5EM0A

Crystal structure of mugwort allergen art v 4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
133
Chain Sequence
SGSWQTYVDDHLMDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pollen allergen Art v 4.01
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Artemisia vulgaris
molecule tags Allergen
total genus 35
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5em0A00
1D1JA 1VEUA 1G5UA 2E8JA 2PRFA 3U4LP 1VETA 2V8FA 2ZL1B 3T1XA 5EVEA 2JKFA 1FILA 4X1MA 5FEGA 3T12B 3CHWP 1CF0A 2JKGA 2V8CA 1HLUP 2ZL1A 1ACFA 5EM1A 3NULA 3NECA 2HZ5A 1A0KA 1J3WA 3T1RA 5FEFA 3T1QB 1Y4OA 2B95A 2ACGA 1FIKA 4X25A 1AWIA 1CJFA 5EM0A 4X1LA 4QWOA 3D9YA 3UB5P 3MS6A 1SZVA 3DAVA 3L7HA 3CPTB 5FDSA 3T1SA 1K0KA 1YPRA 4FTXA 1CQAA 2PBDP 1SKOB 4ESPA 3LGOA 3KYEA 1PRQA 3L9KA 1PNEA 3CPTA 1VEUB 5EV0A 3MSHA 2VK3A 4D60A 3LEQA 1VETB 2BTFP 1SKOA 1F2KA 2PAVP 4FUWA 1Z09A 1PFLA
chains in the Genus database with same CATH superfamily
3IF6B 2KDKA 3FC7A 1G68A 1ES5A 3W4PA 1NYYA 1MXOA 2JKRM 3CLOA 2XGNA 3G6OA 4OONA 4D2OA 1K6RA 3BQ8A 3LEZA 4NK3A 3SOIA 1N9OA 1ES3A 3F1NA 4HH3A 3K2NA 5EM1A 2EX9A 1Y28A 3NULA 5KSCA 3BFEA 5FATA 1DY6A 5A90A 3M6BA 2XA7S 2XD1A 4I5SA 2D02A 3LY4A 4E3LA 5EOEA 1NY0A 4GD6A 3LR4A 5EOOA 4OH0A 3CZDA 2CC1A 2H0TA 1FIKA 2J3WA 4X25A 4EXOA 4GDBA 4R6LA 2VLGA 1KVLA 4UEYA 2QPNA 5JYOA 5L8MA 4XUXA 5I5LA 2INWA 4Z1WA 4WN5A 2A24B 4LFUA 5DKKA 2PU2A 4XT2A 3HJIA 2PBDP 5F1GA 3LR5A 3C4OA 3LGOA 4PM6A 3B42A 3UPOA 1SKFA 1P9RA 3UB9A 5KSHA 1PRQA 3P7NA 2HP6A 5A92A 5A91A 4E3OA 2P7JA 3MZEA 1OT9A 4N9LA 3VP1A 3GV9A 5G4YA 3A3JA 4ZJ1A 3QHYA 4S2PA 3LCEA 1WE4A 2VA0A 3RXXA 1Q2QA 1QMEA 4OPYA 4ZJ2A 1BT5A 2PRFA 5J4EA 1PI5A 3QP5A 1S67L 2OWJA 4BL2A 2ZM0A 3HLCA 4L9GA 3T1XA 1K54C 2PR5A 3DTKA 4R38A 1FR6A 5GL9A 2V0UA 4E3NA 5FAQA 3MQ0A 1TD5A 4JBFA 5J7EA 2Y55A 3GSGA 4OQGA 4RYEA 5J3WA 2DCFA 4R3JA 2PD7A 5AVFA 4ETZA 1GA9A 1J3WA 2O0YA 4K0WA 1T19A 3KSGA 3EEAA 4WEKA 1CEGA 1OMEA 3O3VA 2V9AA 1YLZA 4Y0UA 4PAUA 4IUKA 3KSHA 3A3FA 4FCFA 2Y2IA 4MN7A 5E2GA 3OC2A 2HJEA 3IWOA 1LL5A 4HQAA 2WKQA 3D9YA 3HUOA 3BQAA 4KUKA 3BYDA 2W1TB 3G4PA 1OTAA 1L2SA 1K0KA 4KZ4A 2WZZA 2DRWA 1OJGA 3B33A 5CHMA 4GLQA 3GVBA 3UB7A 3OOVA 3VFHA 3C30A 4MNRA 2Y2NA 2QMIA 3WS2A 4FUWA 1LSWA 1YAXA 1LSVA 5HX9A 1D1JA 1LSXA 5L07A 4C75A 4HEFA 3N8LA 3U4LP 1ONGA 3IX8A 1GHIA 4UQIS 5AQAA 3JYIA 5EVEA 3W8KA 1BSGA 1ODVA 3F1OB 2JKFA 4GD8A 4HY8A 2ZM8A 2Y2KA 3GDIA 1H3QA 3T4TA 2XDMA 1CF0A 3M2KA 1YMSA 2ZL1A 4CLCA 1S66L 2O9AA 4ID4A 1JVJA 2EX2A 4IEDA 4CQHA 3VOYA 3OPPA 2I9VA 2PBYA 3MFXA 1YSQA 4NXGA 5GHYA 1FOFA 2H28A 5FEFA 1ERMA 1PIOA 4BD0A 4S2JA 1TDLA 3PBQA 4OLGA 1AWIA 1ZHHB 1XP4A 3W2ZA 5HWVA 2DNSA 1BYWA 1YKDA 3WS0A 1K4FA 3LI8A 4YFMA 2XF3A 3ZGAB 1JNUA 2ZOIA 4DJ3A 2K2NA 4B93A 1N9BA 4K91A 3NC8A 1T18A 3DAVA 3V5MA 2R78A 3D4FA 1DP9A 4JGQA 1KGFA 4Y5FA 5M19A 5F82A 2NUPC 1C3BA 2VEAA 4RA7A 5HD5A 1LL9A 5FSRA 3MFDA 4Y0OA 3A3IA 1E3UA 1BLHA 1NZOA 4CLCC 4FOFA 1SKOA 1SDEA 3EGXC 1N9NA 1XKZA 4EBNA 3NBLA 3PHYA 1PFLA 1T1CA 3FPVA 3G32A 1NWZA 3OZHA 2JKTI 1VQQA 2WKPA 4EEUA 3MF0A 5EVIB 4Q0HA 3LY3A 1K25A 4G3KA 3HLBA 4O0PA 1NZUA 1TS6A 2X02A 2XH9A 3QP4A 4K08A 3T12B 3VP0A 4JGPA 4ARZB 3E2LA 1FR1A 1RGYA 2XFSA 3HBRA 4B9OA 4WMCD 2ZC5B 3ZYTA 4R23A 5TBMB 4WMCA 1PWGA 5HW3A 2VGLM 3CAXA 2W1RA 4PMAA 4OOMA 2PR6A 5C5KA 3NOTC 5TFQA 2WK0A 1XPBA 4FSFA 5EUAA 4LV0A 4E3MA 1S1YA 3UN7A 1EI5A 5HAIA 1EW0A 2WGWB 3V50A 5HAQA 4Y2FA 1K57A 5DFXA 3SH8A 1LI9A 2JCHA 3V3SA 2J8YA 5CTNA 2Z6DA 1J9MA 3CPTB 4QD4A 4G3WA 5HPFA 3ZG9B 3ZCZA 2Q9NA 2VZWA 2BG1A 4MLLA 4DF6A 2IWBA 3CI6A 1NRJA 