA 2KAAA 3F8HA 3EB8A 1B20A 4I5QA 2FGTA 5A0OB 1QALA 2RNTA 2QA43 3DGNA 1ZX2A 1QAKA 3MG1A 3EN8A 1RN1A 4KT3B 4J9AA 3T8UA 5KP4A 3LT8A 2R41A 1N9JA 2BO9B 3KSPA 1RGEA 4HM1B 1BNSA 1GY6A 1WMNA 3HOHA 4GHOA 3GSPA 1W2ZA 1TIJA 3CMA3 3B7CA 3EE1A 3K63A 4N3VA 1DVDA 2CC3A 3HIIA 1OHSA 2W03A 3CCM3 2RFRA 2QEX3 1DE3A 3G0KA 5LC6A 2P09A 1X1YA 5CF1A 3AGNA 1C7HA 2JQ5A 2YX9A 3WR2A 1W2B2 1B2UA 2OTL3 1RCKA 2E2UA 1QMAA 1B2MA 3A76A 3EQQB 3X3XA 1BU4A 4WHAA 1TU5A 1BRSA 4LGQA 1UI7A 1EKMA 4HJLB 4LZIA 1BUJA 3STDA 5IG4A 2C11A 1CQSA 2CWVA 1YGWA 3LXUX 5AIHA 1BNRA 3HZPA 3X42A 8RNTA 3NM7A 3MWZA 1VQK3 1R4CA 3PCSA 1BRGA 2ZDJA 4WYKA 4EV2A 5BVBA 1W7CA 4GL6A 1RNTA 3HIGA 2IUJA 3A5EA 3UNLA 1JB2A 3KN4A 4K1UA 4L7KA 1WMOA 4WFOA 2XEPA 3KZTA 4U13A 2CFGA 2H0HA 1RRLA 1Q40A 1DMMA 5CK6A 5HGRA 1KSIA 2I9WA 3CNXA 1BRNL 1LXEA 1RGAA 2F5WA 2XGLA 4HM0B 5BIRA 3WA2X 1SQWA 1UUVB 2GBWB 4N6V0 1GS3A 3PYJA 3K5TA 1O7MB 2OTJ3 4LSOA 2KF4A 4O8SA 1RGKA 1MWUA 1UW1A 2WGQA 2OQEA 2P0MA 1B2ZA 1CYUA 1D6ZA 3SYUA 2W6JH 1I2EA 1SIHA 3PCRA 4QWTA 1TTOA 1DVCA 3O8YA 1GSPA 1BSAA 4AKYA 1IVUA 1OACA 1ZO2A 3EN1B 1JB5A 3BIRA 4HOHA 1UCKA 3LTAA 2YFLB 4HYZA 7GSPA 1BUQA 4H3UA 1M1XB 5IG0A 1BSDA 3WHOA 1KD14 3D3LA 2WO0A 1A2KA 3FZWA 1ZGXA 3BU4A 1W6GA 1Z1SA 3AMOB 1DMQA 3FGYA 3F14A 1GMRA 2STDA 3I553 6RNTA 2B1XB 1NU3A 2CKFB 3Q2PA 1KQS2 1U8CB 4BU4A 3PGBA 3MSOA 4RNYA 3PXMA 1JKGB 1RTUA 1T5YA 2K54A 3B4OA 1E3RA 2V1LA 2BIRA 2B24B 1GD3A 3M8CA 4O3VA 1AVLA 1W4NA 2CFDA 1TP6A 3ALAA 3KFQC 1LQGC 2AAEA 1RGCA 4R9LA 1M9GA 3FH1A 1FUSA 3CNMA 4EBGA 1ISKA 2O3OA 3CCR3 3D5IA 5TGNA 2BT3A 4N6LA 2F4YA 1IQXA 3NQZA 3NV0B 2PNCA 1RNBA 1O7NB 2GU3A 1BRKA 1IQ8A 2CK3H 1QVG2 4JF8A 5M1AA 3SVAA 2OOVA 1BNEA 4HM5B 2HMNB 3ER7A 3FSDA 5JBSA 3TDGA 5AIGA 5DREA 5KP1A 3KIIA 4FR9A 1I3FA 3VSYA 5LC7A 5IEOA 2MC8A 5STDA 1BANA 2SBLA 3VF1A 4N6OB 1F8NA 2CX0A 2GSPA 2XGNA 3MYTA 4STDA 2K3DA 2Y74A 2CG0A 2BHMA 2ZL8A 3CCJ3 5IERA 3FF2A 3X40A 2KCDA 2CG1A 4HAAA 1UCIA 2GBXB 1NO3A 3H51A 2GU1A 1BGSA 2SARA 1GY5A 1UCJA 4DKIA 4R9KA 2C10A 3OV4A 4HM3B 2W2CA 2OWPA 3S27A 4IT7A 1B21A 2XSHB 2QIYA 3V98A 1EA2A 1Q42A 3AMOA 3K7CA 5FGOA 4JRFA 3SX1A 3IPTA 4TX4A 4CJNA 3CCU3 1YIT3 3NBBA 5EEOA 3WOEB 3JUNA 3SEDA 2XRXB 3D4AA 1RCLA 1C54A 1EG9B 1BOXA 3Q1CA 1OH0A 1Q864 1NDOB 7STDA 1LNIA 5D83A 3PS8A 1VQ93 3ROBA 5EQLA 1GY7A 4CCVA 1JN5B 3H3HA 4HBRA 3EBTA 2Z76A 1N5PA 3F9SA 3G16A 3SOYA 2E2VA 1M1K4 5AIFA 1D6UA 2XR8B 1VZZA 1STDA 4KFFA 5AYRB 3HX8A 1VQN3 1BNGA 2PZVA 1AR0A 4IPBA 1FGQA 1TRQA 3CPOA 1IVXA 1GYBA 4KVHA 1A2PA 3S67A 2CFLA 1VQ83 2A15A 1TFOA 1PFPA 3RGAA 1DYUA 3GZYB 3D5GA 1N8QA 4NREA 3FKAA 2HMKB 5IG5A 1RDSA 3N9HA 3NUVA 3JUQA 4FCZA 4EW5A 3G713 3ZG0A 1YNVX 2CW9A 1YGEA 2K0MA 4LMIA 3WOFB 1OF5B 4BL2A 2IUKA 1W02A 1FGOA 2W9QA 1JBRA 1ULIB 4N6UA 3LOYA 1UGHI 5IW9A 4AKZA 1AY7A 3MG3A 1RGFA 4MMYB 2CFWA 2M7OA 3WODG 2KF5A 3G4S3 1VQO3 1O7HB 1JB4A 4HM4B 1IYYA 3URPA 4K61A 7RNTA 1IVWA 3L0RA 1K8A4 3UL5A 3KKGA 2UUGC 1RLSA 3F40A 3S29A 3B8LA 1MWSA 3QK9A 3GZBA 4OVMA 1JBTA 4WP5A 5D82A 3CC43 1B27A 5CF2A 1IQYA 4J8TA 1W6YA 5ELJA 2H0GA 2W56B 3HK4A 5IF6A 1V74A 1TRPA 1VQQA 1YVSA 1BNJA 1RGGA 1US1A 1VQM3 1SARA 3KSED 5M19A 1Q7HA 2KF6A 3UL6A 4ILFA 4HM8B 1OGZA 1LRAA 3CC23 3F7SA 1E3VA 1M904 1YJ93 2ZHXB 1BAOA 3J7Yd 2HMOB 2CH9A 4R4KA 1YVBI 3JUOA 5G1KA 2IA7A 4AEQA 1RHLA 3ZFZA 1BVIA 9RNTA 2L1SA 3NX0A 2BMOB 1BNIA 1V58A 2Z7AA 3EJVA 1LNHA 3NM2A 2CWUA 2F99A 4RNTA 1FA3A
