5EM0A

Crystal structure of mugwort allergen art v 4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
133
Chain Sequence
SGSWQTYVDDHLMDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEIDAIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTGQAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Artemisia vulgaris
molecule tags Allergen
molecule keywords Pollen allergen Art v 4.01
total genus 35
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5em0A00
3KYEA 1VETB 1Y4OA 1D1JA 3CPTA 4X1MA 1PNEA 1SZVA 3T1RA 2V8FA 2ZL1A 3NULA 4FTXA 5EVEA 5FEFA 3T1SA 3T12B 3DAVA 3T1QB 3D9YA 1G5UA 1VETA 1CF0A 4QWOA 1AWIA 3NECA 1PRQA 1SKOB 5EM1A 3L7HA 4FUWA 5FDSA 3T1XA 2JKGA 1YPRA 2PAVP 1ACFA 3MSHA 3MS6A 1CQAA 4X25A 1A0KA 2V8CA 1F2KA 2BTFP 3LEQA 2VK3A 1HLUP 2B95A 4X1LA 1K0KA 2PBDP 4D60A 1VEUB 2HZ5A 4ESPA 3CHWP 2ACGA 1PFLA 5EM0A 5EV0A 1Z09A 2JKFA 2E8JA 3CPTB 3L9KA 1VEUA 1FILA 1FIKA 3U4LP 3UB5P 2PRFA 1CJFA 1J3WA 5FEGA 2ZL1B 3LGOA 1SKOA
chains in the Genus database with same CATH superfamily
1H3QA 4DDSA 3MZDA 4EEPA 4B9OA 2B18A 3MFDA 3PHYA 4H6JA 3CWFA 2XLNA 1MC0A 3NI9A 3UMDA 2A3UA 5TGFA 1YLJA 3H7WB 4CLCB 4LCMA 5HFOA 1OTEA 1W8YA 3SH8A 5FQQA 1KGGA 3F1NB 4EUZA 1SDNA 4XUZA 3LR5A 3LICA 1DP8A 3ZNYA 3P7NA 4NG2A 4F94A 3A0SA 2XK1A 4GOGA 5K5BA 1I2SA 4KZBA 3ZG8B 5CTMA 5JYOA 1OPXA 3PBRA 3BFFA 3V67A 4JBFA 2HDUA 3Q7VA 4KUOA 1FR1A 5DF8A 4PM5A 4ZDXA 1MPLA 3D4FA 5EVIB 2EWWA 1CI9A 3RXWA 5IT5A 3MZFA 5HDDA 1TDLA 5EVID 4MBKA 1NJ4A 1YPRA 4L9FA 1P97A 1K57A 1HLUP 5FSRA 4EU0A 1XJ3A 5TBMA 3T4JA 1K55C 1PW8A 4Q0HA 5F1FA 3HLFA 2WKEA 1F9IA 1BTLA 3MQQA 4B4ZA 1RGYA 4R0QA 4IUHA 3WRZA 4CJNA 3PBQA 3FYZA 1TVFA 2ZC6B 4L9GA 4OKPA 3DBAA 2E8JA 1FIKA 2M7UA 1GHPA 2CC1A 3VOYA 2JKRM 5GLCA 4X68A 1YMXA 4X56A 2OAP1 2Z2MB 4S2NA 4UA7A 2VK3A 1GA0A 2PDRA 4S2LA 2ZQ8A 2P7JA 3QHYA 