1BLCA 3C8CA 2ZOHA 3NHQA 4JGOA 3PYPA 1KOUA 3OPHA 1CK3A 3CMZA 1ESIA 1PW1A 2W27A 2Y2HA 4QB8A 1BUEA 5CX7A 4OVDA 1DRMA 3ZQ5A 2GX5A 4JKTA 2W3HA 2RCXA 1HD8A 4F3LA 3Q7VB 2ZQAA 3AGFA 4JXGA 1ZTUA 3KYZA 1RP5A 4OKPA 3IH9A 4PKYA 5AVEA 4P6ZS 2OAQ1 3O87A 3O86A 3WS1A 3T4OA 3NDGA 3DWKA 4KZ9A 2WGIA 4HESA 4JGRA 3NJAA 1LI0A 1KE3A 2PD8A 3G30A 2P9VA 3S7PA 3MS6A 2OLVA 1N9LA 4BWIA 3T4KA 4QJGA 1MC0A 3T50A 1JWVA 3UE1A 1TS8A 3NOUC 1PI4A 5HDSA 1YPRA 2JC7A 2WAFA 4I3AA 4LRXC 2V1AA 5HDCA 3L9KA 1BZAA 4CLCB 3IXDA 5CHUA 1OTEA 4H6JA 3S7NA 4DRTA 1NLYA 4GS9B 3EGDC 5DKLA 2ZD8A 4FH2A 2XA7M 5DFYA 1RGZA 4KQQA 1KE4A 4HP4A 1VEUA 3UE6A 5GLDA 1JWZA 1IYSA 2ZC6B 4Y7PA 4LCMA 2A2LA 4X6TA 3UB8A 5FQMA 3BFDA 1ACFA 3MMHA 2Z2LB 3KO6A 5EPHA 4IBXA 3M2JA 3MKEA 4MN5A 3GR2A 2J3TC 4O7DA 1K55C 3DW0A 3HUMA 3IHBA 3ZFZA 3I7JA 3ZG5A 3GQZA 4S2OA 4K0XA 3WS5A 5GLBA 1PZPA 1BLSA 2FZ0A 3BFFA 1IOUA 3OCNA 1QMFA 4GCZA 1FCOA 1IKIA 4X55A 4E3JA 3N7WA 5EVLA 3ITAA 2WKRA 1WYBA 3RFBA 3BFGA 1IYOA 4EQIA 3KYQA 2J7VA 4FTXA 3HLDA 2WKEA 4O8GA 4LGWA 3MQQA 5DTTA 4BD1A 1LT0A 3FKWA 1YQSA 5U47A 5EVID 3H82A 3EQUA 1VETB 2L0WA 3IT9A 1E25A 1OT6A 4KZ7A 3PTEA 3DTEA 4X69A 4YNRA 2V8FA 2LB9A 4JLFA 4LLOB 5HFOA 2MJ6A 4WL9A 2JBFA 4OPQA 3C7UA 1S6RA 3FKVA 5FA7A 4EW7A 4Y17A 5FQKA 3IXHA 1IELA 3E0YA 1W8YA 4KG2A 3LIEA 3NECA 5IT5A 2VX8A 1UGUA 5HL1A 2FFFB 4GDNA 2HDSA 2ACGA 1S1ZA 3UE0A 1AXBA 3F1PA 4KZ8A 5TR7A 3PBNA 3BEBA 3TOIA 3IBJA 3IXBA 2EXAA 1XJ2A 3BW6A 4WZ4A 3IS2A 2O99A 3IHAA 2ZBBA 2ZJ9A 4UQIM 1S0WA 2WYXA 3LFVA 2H0YA 2EX6A 2X01A 1MZUA 5FAOA 5BOHA 2EXBA 3BFCA 3FZCA 2FH5A 3T4SA 4P6BA 3EQVA 2EWWA 1W5DA 2Y4AA 4DE0A 5CTMA 4LV3A 3EWKA 4U3TA 5AQBA 3MKFA 1BTLA 2IWDA 2WADA 1IFQA 4WZ5A 3B47A 2O9CA 3MXRA 2QJ7A 5GLAA 4HBUA 4LCLA 2M7UA 4PM9A 3BWLA 5CECA 1K56D 4S2MA 1JTGA 4WELA 1W8QA 4FD8A 1YLYA 4KG5A 4BLMA 3LR3A 2G7UA 1I2WA 4LPZA 4OQIA 4UA6A 1GSWA 2FFYA 1PW8A 2RL3A 5A93A 3PBRA 2EX8A 3IX4A 1OJ5A 1TS7A 3IX3A 3DWZA 2QZ6A 3CG5A 5DTKA 4L9EA 3V3RA 2JHEA 1ZG6A 3G2ZA 5AJGA 3RXWA 5KZHA 2M1CA 5HAPA 1SDNA 3NDEA 2ZC7A 4MBHA 4HP9A 1DJBA 3MXQA 3LIAA 2ZLYA 4WM9A 4MMNA 4QU3A 3T4LA 2W3FA 2LB5A 1F5MA 1P9WA 5FQJA 4GNUA 4KZBA 2Y91A 5DTSA 3OPLA 4JXWA 1E4DA 1KGEA 4RX2A 4DDYA 4QHCA 2HGVA 2K31A 4GHIB 3PR6A 3VP4A 3SZTA 1F9IA 1YLJA 1W63M 3PBOA 3BRMA 1VHMA 3W4OA 5CRFA 5EV0A 3FG8A 3UY6A 1FCNA 2W0NA 4IJGA 1LHYA 4Z9QA 3S1YA 4I3IA 1G5UA 4KQDA 4C3QA 3R4KA 4P85A 3F1NB 1FCMA 5TGFA 2Q0OA 3BJNA 3CUEA 1ZG4A 1NJ4A 3IF6A 2I72A 4XXRA 2Y2MA 4EETB 3UE3A 2J80A 3OCLA 1WYCA 3LYXA 2M7VA 2PHYA 1Z6FA 2EWVA 3N4IA 4R70A 4GZBA 1I5QA 2Y8HA 3H7WA 2UV0E 2EFUA 4JF4A 3QP6A 3JVUA 1G28A 5HDDA 1ES4A 5G4ZA 1K4EA 3ZHHA 4PM5A 3ZG8B 1HTZA 4GB7A 4B4ZA 3PXPA 1UWPX 4GJ4A 4EUZA 4JPMA 4O01A 2HF6A 1K6SA 3DTMA 5FAPA 4XT2B 1U60A 1OPXA 1ERQA 4NXFA 4A5RA 2V1BA 5CXWA 5CEBA 2QJ5A 3G31A 4BENA 3LUQA 4EBLA 1K38A 3T1SA 5HWWA 1M6KA 2HP9A 4FH4A 3IBRA 2XLNA 1MWTA 3VP2A 1MBLA 2D01A 3VP3A 1JWPA 5FQQA 4BMWA 1XFQA 1XGJA 5DF8A 2BTFP 3IWIA 1F2KA 4E6WA 2PDRA 4P6ZM 4NETA 3OPRA 4UA7A 4KUOA 4UA9A 4P87A 1ALQA 1P0ZA 5FI7A 3QP1A 4EV4A 1DP6A 4R4SA 3M6HA 2V1ZA 3S22A 2WKHA 5AQ9A 2XQZA 1MY8A 2V20A 3C5AA 4OQHA 1XJ4A 2OV5A 4DN0A 2Y2PA 4OQ0A 4ME4A 4PM7A 2GJ3A 4KZAA 4NXBA 4CPKA 1TS0A 3BY8A 2OAP1 4IVIA 2Y2JA 5MC7A 3JPUA 1LL8A 2GDNA 1XGIA 5JYPA 4ZAMA 1K57C 1W63Q 1NRFA 4KG6A 4LRYC 2HDUA 3TE8A 3A3EA 4F94A 3E2KA 1H8ZA 5M18A 2JKRI 3IF5A 2B02A 4BQMA 5EECA 2JKTM 5FDHA 1O07A 4NXEA 2HP5A 1IYQA 4PHTA 1G6OA 2XROA 5IHVA 5CGSA 4DXCA 1ES2A 3RJUA 3WRZA 2ZQDA 2Y2LA 1KGGA 2L1MA 4DE1A 3ZNTA 5FDSA 1ZC2A 4Y15A 2IA2A 4BL3A 4X56A 5KIZA 