chains in the Genus database with same CATH topology
2WOFA 1IVVA 3BNEA 2LYXA 2P0XA 3OXAA 5I97A 2HMMB 3DXOA 1CEWI 2D1WA 3DUKA 4KFEA 1JN5A 4XM4A 1RRHA 1JNQA 1AV4A 2Y73A 1IU7A 1KWIA 3DZLA 4CDLA 4G1MB 3NQYA 3WA3A 1IV9A 4L8OA 5CXOA 3BNCA 1IT8A 3GZRA 1YJN3 3E99A 3D9RA 1LVNA 1J2BA 3U1WA 2OOVC 1AVKA 2XFTA 2JDIH 3X3YA 4O02B 4MMXB 1PU4A 2CFKA 1CYVA 3NBJA 1SJWA 2GEXA 2HMLB 4HZ9B 3CPW2 1QJGA 2D42A 1NJI4 3GWRA 3RDEA 3CD63 1FGRA 1O7PB 2Z77A 3FCSB 3FG3A 5DRVA 3Q90A 2RSXA 4XBTA 5FW5A 4HM2B 3UB1A 1S5AA 3OWUA 1Q7Y4 1L5GB 1YJW3 5JPUA 4KZ1A 2L4VA 1Q814 4HZBB 3CCL3 3GRDA 1E97A 1N9EA 1OCVA 2F86B 4N6TA 4ZM8A 6STDA 2BMRB 3BNBA 3FLJA 1O7GB 1RJOA 1ROVA 1W6CA 3FF0A 1OUNA 3NXJA 3WMDA 1Q824 1VQ43 2XH9A 1W5ZA 1MNLA 3CCE3 2FXTA 1A2VA 2KRTA 3G8ZA 2W9PA 3F8XA 2INXA 1JKGA 3N8BA 4OK0A 3BB9A 2OCTA 3LMLA 3SLUA 2YFJB 5EVHA 3S28A 3SOAA 1N8R4 3BNDA 4PEJA 1WNHA 3N54B 5ELUA 1FGTA 1VQ63 3EC9A 2E2TA 1W00A 3OWYA 3EHCA 3QRDA 5D81A 2GEYA 3HI7A 1FUWA 1IV7A 2R4IA 1O7WB 4BTYA 4HM7B 1SPUA 1N5HA 5IENA 3EX9A 4R80A 1UUWB 2UX0A 3T8NA 3G6E3 1Y4KA 3X41A 1A90A 4IIAA 4EXRA 5AYSC 3F7XA 2F99A 3GZXB 4RNZA 1IDPA 1D6YA 3NBRA 1RN7A 4N6NB 1ROAA 5CLKA 3WDGB 1NWWA 2CHCA 1YI23 1OGXA 1OPYA 3JVCA 4FMDA 3MG2A 2QGUA 2XF3A 4XBXA 4GB5A 3NHXA 3V99A 3CU3A 1TUHA 4NHFA 3X3ZA 3IMAB 4MJDA 2RCDA 1YIJ3 3CME3 4FMBA 1A67A 1WTHA 1TFKA 4FCJA 3LTDA 1VQ53 1K41A 4EV5A 4FMAA 2CIUA 4I4KA 3DMCA 4HVNA 2P38A 2WGOA 1U5OA 3SXXA 1ISKA 1DMNA 1QAFA 2O9UX 2BNGA 4EYCA 1OHPA 1K734 1RKYA 4X2HA 1STFI 5AI1A 1WQLB 2IMJA 3LH4A 3LZAA 3LTCA 3CCV3 1OF5A 4K1VA 3EBYA 2OQEC 3LYGA 3GAXA 3MPHA 1S723 3K9MC 2XFSA 3DY5A 3MHEA 3FG1A 4H61A 3K0ZA 3ECFA 4XBYA 3OX9A 3JUMA 2F98A 1SIIA 5KP3A 3CXC2 1GD4A 1W01A 2Q07A 2W0QA 1K28A 3I563 1NB5I 4KFDA 4K90B 2BMQB 4O2HA 3B4PA 2FNQA 2W56A 4BTXA 4RZMA 2WOHA 2LQVA 3MKIA 3OW22 4XDWA 2XSOB 3OWSA 1MOLA 1NB3I 3PZWA 1VQL3 4L8PA 4OUQA 4ORLA 5AEUB 1WMPA 1Q40B 5G2GA 1K9M4 4N6MA 4XDVA 5IEPA 3BLZA 4X2OA 2CWTA 1JJ22 3IJEB 3UJMA 4RBNA 3DM8A 3U97A 4Q53A 3FG4A 1ASKA 2P05A 1QVF2 4WYKB 3CC73 3V92A 2GXFA 5AEWB 3T0UA 1YHQ3 4HM6B 2YFIB 3KE7A 2MF7A 4MMZB 1ULJB 1HU9A 1LOXA 2W04A 3CCQ3 2KXGA 4HKVB 1FGMA 5BXQA 3S5CA 1VQ73 4XB5A 8CHOA 2RGQA 1JRQA 3LTBA 2Z6BA 3EF8A 3LT9A 4WWUC 3RGRA 4LEHA 3CCS3 1EQKA 5AIIA 2ML5A 3DGLA 4EC6A 3I0YA 2HMJB 4FMCA 5JPPA 1IK3A 1IT7A 1VQP3 1G96A 4R1KA 3NV0A 2ML6A 5IG3A 4FCMA 1OHOA 3VGNA 4MEIA 1JV2B 3JUPA 3DGMA 1HKXA 3DGOA 4BTWA 1UI8A 1KC84 3F8HA 3EB8A 2FGTA 5A0OB 1QALA 2QA43 3DGNA 1ZX2A 1QAKA 3MG1A 3EN8A 5KP4A 4J9AA 3T8UA 3LT8A 1N9JA 2BO9B 3KSPA 4HM1B 1GY6A 1WMNA 1W2ZA 1TIJA 3CMA3 3B7CA 3EE1A 3K63A 4N3VA 1DVDA 2CC3A 3HIIA 1OHSA 2W03A 3CCM3 2RFRA 2QEX3 3G0KA 5LC6A 2P09A 5CF1A 2OTL3 1C7HA 2JQ5A 2YX9A 1W2B2 2E2UA 1QMAA 3A76A 3EQQB 3X3XA 4WHAA 1TU5A 4LGQA 1UI7A 1EKMA 4HJLB 4LZIA 3STDA 5IG4A 2C11A 1CQSA 2CWVA 3LXUX 5AIHA 3HZPA 3X42A 3NM7A 3MWZA 1VQK3 1R4CA 3PCSA 4WYKA 2ZDJA 4EV2A 5BVBA 1W7CA 4GL6A 2IUJA 3HIGA 3UNLA 1JB2A 3KN4A 4K1UA 4L7KA 1WMOA 4WFOA 2XEPA 3KZTA 4U13A 2CFGA 1RRLA 1Q40A 1DMMA 5CK6A 5HGRA 1KSIA 2I9WA 3CNXA 1LXEA 2XGLA 4HM0B 3WA2X 1SQWA 1UUVB 2GBWB 4N6V0 1GS3A 3PYJA 3K5TA 1O7MB 2OTJ3 4LSOA 4O8SA 1UW1A 2WGQA 2OQEA 2P0MA 1CYUA 1D6ZA 2W6JH 3PCRA 1SIHA 4QWTA 