1ESIA 2RCXA 3ITBA 3WS1A 1QMFA 2Y8HA 1CK3A 3IXHA 1OTDA 5G18A 1SKOB 1K57C 1NY0A 2IWBA 2O9CA 4WUJA 3A3DA 2HDSA 2HP9A 1OTBA 3W4PA 2OOLA 3BFEA 5FQJA 4KZ3A 5DJTA 4EERA 3IF5A 1RP5A 4S2KA 1G28A 3IHAA 2M1CA 1AWIA 4MNRA 3EEHA 2INWA 2M7VA 4ARZB 2WYXA 1DP6A 4D60A 4ID4A 2ZMFA 1L0EA 5CECA 3PAEA 1K55A 2XEPA 1MWUA 1K56A 5I5LA 2VV6A 4O7DA 1MWTA 3LIAA 1LHYA 3E98A 5FQMA 1NZUA 2RL3A 5GL9A 2HDQA 1STZA 3BEBA 5TBMB 3H82B 1LT0A 4GN2A 5KIZA 2GZAA 3KO6A 1L2SA 4WEKA 5GHYA 2J3WA 3LGOA 2Y2JA 2H5SA 3O88A 2VZWA 4IJGA 1CI8A 4D2OA 5HPIA 3C2WA 4ETZA 3M2JA 2PR5A 3SZTA 1WYCA 3BY9A 1ZHHB 4DRTA 4NKPA 4L0LA 1K6SA 4II7A 2W1TA 2Q9MA 3WS4A 3S7NA 2HDRA 3VV4A 1VETB 3HLEA 3T1SA 1KVMA 4HH2A 2XH9A 2XFSA 1FCOA 3NHQA 1XP4A 2J8YA 4MLLA 4C75A 1V9YA 1D06A 2H10A 3LR3A 1Z09A 4X69A 4DJ2A 1T1CA 4NXBA 5L10A 2LB9A 4NETA 3IH9A 3VFHA 2IWDA 4KQDA 3GMWA 1H8YA 1CQAA 3P98A 3W8KA 5FAOA 5L09A 3LEZA 2GJ3A 2L4RA 4WF0A 4UA6A 2GX5A 4GD6A 2VGLM 4X6TA 4GHIA 1DP9A 1FOFA 4Y0UA 2JE5A 4O8GA 1H5XA 4FUWA 3IF6C 4KZ7A 4HJ4A 4C6YA 4ME4A 3QP6A 4N1XA 2ZOHA 3SS3A 3U2AA 4BBVA 2ZLYA 3N8SA 1PIOA 2WAEA 4CLCC 3T4QA 4QD4A 4U0TA 1MZUA 5DKKA 1KOUA 4GLQA 2K7SA 5TR7A 1KVLA 4RX2A 3K3DA 4FH2A 4E3IA 3ISGA 2PRFA 1J3WA 4YFMA 5A91A 1OJ5A 5AVFA 3BQ8A 4R4RA 5DF9A 3TRCA 4BWIA 3HLBA 1GSWA 1L3LA 4RA7A 2JKTM 1MWRA 1ODVA 1H8MA 5L2FA 2C6WB 3KSGA 3Q81A 5GLBA 4YWZA 3ZG5A 1ESUA 5AQBA 5J7EA 4MBFA 1MWSA 3A0VA 1AXBA 3F1OA 2WGWA 4ZAMA 1TF1A 5FDSA 3A3JA 4GJ4A 4PKYA 3IXGA 3IQAA 2ZM2A 4R3BA 5E43A 4DMZA 4KUKA 4RVAA 1IYQA 4MN7A 1P9RA 3QNCA 2GNXA 3KYEA 3VSLA 4YNRA 2KOIA 2Y91A 5FQKA 5E2HA 3MKFA 4GDBA 3UO9A 3LY3A 3UPOA 3JPUA 3O86A 4U0XA 5L8MA 4LLOB 4JGQA 2EWVA 3UDIA 3V50A 1XA7A 2PT7A 4XT2A 2AVXA 2DNSA 3HJIA 3HUMA 4DE2A 1NWZA 3HBRA 4I5SA 1W63Q 2QWSA 1OJGA 3SW1A 2I72A 5EVLA 3NJAA 2ACGA 4KZ6A 1NRJA 3PAGA 2NUPC 4JGRA 3O5YA 3EOIA 4B93A 4PHTA 3VE3A 2D02A 4N9LA 3G35A 1S66L 5F6AA 1S0WA 1MBLA 5CHJA 5AJGA 4CLCE 4IUKA 3E2KA 3IWIA 5M18A 2W3DA 4Z9QA 3MXSA 5HWWA 5HW3A 3L9KA 4ZJ1A 3LR4A 4WYYA 5HD5A 1ZTUA 3ZQ5A 5DF7A 3RJUA 2XR0A 4WLAA 4X1MA 2KDKA 2ZM0A 4XUXA 1LSVA 1IOUA 4OQ0A 3FC7A 3VP0A 3E0YA 1XJ6A 4OVDA 3MZEA 4LV2A 3CHWP 2EXAA 3OPLA 1YLWA 5L07A 3C7VA 2V0WA 2V2FF 5JYPA 3HLGA 4ESPA 2HJEA 1KE0A 3GV9A 1S67L 4EW7A 3LEQA 2V1AA 5J3WA 4JPMA 2Q9NA 1JTDA 3KYQA 4GDNA 3UB7A 1M6KA 3CUEC 4KZ8A 1Y4OA 3CG5A 4LV0A 1MKIA 1BLHA 5IS1A 1ES2A 4HIAA 3CLOA 2KX6A 1YQSA 2HGVA 5HARA 1FILA 2Z2LB 5DVAA 2PU4A 1XJ4A 2W3FA 4ZJ2A 3WS5A 4PPRA 4EQIA 1LLBA 4GKUA 5F82A 1BYWA 4LFUA 1E3UD 2EFUA 3C38A 4WMCA 4RX3A 1JNUA 1PNEA 1ONHA 3PBNA 5EFWA 1TDGA 2HV1A 3C7UA 3T50A 4HP4A 3FZCA 3ZCZA 3UE0A 4BMWA 1ONGA 1KGEA 1X0OA 3RTYA 4FH4A 2ZQDA 3OC2A 1NZOA 2XA7S 4DKIA 4RYEA 1IYOA 3BRMA 3BFDA 3JVVA 3UB8A 4MMNA 1TS0A 2QJ5A 3H9WA 1SDEA 1N4OA 4IBRA 5HSQA 1PI4A 3WWXA 4PM8A 5EM0A 2OV5A 2ZC7A 5E2EA 2V1ZA 3SH9A 5GHXA 4NXFA 2PHYA 2QZ6A 2VA0A 3NY4A 4GB7A 2ZC5B 2L1MA 2VV7A 1BSGA 3WS0A 2GDNA 2PD8A 5HZHA 3NOPC 3PR6A 4JGOA 2FH5A 1XA1A 2OLVA 1K6RA 2I9VA 4HY8A 3G34A 3CZDA 3LIEA 2VGLS 4JF6A 2X71A 2EX2A 2P9VB 1IEMA 3T4SA 3M2KA 3NCKA 4OOLA 1XPBA 4FTXA 5AQ9A 5HDCA 2P74A 3OZHA 1G6OA 5DFXA 5A8BA 5J4EA 5CGXA 5FASA 1KGFA 5IU1A 4WN5A 3OLOA 1XGJA 4Q8IA 4IHQA 1PW1A 5FI2A 4F3LB 4HJ6A 4XT2B 1K4EA 3KYZA 1RCJA 1YKDA 5CGSA 5HWTA 3Q82A 4OH0A 5CRFA 3D9YA 3VE4A 4QWOA 3D72A 1JWVA 5CHUA 3NIAA 4FD8A 1UWNX 3HL9A 3E4QA 3MJQA 3QP8A 4EEUA 3RFBA 4QB8A 1ZG6A 3OCNA 3QNBA 1OMEA 3G2YA 3C4PA 2EX9A 3FV7A 1PWDA 1N9NA 2EX6A 2MJ6A 3T4TA 3VP4A 3UMEA 2WKHA 3PXPA 4X55A 3VP2A 2FFFB 3H7WA 2PD7A 4MN6A 4GS9B 2LB5A 5AQAA 4ZBEA 1WA9A 3AGFA 1W8QA 4BJPA 4GNUA 4OLDA 3MF0A 1E4DA 3G4PA 3HCYA 3LR0A 3FPWA 3VSKA 3KSFA 5D3OA 3NOTC 3BECA 4OQIA 1G6AA 4OOYA 5CHMA 1JWZA 4OQGA 5CXWA 