1YM1A 1KDSA 3VE3A 3KSIA 4WLAA 4Q0JA 3CJMA 1XFNA 4RQ9A 3P01A 1G6AA 2W1TA 2ZQ8A 4KQOA 3VOZA 3UB6A 3VMAA 1OTBA 5F69A 3TRCA 2XSSA 4GKUA 3VFFA 1P97A 1S4RA 2ZC3B 3U2AA 2E8JA 4HIAA 5GHZA 4EEPA 3UO9A 5CERA 2ZL1B 2W3EA 4HJ4A 1X0OA 3HL9A 1YLWA 2BASA 2L4RA 1H0MA 1SHVA 1XX2A 2P08A 2JKGA 3T4QA 2ZQ9A 4DDSA 5F6AA 4S2KA 4QY5A 2OOLA 2V0WA 5IU1A 1SCWA 1A0KA 4Q8IA 3QP8A 2XK1A 1S4SA 2ZQCA 3MZDA 4YINA 3GECA 4DJ2A 2HDRA 5FQ9A 3RTYA 1WA9A 1DJCA 1SZVA 3IQAA 4L9FA 1MPLA 2CMNA 3PAGA 5GHXA 5I94A 3A0VA 1ESUA 3ZVTA 1ZKJA 1SKOB 5FI6A 4KQRA 1TDGA 1GCEA 3TJZC 1PNEA 4HBTA 4QY6A 3JVVA 3B3XA 3K3CA 3H7WB 2VK3A 3LEQA 2ZQ7A 1XJ3A 2E8IA 3S7QA 4U0TA 2A49A 4PKYG 3Q7ZA 2WAEA 4GW9A 2GNXA 4BBUA 5DVAA 2WZXA 3FYZA 3E4OA 1FQGA 5HD3A 3O5YA 3VV4A 4X68A 4MDZA 4DMZA 2Q9MA 5DF7A 3A3DA 2ZMVA 4N92A 2O9BA 3E4QA 1MWSA 1K54A 3CHWP 5KMWA 2DMWA 1OTIA 3ITBA 5EVIA 1HLUP 5E2EA 1Y54A 3BECA 3MR0A 2KLIA 5L10A 4CJNA 4ARZA 3HJKA 4U0XA 4JXVA 3C4PA 3DBAA 4MEZA 5DJUA 1YSPA 2Y59A 1L0GA 3UDXA 4WBGA 1HZOA 4R1GA 5TBMA 4LV2A 1W79A 5DJTA 3BY9A 3QNBA 3E4PA 3VE4A 1H8MA 5F83A 5HL6A 3UB5P 4XUZA 3AGEA 2WGWA 1YT4A 4IVKA 5K5BA 2WKIA 5L2FA 3RH8B 1TVFA 3ZG0A 4B4XA 4ESPA 3HLGA 2ZMFA 4NEED 3K3DA 4P0MA 4E3KA 3CPTA 1TEMA 3Q1FA 1V9YA 1L0EA 3Q82A 5EVIC 1PYYA 4JF6A 3BLMA 1Q2PA 2P74A 1IYPA 3GTCA 4NKPA 1FSWA 5FI2A 1T1BA 4BBTA 3C2WA 5TJJA 4F3LB 2OSUA 3UPPA 3VSKA 1XA1A 1FILA 4KZ3A 3BM6A 4DE2A 4X1MA 3OLOA 2WUQA 1F98A 4EUVA 1N4OA 3R7WA 2AVXA 2XRNA 4Y13A 5EFWA 4IBRA 3BLSA 1YMXA 3W4QA 3LIBA 3HLWA 4EERA 5F1FA 3KSFA 4JXSA 4I39A 4II7A 1K56A 3UMEA 1D7EA 5F5YA 3Q7VA 3ZVWA 1GHPA 2R9WA 2VGJA 3EOIA 2P9VB 2QYBA 1BULA 2VV8A 1IKGA 5E2FA 1RCJA 4HJ3A 1O7EA 5A8BA 4ETXA 4X1LA 4ZDXA 1W7FA 1NYMA 3V39A 3HLFA 4QWOA 2PT7A 4KZ6A 4I3JA 1L0DA 5FASA 3L7HA 4E04A 4EWFA 4N1XA 4H6JB 4M4XA 3PAEA 1MWUA 2H5SA 4BJPA 2HV1A 3GMWA 2C5WB 3VSLA 3A0RA 3Q07A 3V67A 5HZHA 1VEUB 4WZ5C 4DE3A 5L09A 4D60A 3TG9A 4HOIA 3MZFA 4CLCD 3SW1A 3NI9A 3S4XA 1STZA 4WEJA 1KE0A 2NUTC 3UDIA 3NIAA 4EQ1A 3DTIA 2A3UA 4S2NA 3KX0X 2XR0A 4GS9A 1NLZA 3Q81A 2P04A 2JN7A 3AGDA 3MQOA 4OP8A 4WF0A 2Y2QA 3LR0A 4Y3IA 2PYPA 4OOYA 3MBZA 3IXGA 1L3LA 1GSVA 3QP2A 4H8RA 2XEPA 1MKMA 3LIDA 1MKIA 2QKPA 2VV7A 1FSYA 3WWXA 4MN6A 1DJAA 2VKSA 5F68A 4LV1A 2Y2OA 3IWQA 3T1QB 2PYRA 2B5RA 1OTDA 2YKHA 3G35A 2JE5A 2QHKA 4OLDA 3SH9A 2HJ9C 3FPWA 1CJFA 1E3UD 1LLBA 1GHMA 4OOLA 1L0FA 4DXBA 4OP5A 5D3OA 2WGVA 3WRTA 3NCKA 2W3GA 1VB6A 4MCWA 3P09A 4CLCE 3N8RA 4S2NC 2H10A 1H8YA 5IS1A 1XA7A 3EEHA 2EFXA 3H82B 3ZDJA 4YWZA 3N6IA 2EA9A 5DF9A 2G2WA 3KYEA 3NY4A 4ZTKA 2XD5A 3MSHA 1PWCA 4OPRA 1MWRA 2G2UA 3UPNA 5HPIA 2B18A 2HPBA 4S2IA 4E3IA 4KENB 2X71A 1IEMA 5HWTA 3CUEC 3IF6C 3ZNYA 2A24A 1VETA 3D72A 5CGWA 1CI8A 3H9WA 4UHUA 1D06A 3LICA 2PU4A 2V8CA 3QNCA 4HI4A 5FQIA 2XFTA 2J9PA 3NOPC 2OLUA 2ZC4B 3GRJA 5CGXA 4C6YA 4RX3A 2C6WB 4PPRA 4B88A 2IWCA 4HHDA 3UNWA 2HZ5A 3G2YA 1NXYA 3LIFA 4OPZA 5EE8A 3F1PB 3TSGA 3T1RA 3WS4A 5G18A 3N8SA 3FV7A 1EROA 4IUHA 4N9KA 4GOGA 1GSXA 1Y4OA 2B95A 3A0SA 2Y2GA 1VM1A 1XJ6A 3IS2B 3UMDA 4KZ5A 4MBFA 5AQ7A 3P98A 5HARA 1PWDA 4EU0A 5CHJA 1CEFA 4N1HA 3UDFA 1JTDA 3HLEA 3SS5A 3S7OA 2QWSA 3VOLA 3O88A 4GN2A 2K7SA 2VGLS 2BLSA 1CQAA 3ZG7B 3R7WB 4HJ6A 4R3BA 4M3KA 4ZBEA 3SS3A 4DKIA 2GZAA 5GLCA 5M1AA 3TW8A 1YLTA 3HCYA 4NG2A 5CEDA 4WYYA 3FWLA 3SH7A 4E6XA 3G34A 4MBKA 2HDQA 3PBTA 2J9OA 3D3OA 2ZMAA 1H5XA 1PZOA 1ONHA 2KX6A 4LENA 1KVMA 4HNBA 2V2FF 2YKFA 4R3AA 4ZRRA 2KOIA 3PBSA 3T4JA 3HUNA 1YLPA 5FEGA 4HH2A 1GA0A 3MXSA 2ZM2A 3HVFA 1DP8A 5LBRA 2Y79A 4R4RA 3ULFA 1T1AA 4G3VA 4EBPA 4AFIA 1BLPA 3LO7A 5J8XA 2J3TD 4L0LA 5HSQA 4Q0IA 2Z6CA 1XXMA 3C7VA 4IHQA 3SS4A 4JF5A 1K55A 4R0QA 2Z2MB 4QPRA 5E43A 4S2LA 1CI9A 3F1OA 5E2HA 1I2SA 5EM0A 1UWNX 1EWZA 4X53A 3IH8A 3ISGA 4Y0TA 1M40A 4EESA 4RVAA 2R9XA 3E98A 3CWFA 2VJWA 5FL3A 4I38A 4PM8A 2OWHA 3CITA 3C38A 4UAAA 3LI9A 1KDWA 2UWXA 1TF1A 3HREA 2VGKA 4LRZE 4YOFA 1HVBA 1V9ZA 4GHIA 2VV6A 2W3DA 3OBFA 4ZJ3A 3MJQA 2PAVP 3ICYA 1Z09A 4BBVA 4WUJA