1DVCA 3O8YA 4AKYA 1IVUA 3EN1B 1OACA 1ZO2A 1JB5A 3LTAA 2YFLB 4HYZA 1BUQA 4H3UA 1M1XB 5IG0A 1KD14 3D3LA 2WO0A 1A2KA 3FZWA 1W6GA 1Z1SA 3AMOB 1DMQA 3FGYA 3F14A 2STDA 3I553 2B1XB 1NU3A 2CKFB 3Q2PA 1KQS2 1U8CB 3PGBA 3MSOA 4RNYA 3PXMA 1JKGB 1T5YA 2K54A 3B4OA 4O3VA 1E3RA 2V1LA 2B24B 1GD3A 3M8CA 1AVLA 1W4NA 1TP6A 2CFDA 3ALAA 3KFQC 4R9LA 1M9GA 3FH1A 3CNMA 4EBGA 2O3OA 3CCR3 5TGNA 2BT3A 4N6LA 3NV0B 1IQXA 3NQZA 2PNCA 1O7NB 2GU3A 1IQ8A 2CK3H 1QVG2 4JF8A 3SVAA 2OOVA 4HM5B 2HMNB 3ER7A 3FSDA 5JBSA 3TDGA 5AIGA 5DREA 5KP1A 3KIIA 4FR9A 3VSYA 5LC7A 5IEOA 2MC8A 5STDA 2SBLA 3VF1A 4N6OB 1F8NA 2XGNA 3MYTA 4STDA 2Y74A 2CG0A 2BHMA 2ZL8A 3CCJ3 5IERA 3FF2A 3X40A 2KCDA 2CG1A 2GBXB 1NO3A 3H51A 2GU1A 1GY5A 4R9KA 2C10A 3OV4A 4HM3B 2W2CA 2OWPA 3S27A 4IT7A 2XSHB 2QIYA 3V98A 1EA2A 1Q42A 3AMOA 3K7CA 5FGOA 4JRFA 3SX1A 3IPTA 4TX4A 3CCU3 1YIT3 3NBBA 5EEOA 3WOEB 3JUNA 3SEDA 2XRXB 1EG9B 3Q1CA 1Q864 1OH0A 1NDOB 7STDA 5D83A 3PS8A 1VQ93 3ROBA 5EQLA 1GY7A 4CCVA 1JN5B 3H3HA 4HBRA 3EBTA 2Z76A 1N5PA 3F9SA 3G16A 3SOYA 2E2VA 1M1K4 5AIFA 1D6UA 2XR8B 1VZZA 1STDA 4KFFA 5AYRB 3HX8A 1VQN3 2PZVA 1AR0A 4IPBA 1FGQA 3CPOA 1IVXA 1GYBA 4KVHA 3S67A 2CFLA 1VQ83 2A15A 1TFOA 1PFPA 3RGAA 1DYUA 3GZYB 1N8QA 4NREA 3FKAA 2HMKB 5IG5A 3N9HA 3NUVA 3JUQA 4FCZA 3G713 2CW9A 1YGEA 2K0MA 4LMIA 3WOFB 1OF5B 2IUKA 1W02A 1FGOA 1ULIB 4N6UA 3LOYA 5IW9A 4AKZA 3MG3A 3G4S3 4MMYB 2CFWA 2M7OA 3WODG 1VQO3 1O7HB 1JB4A 4HM4B 4K61A 1IVWA 3L0RA 1K8A4 3UL5A 3KKGA 3F40A 3S29A 3B8LA 3QK9A 4OVMA 3GZBA 3CC43 4WP5A 5D82A 5CF2A 1IQYA 4J8TA 1W6YA 5ELJA 2W56B 3HK4A 5IF6A 1V74A 1US1A 1VQM3 3KSED 3UL6A 4HM8B 1OGZA 3CC23 3F7SA 1E3VA 1M904 1YJ93 3J7Yd 2HMOB 2CH9A 4R4KA 1YVBI 3JUOA 2IA7A 4AEQA 3NX0A 2BMOB 3EJVA 2Z7AA 3NM2A 1LNHA 2CWUA 2W9QA 1FA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUW A;  1N9J A;  2BO9 B;  1IV7 A;  3Q2P A;  3MWZ A;  1R4C A;  1CYU A;  1G96 A;  1CYV A;  1CEW I;  1N5H A;  1TIJ A;  1DVC A;  2O9U X;  3PXM A;  5LC7 A;  3KSE D;  4EYC A;  1MNL A;  4N6O B;  3PS8 A;  1GD3 A;  3UL6 A;  1A90 A;  1DVD A;  2W9Q A;  3KFQ C;  5EQL A;  4N6U A;  1KWI A;  2W9P A;  1STF I;  4CCV A;  1RN7 A;  4N6N B;  1ROA A;  1M9G A;  1MOL A;  1NB3 I;  1N5P A;  3LH4 A;  1FA3 A;  2KXG A;  5LC6 A;  1IV9 A;  2OCT A;  3GAX A;  2CH9 A;  1LXE A;  3K9M C;  3L0R A;  1YVB I;  4N6L A;  3UL5 A;  5A0O B;  1WNH A;  5ELU A;  4N6M A;  4IT7 A;  4ZM8 A;  4N6V 0;  3NX0 A;  3IMA B;  4N6T A;  3PYJ A;  1EQK A;  3SVA A;  4LZI A;  5ELJ A;  1GD4 A;  3S67 A;  4TX4 A;  1A67 A;  3QRD A;  1PFP A;  1NB5 I; 
#chains in the Genus database with same CATH topology
 2WOF A;  1IVV A;  3BNE A;  2LYX A;  2P0X A;  3OXA A;  5I97 A;  2HMM B;  3DXO A;  3DGY A;  1CEW I;  2D1W A;  3DUK A;  4KFE A;  1JN5 A;  4XM4 A;  2BU4 A;  1RRH A;  1JNQ A;  1GMQ A;  1AV4 A;  1B3S A;  2Y73 A;  1IU7 A;  1KWI A;  3DZL A;  4CDL A;  4G1M B;  1FYS A;  3NQY A;  3WA3 A;  1IV9 A;  4L8O A;  1HYF A;  1YI2 3;  1GMP A;  5CXO A;  3BNC A;  1G0T A;  1IT8 A;  4J5K A;  1MGW A;  1PY3 A;  3E99 A;  3GZR A;  1YJN 3;  3D9R A;  1LVN A;  1J2B A;  1UCL A;  1GOU A;  3U1W A;  3D79 A;  2OOV C;  3AHS A;  1AVK A;  2XFT A;  1LOY A;  2JDI H;  3X3Y A;  1GOV A;  1GOY A;  4O02 B;  4MMX B;  1BNF A;  2F56 A;  1PU4 A;  2CFK A;  1CYV A;  1B2S A;  3NBJ A;  1BRJ A;  1RN4 A;  1SJW A;  2GEX A;  2HML B;  1BRH A;  4HZ9 B;  3CPW 2;  1QJG A;  2D42 A;  3RNT A;  3GWR A;  1T2I A;  1NJI 4;  3RDE A;  3CD6 3;  1MWT A;  1FGR A;  1O7P B;  2Z77 A;  3FCS B;  3FG3 A;  5DRV A;  3Q90 A;  2RSX A;  4XBT A;  5FW5 A;  4HM2 B;  3UB1 A;  1S5A A;  3OWU A;  1Q7Y 4;  1L5G B;  1YJW 3;  5JPU A;  4KZ1 A;  2L4V A;  1Q81 4;  1I3I A;  4HZB B;  3CCL 3;  1I8V A;  1NNV A;  3GRD A;  1E97 A;  1N9E A;  1OCV A;  2F86 B;  4N6T A;  4ZM8 A;  5BU4 A;  6STD A;  2BMR B;  3BNB A;  3FLJ A;  1O7G B;  1RJO A;  1ROV A;  1W6C A;  2KF3 A;  3FF0 A;  1OUN A;  3NXJ A;  3WMD A;  1Q82 4;  1VQ4 3;  2XH9 A;  1W5Z A;  4BL3 A;  1MNL A;  3CCE 3;  2FXT A;  1A2V A;  1Q9E A;  2KRT A;  3G8Z A;  2W9P A;  3F8X A;  3ZG5 A;  2INX A;  1JKG A;  1FW7 A;  1V57 A;  1BSC A;  3N8B A;  4OK0 A;  3BB9 A;  2OCT A;  3LML A;  3SLU A;  2YFJ B;  5EVH A;  3S28 A;  1TJD A;  3SOA A;  1N8R 4;  3BND A;  4PEJ A;  1WNH A;  1I2G A;  3N54 B;  1FGT A;  2RBI A;  5ELU A;  4GSP A;  1VQ6 3;  3EC9 A;  1RGH A;  2E2T A;  1W00 A;  2CX1 A;  3OWY A;  3EHC A;  3QRD A;  5D81 A;  1DET A;  2GEY A;  1CH0 A;  3HI7 A;  1FUW A;  1IV7 A;  2ZA4 A;  2R4I A;  1O7W B;  4BTY A;  1BIR A;  4HM7 B;  1SPU A;  1N5H A;  5IEN A;  3EX9 A;  4R80 A;  1UUW B;  5RNT A;  2UX0 A;  3T8N A;  3G6E 3;  1Y4K A;  3X41 A;  1A90 A;  4IIA A;  4EXR A;  1LOW A;  5AYS C;  3F7X A;  3GZX B;  4RNZ A;  1IDP A;  1D6Y A;  3NBR A;  1RN7 A;  1RGL A;  1ROA A;  1UDI I;  4N6N B;  5CLK A;  1NWW A;  2CHC A;  3WDG B;  1I70 A;  1OGX A;  1OPY A;  3JVC A;  4FMD A;  3MG2 A;  5G1L A;  2QGU A;  2XF3 A;  4XBX A;  1FUT A;  4GB5 A;  3NHX A;  3V99 A;  3CU3 A;  1TUH A;  4NHF A;  3X3Z A;  3IMA B;  4MJD A;  2RCD A;  1YIJ 3;  3CME 3;  4FMB A;  1A67 A;  1WTH A;  1TFK A;  4FCJ A;  1BSE A;  3LTD A;  1VQ5 3;  1K41 A;  4EV5 A;  1X1X A;  1UGI A;  4FMA A;  1LOV A;  2CIU A;  3DMC A;  1AQZ A;  2P38 A;  2WGO A;  1U5O A;  4HVN A;  4I4K A;  3SXX A;  1DMN A;  1QAF A;  2HOH A;  1BSB A;  2O9U X;  6GSP A;  2BNG A;  4EYC A;  4LYL B;  1OHP A;  1K73 4;  1RKY A;  4X2H A;  1STF I;  5AI1 A;  1WQL B;  2IMJ A;  3LH4 A;  3LZA A;  3DH2 A;  3LTC A;  3CCV 3;  1OF5 A;  4K1V A;  3EBY A;  2OQE C;  1LQM B;  3LYG A;  3GAX A;  3MPH A;  4J5G A;  1S72 3;  3K9M C;  1RSN A;  2XFS A;  3DY5 A;  3MHE A;  1ZS7 A;  3FG1 A;  4H61 A;  3K0Z A;  3ECF A;  4XBY A;  3OX9 A;  3JUM A;  2F98 A;  1SII A;  1MWR A;  1T2H A;  5KP3 A;  3CXC 2;  1GD4 A;  1W01 A;  2C4B A;  2IY2 A;  2Q07 A;  2W0Q A;  1K28 A;  3I56 3;  1NB5 I;  4KFD A;  4K90 B;  2BMQ B;  4O2H A;  3B4P A;  2FNQ A;  2W56 A;  4BTX A;  1I0X A;  1I0V A;  4RZM A;  2H0I A;  2WOH A;  2LQV A;  3MKI A;  3OW2 2;  1HZ1 A;  4XDW A;  2XSO B;  3OWS A;  1MOL A;  1NB3 I;  1I2F A;  1MGR A;  1B2X A;  1FZU A;  3PZW A;  1VQL 3;  4L8P A;  4OUQ A;  4ORL A;  1BRI A;  1JZD A;  5AEU B;  1WMP A;  1Q40 B;  3AHW A;  5G2G A;  1K9M 4;  4N6M A;  4XDV A;  2AAD A;  3Q3F A;  5IEP A;  3BLZ A;  4X2O A;  2CWT A;  1JJ2 2;  3IJE B;  3UJM A;  1JZO A;  4RBN A;  3DM8 A;  3U97 A;  4Q53 A;  5HOH A;  3FG4 A;  1ASK A;  2P05 A;  1T3B A;  1QVF 2;  4WYK B;  3CC7 3;  3V92 A;  2GXF A;  5AEW B;  1X1U A;  3T0U A;  1YHQ 3;  4HM6 B;  2YFI B;  1R4Y A;  3KE7 A;  2MF7 A;  4MMZ B;  1ULJ B;  1HU9 A;  1LOX A;  4BIR A;  2W04 A;  3CCQ 3;  