chains in the Genus database with same CATH topology
1D1JA 1VEUA 1G5UA 2E8JA 2PRFA 3U4LP 1VETA 2V8FA 2ZL1B 3T1XA 5EVEA 2JKFA 1FILA 4X1MA 5FEGA 3T12B 3CHWP 1CF0A 2JKGA 2V8CA 1HLUP 2ZL1A 1ACFA 5EM1A 3NULA 3NECA 2HZ5A 1A0KA 1J3WA 3T1RA 5FEFA 3T1QB 1Y4OA 2B95A 2ACGA 1FIKA 4X25A 1AWIA 1CJFA 5EM0A 4X1LA 4QWOA 3D9YA 3UB5P 3MS6A 1SZVA 3DAVA 3L7HA 3CPTB 5FDSA 3T1SA 1K0KA 1YPRA 4FTXA 1CQAA 2PBDP 1SKOB 4ESPA 3LGOA 3KYEA 1PRQA 3L9KA 1PNEA 3CPTA 1VEUB 5EV0A 3MSHA 2VK3A 4D60A 3LEQA 1VETB 2BTFP 1SKOA 1F2KA 2PAVP 4FUWA 1Z09A 1PFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1J A;  1VEU A;  1G5U A;  2E8J A;  2PRF A;  3U4L P;  1VET A;  2V8F A;  2ZL1 B;  3T1X A;  5EVE A;  2JKF A;  1FIL A;  4X1M A;  5FEG A;  3T12 B;  3CHW P;  1CF0 A;  2JKG A;  2V8C A;  1HLU P;  2ZL1 A;  1ACF A;  5EM1 A;  3NUL A;  3NEC A;  2HZ5 A;  1A0K A;  1J3W A;  3T1R A;  5FEF A;  3T1Q B;  1Y4O A;  2B95 A;  2ACG A;  1FIK A;  4X25 A;  1AWI A;  1CJF A;  5EM0 A;  4X1L A;  4QWO A;  3D9Y A;  3UB5 P;  3MS6 A;  1SZV A;  3DAV A;  3L7H A;  3CPT B;  5FDS A;  3T1S A;  1K0K A;  1YPR A;  4FTX A;  1CQA A;  2PBD P;  1SKO B;  4ESP A;  3LGO A;  3KYE A;  1PRQ A;  3L9K A;  1PNE A;  3CPT A;  1VEU B;  5EV0 A;  3MSH A;  2VK3 A;  4D60 A;  3LEQ A;  1VET B;  2BTF P;  1SKO A;  1F2K A;  2PAV P;  4FUW A;  1Z09 A;  1PFL A; 
#chains in the Genus database with same CATH topology
 3IF6 B;  2KDK A;  3FC7 A;  1G68 A;  1ES5 A;  3W4P A;  1NYY A;  1MXO A;  2JKR M;  3CLO A;  2XGN A;  3G6O A;  4OON A;  4D2O A;  1K6R A;  3BQ8 A;  3LEZ A;  4NK3 A;  3SOI A;  1N9O A;  1ES3 A;  3F1N A;  4HH3 A;  3K2N A;  5EM1 A;  2EX9 A;  1Y28 A;  3NUL A;  5KSC A;  3BFE A;  5FAT A;  1DY6 A;  5A90 A;  3M6B A;  2XA7 S;  2XD1 A;  4I5S A;  2D02 A;  3LY4 A;  4E3L A;  5EOE A;  1NY0 A;  4GD6 A;  3LR4 A;  5EOO A;  4OH0 A;  3CZD A;  2CC1 A;  2H0T A;  1FIK A;  2J3W A;  4X25 A;  4EXO A;  4GDB A;  4R6L A;  2VLG A;  1KVL A;  4UEY A;  2QPN A;  5JYO A;  5L8M A;  4XUX A;  5I5L A;  2INW A;  4Z1W A;  4WN5 A;  2A24 B;  4LFU A;  5DKK A;  2PU2 A;  4XT2 A;  3HJI A;  2PBD P;  5F1G A;  3LR5 A;  3C4O A;  3LGO A;  4PM6 A;  3B42 A;  3UPO A;  1SKF A;  1P9R A;  3UB9 A;  5KSH A;  1PRQ A;  3P7N A;  2HP6 A;  5A92 A;  5A91 A;  4E3O A;  2P7J A;  3MZE A;  1OT9 A;  4N9L A;  3VP1 A;  3GV9 A;  5G4Y A;  3A3J A;  4ZJ1 A;  3QHY A;  4S2P A;  3LCE A;  1WE4 A;  2VA0 A;  3RXX A;  1Q2Q A;  1QME A;  4OPY A;  4ZJ2 A;  1BT5 A;  2PRF A;  5J4E A;  1PI5 A;  3QP5 A;  1S67 L;  2OWJ A;  4BL2 A;  2ZM0 A;  3HLC A;  4L9G A;  3T1X A;  1K54 C;  2PR5 A;  3DTK A;  4R38 A;  1FR6 A;  5GL9 A;  2V0U A;  4E3N A;  5FAQ A;  3MQ0 A;  1TD5 A;  4JBF A;  5J7E A;  2Y55 A;  3GSG A;  4OQG A;  4RYE A;  5J3W A;  2DCF A;  4R3J A;  2PD7 A;  5AVF A;  4ETZ A;  1GA9 A;  1J3W A;  2O0Y A;  4K0W A;  1T19 A;  3KSG A;  3EEA A;  4WEK A;  1CEG A;  1OME A;  3O3V A;  2V9A A;  1YLZ A;  4Y0U A;  4PAU A;  4IUK A;  3KSH A;  3A3F A;  4FCF A;  2Y2I A;  4MN7 A;  5E2G A;  3OC2 A;  2HJE A;  3IWO A;  1LL5 A;  4HQA A;  2WKQ A;  3D9Y A;  3HUO A;  3BQA A;  4KUK A;  3BYD A;  2W1T B;  3G4P A;  1OTA A;  1L2S A;  1K0K A;  4KZ4 A;  2WZZ A;  2DRW A;  1OJG A;  3B33 A;  5CHM A;  4GLQ A;  3GVB A;  3UB7 A;  3OOV A;  3VFH A;  3C30 A;  4MNR A;  2Y2N A;  2QMI A;  3WS2 A;  4FUW A;  1LSW A;  1YAX A;  1LSV A;  5HX9 A;  1D1J A;  1LSX A;  5L07 A;  4C75 A;  4HEF A;  3N8L A;  3U4L P;  1ONG A;  3IX8 A;  1GHI A;  4UQI S;  5AQA A;  3JYI A;  5EVE A;  3W8K A;  1BSG A;  1ODV A;  3F1O B;  2JKF A;  4GD8 A;  4HY8 A;  2ZM8 A;  2Y2K A;  3GDI A;  1H3Q A;  3T4T A;  2XDM A;  1CF0 A;  3M2K A;  1YMS A;  2ZL1 A;  4CLC A;  1S66 L;  2O9A A;  4ID4 A;  1JVJ A;  2EX2 A;  4IED A;  4CQH A;  3VOY A;  3OPP A;  2I9V A;  2PBY A;  3MFX A;  1YSQ A;  4NXG A;  5GHY A;  1FOF A;  2H28 A;  5FEF A;  1ERM A;  1PIO A;  4BD0 A;  4S2J A;  1TDL A;  3PBQ A;  4OLG A;  1AWI A;  1ZHH B;  1XP4 A;  3W2Z A;  5HWV A;  2DNS A;  1BYW A;  1YKD A;  3WS0 A;  1K4F A;  3LI8 A;  4YFM A;  2XF3 A;  3ZGA B;  1JNU A;  2ZOI A;  4DJ3 A;  2K2N A;  4B93 A;  1N9B A;  4K91 A;  3NC8 A;  1T18 A;  3DAV A;  3V5M A;  2R78 A;  3D4F A;  1DP9 A;  4JGQ A;  1KGF A;  4Y5F A;  5M19 A;  5F82 A;  2NUP C;  1C3B A;  2VEA A;  4RA7 A;  5HD5 A;  1LL9 A;  5FSR A;  3MFD A;  4Y0O A;  3A3I A;  1E3U A;  1BLH A;  1NZO A;  4CLC C;  4FOF A;  1SKO A;  1SDE A;  3EGX C;  1N9N A;  1XKZ A;  4EBN A;  3NBL A;  3PHY A;  1PFL A;  1T1C A;  3FPV A;  3G32 A;  1NWZ A;  3OZH A;  2JKT I;  1VQQ A;  2WKP A;  4EEU A;  3MF0 A;  5EVI B;  4Q0H A;  3LY3 A;  1K25 A;  4G3K A;  3HLB A;  4O0P A;  1NZU A;  1TS6 A;  2X02 A;  2XH9 A;  3QP4 A;  4K08 A;  3T12 B;  3VP0 A;  4JGP A;  4ARZ B;  3E2L A;  1FR1 A;  1RGY A;  2XFS A;  3HBR A;  4B9O A;  4WMC D;  2ZC5 B;  3ZYT A;  4R23 A;  5TBM B;  4WMC A;  1PWG A;  5HW3 A;  2VGL M;  3CAX A;  2W1R A;  4PMA A;  4OOM A;  2PR6 A;  5C5K A;  3NOT C;  5TFQ A;  2WK0 A;  1XPB A;  4FSF A;  5EUA A;  4LV0 A;  4E3M A;  1S1Y A;  3UN7 A;  1EI5 A;  5HAI A;  1EW0 A;  2WGW B;  3V50 A;  5HAQ A;  4Y2F A;  1K57 A;  5DFX A;  3SH8 A;  1LI9 A;  2JCH A;  3V3S A;  2J8Y A;  5CTN A;  2Z6D A;  1J9M A;  3CPT B;  4QD4 A;  4G3W A;  5HPF A;  3ZG9 B;  3ZCZ A;  2Q9N A;  2VZW A;  2BG1 A;  4MLL A;  4DF6 A;  2IWB A;  3CI6 A;  1NRJ A;  1BLC A;  3C8C A;  2ZOH A;  3NHQ A;  4JGO A;  3PYP A;  1KOU A;  3OPH A;  1CK3 A;  3CMZ A;  1ESI A;  1PW1 A;  2W27 A;  2Y2H A;  4QB8 A;  1BUE A;  5CX7 A;  4OVD A;  1DRM A;  3ZQ5 A;  2GX5 A;  4JKT A;  2W3H A;  2RCX A;  1HD8 A;  4F3L A;  3Q7V B;  2ZQA A;  3AGF A;  4JXG A;  1ZTU A;  3KYZ A;  1RP5 A;  4OKP A;  3IH9 A;  4PKY A;  5AVE A;  4P6Z S;  2OAQ 1;  3O87 A;  3O86 A;  3WS1 A;  3T4O A;  3NDG A;  3DWK A;  4KZ9 A;  2WGI A;  4HES A;  4JGR A;  3NJA A;  1LI0 A;  1KE3 A;  2PD8 A;  3G30 A;  2P9V A;  3S7P A;  3MS6 A;  2OLV A;  1N9L A;  4BWI A;  3T4K A;  4QJG A;  1MC0 A;  3T50 A;  1JWV A;  3UE1 A;  1TS8 A;  3NOU C;  1PI4 A;  5HDS A;  1YPR A;  2JC7 A;  2WAF A;  4I3A A;  4LRX C;  2V1A A;  5HDC A;  3L9K A;  1BZA A;  4CLC B;  3IXD A;  5CHU A;  1OTE A;  4H6J A;  3S7N A;  4DRT A;  1NLY A;  4GS9 B;  3EGD C;  5DKL A;  2ZD8 A;  4FH2 A;  2XA7 M;  5DFY A;  1RGZ A;  4KQQ A;  1KE4 A;  4HP4 A;  1VEU A;  3UE6 A;  5GLD A;  1JWZ A;  1IYS A;  2ZC6 B;  4Y7P A;  4LCM A;  2A2L A;  4X6T A;  3UB8 A;  5FQM A;  3BFD A;  1ACF A;  3MMH A;  2Z2L B;  3KO6 A;  5EPH A;  4IBX A;  3M2J A;  3MKE A;  4MN5 A;  3GR2 A;  2J3T C;  4O7D A;  1K55 C;  3DW0 A;  3HUM A;  3IHB A;  3ZFZ A;  3I7J A;  3ZG5 A;  3GQZ A;  4S2O A;  4K0X A;  3WS5 A;  5GLB A;  1PZP A;  1BLS A;  2FZ0 A;  3BFF A;  1IOU A;  3OCN A;  1QMF A;  4GCZ A;  1FCO A;  1IKI A;  4X55 A;  4E3J A;  3N7W A;  5EVL A;  3ITA A;  2WKR A;  