2KXG A;  4HKV B;  1FGM A;  5BXQ A;  3S5C A;  1VQ7 3;  2IYJ A;  3KCH A;  4XB5 A;  8CHO A;  2RGQ A;  1JRQ A;  3LTB A;  2Z6B A;  3EF8 A;  3LT9 A;  2J8X B;  4WWU C;  3RGR A;  4LEH A;  3CCS 3;  1EQK A;  5AII A;  2ML5 A;  3DGL A;  4EC6 A;  3I0Y A;  2HMJ B;  1UUG B;  4FMC A;  5JPP A;  1IK3 A;  1IT7 A;  1VQP 3;  1G96 A;  4R1K A;  3NV0 A;  2UGI A;  1G02 A;  2ML6 A;  5IG3 A;  4FCM A;  1OHO A;  1EEJ A;  4CPK A;  1EUI C;  3VGN A;  1JBS A;  5M18 A;  4MEI A;  3AGO A;  1X1W A;  1JV2 B;  3JUP A;  3DGM A;  1HKX A;  3DGO A;  4BTW A;  1RMS A;  1UI8 A;  2F5M A;  5GSP A;  4NPB A;  1KC8 4;  1PYL A;  2KAA A;  3F8H A;  3EB8 A;  1B20 A;  4I5Q A;  2FGT A;  5A0O B;  1QAL A;  2RNT A;  2QA4 3;  3DGN A;  1ZX2 A;  1QAK A;  3MG1 A;  3EN8 A;  1RN1 A;  4KT3 B;  4J9A A;  3T8U A;  5KP4 A;  3LT8 A;  2R41 A;  1N9J A;  2BO9 B;  3KSP A;  1RGE A;  4HM1 B;  1BNS A;  1GY6 A;  1WMN A;  3HOH A;  4GHO A;  3GSP A;  1W2Z A;  1TIJ A;  3CMA 3;  3B7C A;  3EE1 A;  3K63 A;  4N3V A;  1DVD A;  2CC3 A;  3HII A;  1OHS A;  2W03 A;  3CCM 3;  2RFR A;  2QEX 3;  1DE3 A;  3G0K A;  5LC6 A;  2P09 A;  1X1Y A;  5CF1 A;  3AGN A;  1C7H A;  2JQ5 A;  2YX9 A;  3WR2 A;  1W2B 2;  1B2U A;  2OTL 3;  1RCK A;  2E2U A;  1QMA A;  1B2M A;  3A76 A;  3EQQ B;  3X3X A;  1BU4 A;  4WHA A;  1TU5 A;  1BRS A;  4LGQ A;  1UI7 A;  1EKM A;  4HJL B;  4LZI A;  1BUJ A;  3STD A;  5IG4 A;  2C11 A;  1CQS A;  2CWV A;  1YGW A;  3LXU X;  5AIH A;  1BNR A;  3HZP A;  3X42 A;  8RNT A;  3NM7 A;  3MWZ A;  1VQK 3;  1R4C A;  3PCS A;  1BRG A;  2ZDJ A;  4WYK A;  4EV2 A;  5BVB A;  1W7C A;  4GL6 A;  1RNT A;  3HIG A;  2IUJ A;  3A5E A;  3UNL A;  1JB2 A;  3KN4 A;  4K1U A;  4L7K A;  1WMO A;  4WFO A;  2XEP A;  3KZT A;  4U13 A;  2CFG A;  2H0H A;  1RRL A;  1Q40 A;  1DMM A;  5CK6 A;  5HGR A;  1KSI A;  2I9W A;  3CNX A;  1BRN L;  1LXE A;  1RGA A;  2F5W A;  2XGL A;  4HM0 B;  5BIR A;  3WA2 X;  1SQW A;  1UUV B;  2GBW B;  4N6V 0;  1GS3 A;  3PYJ A;  3K5T A;  1O7M B;  2OTJ 3;  4LSO A;  2KF4 A;  4O8S A;  1RGK A;  1MWU A;  1UW1 A;  2WGQ A;  2OQE A;  2P0M A;  1B2Z A;  1CYU A;  1D6Z A;  3SYU A;  2W6J H;  1I2E A;  1SIH A;  3PCR A;  4QWT A;  1TTO A;  1DVC A;  3O8Y A;  1GSP A;  1BSA A;  4AKY A;  1IVU A;  1OAC A;  1ZO2 A;  3EN1 B;  1JB5 A;  3BIR A;  4HOH A;  1UCK A;  3LTA A;  2YFL B;  4HYZ A;  7GSP A;  1BUQ A;  4H3U A;  1M1X B;  5IG0 A;  1BSD A;  3WHO A;  1KD1 4;  3D3L A;  2WO0 A;  1A2K A;  3FZW A;  1ZGX A;  3BU4 A;  1W6G A;  1Z1S A;  3AMO B;  1DMQ A;  3FGY A;  3F14 A;  1GMR A;  2STD A;  3I55 3;  6RNT A;  2B1X B;  1NU3 A;  2CKF B;  3Q2P A;  1KQS 2;  1U8C B;  4BU4 A;  3PGB A;  3MSO A;  4RNY A;  3PXM A;  1JKG B;  1RTU A;  1T5Y A;  2K54 A;  3B4O A;  1E3R A;  2V1L A;  2BIR A;  2B24 B;  1GD3 A;  3M8C A;  4O3V A;  1AVL A;  1W4N A;  2CFD A;  1TP6 A;  3ALA A;  3KFQ C;  1LQG C;  2AAE A;  1RGC A;  4R9L A;  1M9G A;  3FH1 A;  1FUS A;  3CNM A;  4EBG A;  1ISK A;  2O3O A;  3CCR 3;  3D5I A;  5TGN A;  2BT3 A;  4N6L A;  2F4Y A;  1IQX A;  3NQZ A;  3NV0 B;  2PNC A;  1RNB A;  1O7N B;  2GU3 A;  1BRK A;  1IQ8 A;  2CK3 H;  1QVG 2;  4JF8 A;  5M1A A;  3SVA A;  2OOV A;  1BNE A;  4HM5 B;  2HMN B;  3ER7 A;  3FSD A;  5JBS A;  3TDG A;  5AIG A;  5DRE A;  5KP1 A;  3KII A;  4FR9 A;  1I3F A;  3VSY A;  5LC7 A;  5IEO A;  2MC8 A;  5STD A;  1BAN A;  2SBL A;  3VF1 A;  4N6O B;  1F8N A;  2CX0 A;  2GSP A;  2XGN A;  3MYT A;  4STD A;  2K3D A;  2Y74 A;  2CG0 A;  2BHM A;  2ZL8 A;  3CCJ 3;  5IER A;  3FF2 A;  3X40 A;  2KCD A;  2CG1 A;  4HAA A;  1UCI A;  2GBX B;  1NO3 A;  3H51 A;  2GU1 A;  1BGS A;  2SAR A;  1GY5 A;  1UCJ A;  4DKI A;  4R9K A;  2C10 A;  3OV4 A;  4HM3 B;  2W2C A;  2OWP A;  3S27 A;  4IT7 A;  1B21 A;  2XSH B;  2QIY A;  3V98 A;  1EA2 A;  1Q42 A;  3AMO A;  3K7C A;  5FGO A;  4JRF A;  3SX1 A;  3IPT A;  4TX4 A;  4CJN A;  3CCU 3;  1YIT 3;  3NBB A;  5EEO A;  3WOE B;  3JUN A;  3SED A;  2XRX B;  3D4A A;  1RCL A;  1C54 A;  1EG9 B;  1BOX A;  3Q1C A;  1OH0 A;  1Q86 4;  1NDO B;  7STD A;  1LNI A;  5D83 A;  3PS8 A;  1VQ9 3;  3ROB A;  5EQL A;  1GY7 A;  4CCV A;  1JN5 B;  3H3H A;  4HBR A;  3EBT A;  2Z76 A;  1N5P A;  3F9S A;  3G16 A;  3SOY A;  2E2V A;  1M1K 4;  5AIF A;  1D6U A;  2XR8 B;  1VZZ A;  1STD A;  4KFF A;  5AYR B;  3HX8 A;  1VQN 3;  1BNG A;  2PZV A;  1AR0 A;  4IPB A;  1FGQ A;  1TRQ A;  3CPO A;  1IVX A;  1GYB A;  4KVH A;  1A2P A;  3S67 A;  2CFL A;  1VQ8 3;  2A15 A;  1TFO A;  1PFP A;  3RGA A;  1DYU A;  3GZY B;  3D5G A;  1N8Q A;  4NRE A;  3FKA A;  2HMK B;  5IG5 A;  1RDS A;  3N9H A;  3NUV A;  3JUQ A;  4FCZ A;  4EW5 A;  3G71 3;  3ZG0 A;  1YNV X;  2CW9 A;  1YGE A;  2K0M A;  4LMI A;  3WOF B;  1OF5 B;  4BL2 A;  2IUK A;  1W02 A;  1FGO A;  2W9Q A;  1JBR A;  1ULI B;  4N6U A;  3LOY A;  1UGH I;  5IW9 A;  4AKZ A;  1AY7 A;  3MG3 A;  1RGF A;  4MMY B;  2CFW A;  2M7O A;  3WOD G;  2KF5 A;  3G4S 3;  1VQO 3;  1O7H B;  1JB4 A;  4HM4 B;  1IYY A;  3URP A;  4K61 A;  7RNT A;  1IVW A;  3L0R A;  1K8A 4;  3UL5 A;  3KKG A;  2UUG C;  1RLS A;  3F40 A;  3S29 A;  3B8L A;  1MWS A;  3QK9 A;  3GZB A;  4OVM A;  1JBT A;  4WP5 A;  5D82 A;  3CC4 3;  1B27 A;  5CF2 A;  1IQY A;  4J8T A;  1W6Y A;  5ELJ A;  2H0G A;  2W56 B;  3HK4 A;  5IF6 A;  1V74 A;  1TRP A;  1VQQ A;  1YVS A;  1BNJ A;  1RGG A;  1US1 A;  1VQM 3;  1SAR A;  3KSE D;  5M19 A;  1Q7H A;  2KF6 A;  3UL6 A;  4ILF A;  4HM8 B;  1OGZ A;  1LRA A;  3CC2 3;  3F7S A;  1E3V A;  1M90 4;  1YJ9 3;  2ZHX B;  1BAO A;  3J7Y d;  2HMO B;  2CH9 A;  4R4K A;  1YVB I;  3JUO A;  5G1K A;  2IA7 A;  4AEQ A;  1RHL A;  3ZFZ A;  1BVI A;  9RNT A;  2L1S A;  3NX0 A;  2BMO B;  1BNI A;  1V58 A;  2Z7A A;  3EJV A;  1LNH A;  3NM2 A;  2CWU A;  2F99 A;  4RNT A;  1FA3 A; 
#chains in the Genus database with same CATH homology
 2WOF A;  1IVV A;  3BNE A;  2LYX A;  2P0X A;  3OXA A;  5I97 A;  2HMM B;  3DXO A;  1CEW I;  2D1W A;  3DUK A;  4KFE A;  1JN5 A;  4XM4 A;  1RRH A;  1JNQ A;  1AV4 A;  2Y73 A;  1IU7 A;  1KWI A;  3DZL A;  4CDL A;  4G1M B;  3NQY A;  3WA3 A;  1IV9 A;  4L8O A;  5CXO A;  3BNC A;  1IT8 A;  3GZR A;  1YJN 3;  3E99 A;  3D9R A;  1LVN A;  1J2B A;  3U1W A;  2OOV C;  1AVK A;  2XFT A;  2JDI H;  3X3Y A;  4O02 B;  4MMX B;  1PU4 A;  2CFK A;  1CYV A;  3NBJ A;  1SJW A;  2GEX A;  2HML B;  4HZ9 B;  3CPW 2;  1QJG A;  2D42 A;  1NJI 4;  3GWR A;  3RDE A;  3CD6 3;  1FGR A;  1O7P B;  2Z77 A;  3FCS B;  3FG3 A;  5DRV A;  3Q90 A;  2RSX A;  4XBT A;  5FW5 A;  4HM2 B;  3UB1 A;  1S5A A;  3OWU A;  1Q7Y 4;  1L5G B;  1YJW 3;  5JPU A;  4KZ1 A;  2L4V A;  1Q81 4;  4HZB B;  3CCL 3;  3GRD A;  1E97 A;  1N9E A;  1OCV A;  2F86 B;  4N6T A;  4ZM8 