1WYB A;  3RFB A;  3BFG A;  1IYO A;  4EQI A;  3KYQ A;  2J7V A;  4FTX A;  3HLD A;  2WKE A;  4O8G A;  4LGW A;  3MQQ A;  5DTT A;  4BD1 A;  1LT0 A;  3FKW A;  1YQS A;  5U47 A;  5EVI D;  3H82 A;  3EQU A;  1VET B;  2L0W A;  3IT9 A;  1E25 A;  1OT6 A;  4KZ7 A;  3PTE A;  3DTE A;  4X69 A;  4YNR A;  2V8F A;  2LB9 A;  4JLF A;  4LLO B;  5HFO A;  2MJ6 A;  4WL9 A;  2JBF A;  4OPQ A;  3C7U A;  1S6R A;  3FKV A;  5FA7 A;  4EW7 A;  4Y17 A;  5FQK A;  3IXH A;  1IEL A;  3E0Y A;  1W8Y A;  4KG2 A;  3LIE A;  3NEC A;  5IT5 A;  2VX8 A;  1UGU A;  5HL1 A;  2FFF B;  4GDN A;  2HDS A;  2ACG A;  1S1Z A;  3UE0 A;  1AXB A;  3F1P A;  4KZ8 A;  5TR7 A;  3PBN A;  3BEB A;  3TOI A;  3IBJ A;  3IXB A;  2EXA A;  1XJ2 A;  3BW6 A;  4WZ4 A;  3IS2 A;  2O99 A;  3IHA A;  2ZBB A;  2ZJ9 A;  4UQI M;  1S0W A;  2WYX A;  3LFV A;  2H0Y A;  2EX6 A;  2X01 A;  1MZU A;  5FAO A;  5BOH A;  2EXB A;  3BFC A;  3FZC A;  2FH5 A;  3T4S A;  4P6B A;  3EQV A;  2EWW A;  1W5D A;  2Y4A A;  4DE0 A;  5CTM A;  4LV3 A;  3EWK A;  4U3T A;  5AQB A;  3MKF A;  1BTL A;  2IWD A;  2WAD A;  1IFQ A;  4WZ5 A;  3B47 A;  2O9C A;  3MXR A;  2QJ7 A;  5GLA A;  4HBU A;  4LCL A;  2M7U A;  4PM9 A;  3BWL A;  5CEC A;  1K56 D;  4S2M A;  1JTG A;  4WEL A;  1W8Q A;  4FD8 A;  1YLY A;  4KG5 A;  4BLM A;  3LR3 A;  2G7U A;  1I2W A;  4LPZ A;  4OQI A;  4UA6 A;  1GSW A;  2FFY A;  1PW8 A;  2RL3 A;  5A93 A;  3PBR A;  2EX8 A;  3IX4 A;  1OJ5 A;  1TS7 A;  3IX3 A;  3DWZ A;  2QZ6 A;  3CG5 A;  5DTK A;  4L9E A;  3V3R A;  2JHE A;  1ZG6 A;  3G2Z A;  5AJG A;  3RXW A;  5KZH A;  2M1C A;  5HAP A;  1SDN A;  3NDE A;  2ZC7 A;  4MBH A;  4HP9 A;  1DJB A;  3MXQ A;  3LIA A;  2ZLY A;  4WM9 A;  4MMN A;  4QU3 A;  3T4L A;  2W3F A;  2LB5 A;  1F5M A;  1P9W A;  5FQJ A;  4GNU A;  4KZB A;  2Y91 A;  5DTS A;  3OPL A;  4JXW A;  1E4D A;  1KGE A;  4RX2 A;  4DDY A;  4QHC A;  2HGV A;  2K31 A;  4GHI B;  3PR6 A;  3VP4 A;  3SZT A;  1F9I A;  1YLJ A;  1W63 M;  3PBO A;  3BRM A;  1VHM A;  3W4O A;  5CRF A;  5EV0 A;  3FG8 A;  3UY6 A;  1FCN A;  2W0N A;  4IJG A;  1LHY A;  4Z9Q A;  3S1Y A;  4I3I A;  1G5U A;  4KQD A;  4C3Q A;  3R4K A;  4P85 A;  3F1N B;  1FCM A;  5TGF A;  2Q0O A;  3BJN A;  3CUE A;  1ZG4 A;  1NJ4 A;  3IF6 A;  2I72 A;  4XXR A;  2Y2M A;  4EET B;  3UE3 A;  2J80 A;  3OCL A;  1WYC A;  3LYX A;  2M7V A;  2PHY A;  1Z6F A;  2EWV A;  3N4I A;  4R70 A;  4GZB A;  1I5Q A;  2Y8H A;  3H7W A;  2UV0 E;  2EFU A;  4JF4 A;  3QP6 A;  3JVU A;  1G28 A;  5HDD A;  1ES4 A;  5G4Z A;  1K4E A;  3ZHH A;  4PM5 A;  3ZG8 B;  1HTZ A;  4GB7 A;  4B4Z A;  3PXP A;  1UWP X;  4GJ4 A;  4EUZ A;  4JPM A;  4O01 A;  2HF6 A;  1K6S A;  3DTM A;  5FAP A;  4XT2 B;  1U60 A;  1OPX A;  1ERQ A;  4NXF A;  4A5R A;  2V1B A;  5CXW A;  5CEB A;  2QJ5 A;  3G31 A;  4BEN A;  3LUQ A;  4EBL A;  1K38 A;  3T1S A;  5HWW A;  1M6K A;  2HP9 A;  4FH4 A;  3IBR A;  2XLN A;  1MWT A;  3VP2 A;  1MBL A;  2D01 A;  3VP3 A;  1JWP A;  5FQQ A;  4BMW A;  1XFQ A;  1XGJ A;  5DF8 A;  2BTF P;  3IWI A;  1F2K A;  4E6W A;  2PDR A;  4P6Z M;  4NET A;  3OPR A;  4UA7 A;  4KUO A;  4UA9 A;  4P87 A;  1ALQ A;  1P0Z A;  5FI7 A;  3QP1 A;  4EV4 A;  1DP6 A;  4R4S A;  3M6H A;  2V1Z A;  3S22 A;  2WKH A;  5AQ9 A;  2XQZ A;  1MY8 A;  2V20 A;  3C5A A;  4OQH A;  1XJ4 A;  2OV5 A;  4DN0 A;  2Y2P A;  4OQ0 A;  4ME4 A;  4PM7 A;  2GJ3 A;  4KZA A;  4NXB A;  4CPK A;  1TS0 A;  3BY8 A;  2OAP 1;  4IVI A;  2Y2J A;  5MC7 A;  3JPU A;  1LL8 A;  2GDN A;  1XGI A;  5JYP A;  4ZAM A;  1K57 C;  1W63 Q;  1NRF A;  4KG6 A;  4LRY C;  2HDU A;  3TE8 A;  3A3E A;  4F94 A;  3E2K