A;  6STD A;  2BMR B;  3BNB A;  3FLJ A;  1O7G B;  1RJO A;  1ROV A;  1W6C A;  3FF0 A;  1OUN A;  3NXJ A;  3WMD A;  1Q82 4;  1VQ4 3;  2XH9 A;  1W5Z A;  1MNL A;  3CCE 3;  2FXT A;  1A2V A;  2KRT A;  3G8Z A;  2W9P A;  3F8X A;  2INX A;  1JKG A;  3N8B A;  4OK0 A;  3BB9 A;  2OCT A;  3LML A;  3SLU A;  2YFJ B;  5EVH A;  3S28 A;  3SOA A;  1N8R 4;  3BND A;  4PEJ A;  1WNH A;  3N54 B;  5ELU A;  1FGT A;  1VQ6 3;  3EC9 A;  2E2T A;  1W00 A;  3OWY A;  3EHC A;  3QRD A;  5D81 A;  2GEY A;  3HI7 A;  1FUW A;  1IV7 A;  2R4I A;  1O7W B;  4BTY A;  4HM7 B;  1SPU A;  1N5H A;  5IEN A;  3EX9 A;  4R80 A;  1UUW B;  2UX0 A;  3T8N A;  3G6E 3;  1Y4K A;  3X41 A;  1A90 A;  4IIA A;  4EXR A;  5AYS C;  3F7X A;  2F99 A;  3GZX B;  4RNZ A;  1IDP A;  1D6Y A;  3NBR A;  1RN7 A;  4N6N B;  1ROA A;  5CLK A;  3WDG B;  1NWW A;  2CHC A;  1YI2 3;  1OGX A;  1OPY A;  3JVC A;  4FMD A;  3MG2 A;  2QGU A;  2XF3 A;  4XBX A;  4GB5 A;  3NHX A;  3V99 A;  3CU3 A;  1TUH A;  4NHF A;  3X3Z A;  3IMA B;  4MJD A;  2RCD A;  1YIJ 3;  3CME 3;  4FMB A;  1A67 A;  1WTH A;  1TFK A;  4FCJ A;  3LTD A;  1VQ5 3;  1K41 A;  4EV5 A;  4FMA A;  2CIU A;  4I4K A;  3DMC A;  4HVN A;  2P38 A;  2WGO A;  1U5O A;  3SXX A;  1ISK A;  1DMN A;  1QAF A;  2O9U X;  2BNG A;  4EYC A;  1OHP A;  1K73 4;  1RKY A;  4X2H A;  1STF I;  5AI1 A;  1WQL B;  2IMJ A;  3LH4 A;  3LZA A;  3LTC A;  3CCV 3;  1OF5 A;  4K1V A;  3EBY A;  2OQE C;  3LYG A;  3GAX A;  3MPH A;  1S72 3;  3K9M C;  2XFS A;  3DY5 A;  3MHE A;  3FG1 A;  4H61 A;  3K0Z A;  3ECF A;  4XBY A;  3OX9 A;  3JUM A;  2F98 A;  1SII A;  5KP3 A;  3CXC 2;  1GD4 A;  1W01 A;  2Q07 A;  2W0Q A;  1K28 A;  3I56 3;  1NB5 I;  4KFD A;  4K90 B;  2BMQ B;  4O2H A;  3B4P A;  2FNQ A;  2W56 A;  4BTX A;  4RZM A;  2WOH A;  2LQV A;  3MKI A;  3OW2 2;  4XDW A;  2XSO B;  3OWS A;  1MOL A;  1NB3 I;  3PZW A;  1VQL 3;  4L8P A;  4OUQ A;  4ORL A;  5AEU B;  1WMP A;  1Q40 B;  5G2G A;  1K9M 4;  4N6M A;  4XDV A;  5IEP A;  3BLZ A;  4X2O A;  2CWT A;  1JJ2 2;  3IJE B;  3UJM A;  4RBN A;  3DM8 A;  3U97 A;  4Q53 A;  3FG4 A;  1ASK A;  2P05 A;  1QVF 2;  4WYK B;  3CC7 3;  3V92 A;  2GXF A;  5AEW B;  3T0U A;  1YHQ 3;  4HM6 B;  2YFI B;  3KE7 A;  2MF7 A;  4MMZ B;  1ULJ B;  1HU9 A;  1LOX A;  2W04 A;  3CCQ 3;  2KXG A;  4HKV B;  1FGM A;  5BXQ A;  3S5C A;  1VQ7 3;  4XB5 A;  8CHO A;  2RGQ A;  1JRQ A;  3LTB A;  2Z6B A;  3EF8 A;  3LT9 A;  4WWU C;  3RGR A;  4LEH A;  3CCS 3;  1EQK A;  5AII A;  2ML5 A;  3DGL A;  4EC6 A;  3I0Y A;  2HMJ B;  4FMC A;  5JPP A;  1IK3 A;  1IT7 A;  1VQP 3;  1G96 A;  4R1K A;  3NV0 A;  2ML6 A;  5IG3 A;  4FCM A;  1OHO A;  3VGN A;  4MEI A;  1JV2 B;  3JUP A;  3DGM A;  1HKX A;  3DGO A;  4BTW A;  1UI8 A;  1KC8 4;  3F8H A;  3EB8 A;  2FGT A;  5A0O B;  1QAL A;  2QA4 3;  3DGN A;  1ZX2 A;  1QAK A;  3MG1 A;  3EN8 A;  5KP4 A;  4J9A A;  3T8U A;  3LT8 A;  1N9J A;  2BO9 B;  3KSP A;  4HM1 B;  1GY6 A;  1WMN A;  1W2Z A;  1TIJ A;  3CMA 3;  3B7C A;  3EE1 A;  3K63 A;  4N3V A;  1DVD A;  2CC3 A;  3HII A;  1OHS A;  2W03 A;  3CCM 3;  2RFR A;  2QEX 3;  3G0K A;  5LC6 A;  2P09 A;  5CF1 A;  2OTL 3;  1C7H A;  2JQ5 A;  2YX9 A;  1W2B 2;  2E2U A;  1QMA A;  3A76 A;  3EQQ B;  3X3X A;  4WHA A;  1TU5 A;  4LGQ A;  1UI7 A;  1EKM A;  4HJL B;  4LZI A;  3STD A;  5IG4 A;  2C11 A;  1CQS A;  