A;  1H8Z A;  5M18 A;  2JKR I;  3IF5 A;  2B02 A;  4BQM A;  5EEC A;  2JKT M;  5FDH A;  1O07 A;  4NXE A;  2HP5 A;  1IYQ A;  4PHT A;  1G6O A;  2XRO A;  5IHV A;  5CGS A;  4DXC A;  1ES2 A;  3RJU A;  3WRZ A;  2ZQD A;  2Y2L A;  1KGG A;  2L1M A;  4DE1 A;  3ZNT A;  5FDS A;  1ZC2 A;  4Y15 A;  2IA2 A;  4BL3 A;  4X56 A;  5KIZ A;  1YM1 A;  1KDS A;  3VE3 A;  3KSI A;  4WLA A;  4Q0J A;  3CJM A;  1XFN A;  4RQ9 A;  3P01 A;  1G6A A;  2W1T A;  2ZQ8 A;  4KQO A;  3VOZ A;  3UB6 A;  3VMA A;  1OTB A;  5F69 A;  3TRC A;  2XSS A;  4GKU A;  3VFF A;  1P97 A;  1S4R A;  2ZC3 B;  3U2A A;  2E8J A;  4HIA A;  5GHZ A;  4EEP A;  3UO9 A;  5CER A;  2ZL1 B;  2W3E A;  4HJ4 A;  1X0O A;  3HL9 A;  1YLW A;  2BAS A;  2L4R A;  1H0M A;  1SHV A;  1XX2 A;  2P08 A;  2JKG A;  3T4Q A;  2ZQ9 A;  4DDS A;  5F6A A;  4S2K A;  4QY5 A;  2OOL A;  2V0W A;  5IU1 A;  1SCW A;  1A0K A;  4Q8I A;  3QP8 A;  2XK1 A;  1S4S A;  2ZQC A;  3MZD A;  4YIN A;  3GEC A;  4DJ2 A;  2HDR A;  5FQ9 A;  3RTY A;  1WA9 A;  1DJC A;  1SZV A;  3IQA A;  4L9F A;  1MPL A;  2CMN A;  3PAG A;  5GHX A;  5I94 A;  3A0V A;  1ESU A;  3ZVT A;  1ZKJ A;  1SKO B;  5FI6 A;  4KQR A;  1TDG A;  1GCE A;  3TJZ C;  1PNE A;  4HBT A;  4QY6 A;  3JVV A;  3B3X A;  3K3C A;  3H7W B;  2VK3 A;  3LEQ A;  2ZQ7 A;  1XJ3 A;  2E8I A;  3S7Q A;  4U0T A;  2A49 A;  4PKY G;  3Q7Z A;  2WAE A;  4GW9 A;  2GNX A;  4BBU A;  5DVA A;  2WZX A;  3FYZ A;  3E4O A;  1FQG A;  5HD3 A;  3O5Y A;  3VV4 A;  4X68 A;  4MDZ A;  4DMZ A;  2Q9M A;  5DF7 A;  3A3D A;  2ZMV A;  4N92 A;  2O9B A;  3E4Q A;  1MWS A;  1K54 A;  3CHW P;  5KMW A;  2DMW A;  1OTI A;  3ITB A;  5EVI A;  1HLU P;  5E2E A;  1Y54 A;  3BEC A;  3MR0 A;  2KLI A;  5L10 A;  4CJN A;  4ARZ A;  3HJK A;  4U0X A;  4JXV A;  3C4P A;  3DBA A;  4MEZ A;  5DJU A;  1YSP A;  2Y59 A;  1L0G A;  3UDX A;  4WBG A;  1HZO A;  4R1G A;  5TBM A;  4LV2 A;  1W79 A;  5DJT A;  3BY9 A;  3QNB A;  3E4P A;  3VE4 A;  1H8M A;  5F83 A;  5HL6 A;  3UB5 P;  4XUZ A;  3AGE A;  2WGW A;  1YT4 A;  4IVK A;  5K5B A;  2WKI A;  5L2F A;  3RH8 B;  1TVF A;  3ZG0 A;  4B4X A;  4ESP A;  3HLG A;  2ZMF A;  4NEE D;  3K3D A;  4P0M A;  4E3K A;  3CPT A;  1TEM A;  3Q1F A;  1V9Y A;  1L0E A;  3Q82 A;  5EVI C;  1PYY A;  4JF6 A;  3BLM A;  1Q2P A;  2P74 A;  1IYP A;  3GTC A;  4NKP A;  1FSW A;  5FI2 A;  1T1B A;  4BBT A;  3C2W A;  5TJJ A;  4F3L B;  2OSU A;  3UPP A;  3VSK A;  1XA1 A;  1FIL A;  4KZ3 A;  3BM6 A;  4DE2 A;  4X1M A;  3OLO A;  2WUQ A;  1F98 A;  4EUV A;  1N4O A;  3R7W A;  2AVX A;  2XRN A;  4Y13 A;  5EFW A;  4IBR A;  3BLS A;  1YMX A;  3W4Q A;  3LIB A;  3HLW A;  4EER A;  5F1F A;  3KSF A;  4JXS A;  4I39 A;  4II7 A;  1K56 A;  3UME A;  1D7E A;  5F5Y A;  3Q7V A;  3ZVW A;  1GHP A;  2R9W A;  2VGJ A;  3EOI A;  2P9V B;  2QYB A;  1BUL A;  2VV8 A;  1IKG A;  5E2F A;  1RCJ A;  4HJ3 A;  1O7E A;  5A8B A;  4ETX A;  4X1L A;  4ZDX A;  1W7F A;  1NYM A;  3V39 A;  3HLF A;  4QWO A;  2PT7 A;  4KZ6 A;  4I3J A;  1L0D A;  5FAS A;  3L7H A;  4E04 A;  4EWF A;  4N1X A;  4H6J B;  4M4X A;  3PAE A;  1MWU A;  2H5S A;  4BJP A;  2HV1 A;  3GMW A;  2C5W B;  3VSL A;  3A0R A;  3Q07 A;  3V67 A;  5HZH A;  1VEU B;  4WZ5 C;  4DE3 A;  5L09 A;  4D60 A;  3TG9 A;  4HOI A;  3MZF A;  4CLC D;  3SW1 A;  3NI9 A;  3S4X A;  1STZ A;  4WEJ A;  1KE0 A;  2NUT C;  3UDI A;  3NIA A;  4EQ1 A;  3DTI A;  2A3U A;  4S2N A;  3KX0 X;  2XR0 A;  4GS9 A;  1NLZ A;  3Q81 A;  2P04 A;  2JN7 A;  3AGD A;  3MQO A;  4OP8 A;  4WF0 A;  2Y2Q A;  3LR0 A;  4Y3I A;  2PYP A;  4OOY A;  3MBZ A;  3IXG A;  1L3L A;  1GSV A;  3QP2 A;  