2CWV A;  3LXU X;  5AIH A;  3HZP A;  3X42 A;  3NM7 A;  3MWZ A;  1VQK 3;  1R4C A;  3PCS A;  4WYK A;  2ZDJ A;  4EV2 A;  5BVB A;  1W7C A;  4GL6 A;  2IUJ A;  3HIG A;  3UNL A;  1JB2 A;  3KN4 A;  4K1U A;  4L7K A;  1WMO A;  4WFO A;  2XEP A;  3KZT A;  4U13 A;  2CFG A;  1RRL A;  1Q40 A;  1DMM A;  5CK6 A;  5HGR A;  1KSI A;  2I9W A;  3CNX A;  1LXE A;  2XGL A;  4HM0 B;  3WA2 X;  1SQW A;  1UUV B;  2GBW B;  4N6V 0;  1GS3 A;  3PYJ A;  3K5T A;  1O7M B;  2OTJ 3;  4LSO A;  4O8S A;  1UW1 A;  2WGQ A;  2OQE A;  2P0M A;  1CYU A;  1D6Z A;  2W6J H;  3PCR A;  1SIH A;  4QWT A;  1DVC A;  3O8Y A;  4AKY A;  1IVU A;  3EN1 B;  1OAC A;  1ZO2 A;  1JB5 A;  3LTA A;  2YFL B;  4HYZ A;  1BUQ A;  4H3U A;  1M1X B;  5IG0 A;  1KD1 4;  3D3L A;  2WO0 A;  1A2K A;  3FZW A;  1W6G A;  1Z1S A;  3AMO B;  1DMQ A;  3FGY A;  3F14 A;  2STD A;  3I55 3;  2B1X B;  1NU3 A;  2CKF B;  3Q2P A;  1KQS 2;  1U8C B;  3PGB A;  3MSO A;  4RNY A;  3PXM A;  1JKG B;  1T5Y A;  2K54 A;  3B4O A;  4O3V A;  1E3R A;  2V1L A;  2B24 B;  1GD3 A;  3M8C A;  1AVL A;  1W4N A;  1TP6 A;  2CFD A;  3ALA A;  3KFQ C;  4R9L A;  1M9G A;  3FH1 A;  3CNM A;  4EBG A;  2O3O A;  3CCR 3;  5TGN A;  2BT3 A;  4N6L A;  3NV0 B;  1IQX A;  3NQZ A;  2PNC A;  1O7N B;  2GU3 A;  1IQ8 A;  2CK3 H;  1QVG 2;  4JF8 A;  3SVA A;  2OOV A;  4HM5 B;  2HMN B;  3ER7 A;  3FSD A;  5JBS A;  3TDG A;  5AIG A;  5DRE A;  5KP1 A;  3KII A;  4FR9 A;  3VSY A;  5LC7 A;  5IEO A;  2MC8 A;  5STD A;  2SBL A;  3VF1 A;  4N6O B;  1F8N A;  2XGN A;  3MYT A;  4STD A;  2Y74 A;  2CG0 A;  2BHM A;  2ZL8 A;  3CCJ 3;  5IER A;  3FF2 A;  3X40 A;  2KCD A;  2CG1 A;  2GBX B;  1NO3 A;  3H51 A;  2GU1 A;  1GY5 A;  4R9K A;  2C10 A;  3OV4 A;  4HM3 B;  2W2C A;  2OWP A;  3S27 A;  4IT7 A;  2XSH B;  2QIY A;  3V98 A;  1EA2 A;  1Q42 A;  3AMO A;  3K7C A;  5FGO A;  4JRF A;  3SX1 A;  3IPT A;  4TX4 A;  3CCU 3;  1YIT 3;  3NBB A;  5EEO A;  3WOE B;  3JUN A;  3SED A;  2XRX B;  1EG9 B;  3Q1C A;  1Q86 4;  1OH0 A;  1NDO B;  7STD A;  5D83 A;  3PS8 A;  1VQ9 3;  3ROB A;  5EQL A;  1GY7 A;  4CCV A;  1JN5 B;  3H3H A;  4HBR A;  3EBT A;  2Z76 A;  1N5P A;  3F9S A;  3G16 A;  3SOY A;  2E2V A;  1M1K 4;  5AIF A;  1D6U A;  2XR8 B;  1VZZ A;  1STD A;  4KFF A;  5AYR B;  3HX8 A;  1VQN 3;  2PZV A;  1AR0 A;  4IPB A;  1FGQ A;  3CPO A;  1IVX A;  1GYB A;  4KVH A;  3S67 A;  2CFL A;  1VQ8 3;  2A15 A;  1TFO A;  1PFP A;  3RGA A;  1DYU A;  3GZY B;  1N8Q A;  4NRE A;  3FKA A;  2HMK B;  5IG5 A;  3N9H A;  3NUV A;  3JUQ A;  4FCZ A;  3G71 3;  2CW9 A;  1YGE A;  2K0M A;  4LMI A;  3WOF B;  1OF5 B;  2IUK A;  1W02 A;  1FGO A;  1ULI B;  4N6U A;  3LOY A;  5IW9 A;  4AKZ A;  3MG3 A;  3G4S 3;  4MMY B;  2CFW A;  2M7O A;  3WOD G;  1VQO 3;  1O7H B;  1JB4 A;  4HM4 B;  4K61 A;  1IVW A;  3L0R A;  1K8A 4;  3UL5 A;  3KKG A;  3F40 A;  3S29 A;  3B8L A;  3QK9 A;  4OVM A;  3GZB A;  3CC4 3;  4WP5 A;  5D82 A;  5CF2 A;  1IQY A;  4J8T A;  1W6Y A;  5ELJ A;  2W56 B;  3HK4 A;  5IF6 A;  1V74 A;  1US1 A;  1VQM 3;  3KSE D;  3UL6 A;  4HM8 B;  1OGZ A;  3CC2 3;  3F7S A;  1E3V A;  1M90 4;  1YJ9 3;  3J7Y d;  2HMO B;  2CH9 A;  4R4K A;  1YVB I;  3JUO A;  2IA7 A;  4AEQ A;  3NX0 A;  2BMO B;  3EJV A;  2Z7A A;  3NM2 A;  1LNH A;  2CWU A;  2W9Q A;  1FA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...