4H8R A;  2XEP A;  1MKM A;  3LID A;  1MKI A;  2QKP A;  2VV7 A;  1FSY A;  3WWX A;  4MN6 A;  1DJA A;  2VKS A;  5F68 A;  4LV1 A;  2Y2O A;  3IWQ A;  3T1Q B;  2PYR A;  2B5R A;  1OTD A;  2YKH A;  3G35 A;  2JE5 A;  2QHK A;  4OLD A;  3SH9 A;  2HJ9 C;  3FPW A;  1CJF A;  1E3U D;  1LLB A;  1GHM A;  4OOL A;  1L0F A;  4DXB A;  4OP5 A;  5D3O A;  2WGV A;  3WRT A;  3NCK A;  2W3G A;  1VB6 A;  4MCW A;  3P09 A;  4CLC E;  3N8R A;  4S2N C;  2H10 A;  1H8Y A;  5IS1 A;  1XA7 A;  3EEH A;  2EFX A;  3H82 B;  3ZDJ A;  4YWZ A;  3N6I A;  2EA9 A;  5DF9 A;  2G2W A;  3KYE A;  3NY4 A;  4ZTK A;  2XD5 A;  3MSH A;  1PWC A;  4OPR A;  1MWR A;  2G2U A;  3UPN A;  5HPI A;  2B18 A;  2HPB A;  4S2I A;  4E3I A;  4KEN B;  2X71 A;  1IEM A;  5HWT A;  3CUE C;  3IF6 C;  3ZNY A;  2A24 A;  1VET A;  3D72 A;  5CGW A;  1CI8 A;  3H9W A;  4UHU A;  1D06 A;  3LIC A;  2PU4 A;  2V8C A;  3QNC A;  4HI4 A;  5FQI A;  2XFT A;  2J9P A;  3NOP C;  2OLU A;  2ZC4 B;  3GRJ A;  5CGX A;  4C6Y A;  4RX3 A;  2C6W B;  4PPR A;  4B88 A;  2IWC A;  4HHD A;  3UNW A;  2HZ5 A;  3G2Y A;  1NXY A;  3LIF A;  4OPZ A;  5EE8 A;  3F1P B;  3TSG A;  3T1R A;  3WS4 A;  5G18 A;  3N8S A;  3FV7 A;  1ERO A;  4IUH A;  4N9K A;  4GOG A;  1GSX A;  1Y4O A;  2B95 A;  3A0S A;  2Y2G A;  1VM1 A;  1XJ6 A;  3IS2 B;  3UMD A;  4KZ5 A;  4MBF A;  5AQ7 A;  3P98 A;  5HAR A;  1PWD A;  4EU0 A;  5CHJ A;  1CEF A;  4N1H A;  3UDF A;  1JTD A;  3HLE A;  3SS5 A;  3S7O A;  2QWS A;  3VOL A;  3O88 A;  4GN2 A;  2K7S A;  2VGL S;  2BLS A;  1CQA A;  3ZG7 B;  3R7W B;  4HJ6 A;  4R3B A;  4M3K A;  4ZBE A;  3SS3 A;  4DKI A;  2GZA A;  5GLC A;  5M1A A;  3TW8 A;  1YLT A;  3HCY A;  4NG2 A;  5CED A;  4WYY A;  3FWL A;  3SH7 A;  4E6X A;  3G34 A;  4MBK A;  2HDQ A;  3PBT A;  2J9O A;  3D3O A;  2ZMA A;  1H5X A;  1PZO A;  1ONH A;  2KX6 A;  4LEN A;  1KVM A;  4HNB A;  2V2F F;  2YKF A;  4R3A A;  4ZRR A;  2KOI A;  3PBS A;  3T4J A;  3HUN A;  1YLP A;  5FEG A;  4HH2 A;  1GA0 A;  3MXS A;  2ZM2 A;  3HVF A;  1DP8 A;  5LBR A;  2Y79 A;  4R4R A;  3ULF A;  1T1A A;  4G3V A;  4EBP A;  4AFI A;  1BLP A;  3LO7 A;  5J8X A;  2J3T D;  4L0L A;  5HSQ A;  4Q0I A;  2Z6C A;  1XXM A;  3C7V A;  4IHQ A;  3SS4 A;  4JF5 A;  1K55 A;  4R0Q A;  2Z2M B;  4QPR A;  5E43 A;  4S2L A;  1CI9 A;  3F1O A;  5E2H A;  1I2S A;  5EM0 A;  1UWN X;  1EWZ A;  4X53 A;  3IH8 A;  3ISG A;  4Y0T A;  1M40 A;  4EES A;  4RVA A;  2R9X A;  3E98 A;  3CWF A;  2VJW A;  5FL3 A;  4I38 A;  4PM8 A;  2OWH A;  3CIT A;  3C38 A;  4UAA A;  3LI9 A;  1KDW A;  2UWX A;  1TF1 A;  3HRE A;  2VGK A;  4LRZ E;  4YOF A;  1HVB A;  1V9Z A;  4GHI A;  2VV6 A;  2W3D A;  3OBF A;  4ZJ3 A;  3MJQ A;  2PAV P;  3ICY A;  1Z09 A;  4BBV A;  4WUJ A; 
#chains in the Genus database with same CATH homology
 1D1J A;  1VEU A;  1G5U A;  2E8J A;  2PRF A;  3U4L P;  1VET A;  2V8F A;  2ZL1 B;  3T1X A;  5EVE A;  2JKF A;  1FIL A;  4X1M A;  5FEG A;  3T12 B;  3CHW P;  1CF0 A;  2JKG A;  2V8C A;  1HLU P;  2ZL1 A;  1ACF A;  5EM1 A;  3NUL A;  3NEC A;  2HZ5 A;  1A0K A;  1J3W A;  3T1R A;  5FEF A;  3T1Q B;  1Y4O A;  2B95 A;  2ACG A;  1FIK A;  4X25 A;  1AWI A;  1CJF A;  5EM0 A;  4X1L A;  4QWO A;  3D9Y A;  3UB5 P;  3MS6 A;  1SZV A;  3DAV A;  3L7H A;  3CPT B;  5FDS A;  3T1S A;  1K0K A;  1YPR A;  4FTX A;  1CQA A;  2PBD P;  1SKO B;  4ESP A;  3LGO A;  3KYE A;  1PRQ A;  3L9K A;  1PNE A;  3CPT A;  1VEU B;  5EV0 A;  3MSH A;  2VK3 A;  4D60 A;  3LEQ A;  1VET B;  2BTF P;  1SKO A;  1F2K A;  2PAV P;  4FUW A;  1Z09 A;  1PFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...