4E6XA 1DJCA 5FAQA 3HUNA 1YLPA 4QJGA 1NXYA 5EE8A 1PRQA 4JLFA 1KDWA 1XFQA 3B42A 5FL3A 1MKMA 2VLGA 3R7WA 3V3RA 2O9BA 1I2WA 3EQVA 1G68A 4UHUA 1ZG4A 2HP6A 3T4KA 3AGDA 5U47A 4KG2A 4E04A 5DJUA 4WM9A 4LV3A 5DTSA 4R4SA 1V9ZA 2IA2A 4K0XA 1GSXA 4F3LA 3FKWA 4S2JA 4DXBA 4R23A 4OPRA 4U3TA 3HJKA 2EA9A 3NOUC 3CITA 4EBLA 2QPNA 3IF6B 3W2ZA 3BQAA 3UN7A 1IKGA 1S4RA 4EBPA 3NC8A 1CEGA 2OAQ1 2HP5A 5TFQA 3HVFA 4IEDA 2XGNA 2EXBA 5J8XA 5HL6A 3N8RA 1TD5A 5BOHA 1O7EA 3UE3A 2PBDP 4HESA 1FR6A 3BJNA 2VKSA 1Y54A 2Y2LA 1YM1A 1LL8A 3F1PB 4GS9A 4N1HA 2A49A 3T1QB 4HJ3A 1LI0A 4OONA 4HI4A 1S6RA 2H28A 4WMCD 1K0KA 1VM1A 3E2LA 3BLMA 1ERMA 2JC7A 3E4OA 3IHBA 2WZXA 3C4OA 4GZBA 1ALQA 5MC7A 4BQMA 1D1JA 3FKVA 1HTZA 1JWPA 4LCLA 1DY6A 4OQHA 1LSWA 3GR2A 2IWCA 2Y2MA 3QP2A 4Y7PA 2WKRA 2WKIA 1NLZA 2JCHA 2WKQA 1FCNA 1I5QA 2EFXA 3LYXA 5FAPA 1O07A 4HQAA 3DTIA 5G4ZA 1MXOA 2P04A 1GCEA 2FZ0A 4S2IA 2V20A 1MY8A 4H8RA 5A90A 2Y2QA 4JXVA 4Y2FA 4EBNA 3UE6A 3H82A 4P0MA 1UWPX 3MKEA 3HREA 1T18A 5CEBA 3LIBA 2JKRI 4ZTKA 2VGKA 2QYBA 1F98A 2WKPA 2ZMVA 3S7OA 1LI9A 4P85A 5AVEA 4MBHA 3UPNA 1DRMA 3IF6A 2K2NA 3JVUA 1LL5A 2W1TB 5F69A 4I3JA 2Y2OA 4S2OA 5I94A 3QP4A 1TS8A 4Q0IA 4UA9A 2ZQCA 4WZ5A 3ICYA 4JXGA 2XA7M 1VETA 4S2NC 3IWQA 3LIFA 4I38A 3HLWA 5AQ7A 5EV0A 5HL1A 2V0UA 4CLCA 1ES3A 1CJFA 2OSUA 1H0MA 3WRTA 2VX8A 4HBUA 2WAFA 4GD8A 5FATA 2OWHA 3UY6A 4WL9A 1IKIA 4OPZA 4EETB 4DE0A 1S4SA 3VFFA 1UGUA 4B4XA 2QMIA 5F1GA 4JF4A 4PM9A 3ZDJA 4HBTA 1F5MA 3SS4A 5LBRA 3TJZC 3C8CA 1EROA 3G31A 2Y2GA 4ZJ3A 3EQUA 3IXBA 4GHIB 4EQ1A 5HPFA 2Z6DA 5EPHA 2JKGA 1HZOA 1T19A 3D3OA 4KZ5A 3GDIA 1S1ZA 1ES4A 1U60A 1KE4A 1H8ZA 3GECA 3LI9A 3C30A 2PU2A 4B88A 3UNWA 1VQQA 2G2WA 3LCEA 1CF0A 3R7WB 1XJ2A 4MCWA 3N6IA 4PM7A 5DFYA 3ZG9B 1YMSA 1EWZA 2O9AA 3NDEA 3ZVTA 4I3AA 3E4PA 4P6ZS 5E2FA 3I7JA 3W4OA 3ZNTA 1D7EA 3K2NA 4G3VA 5HAIA 4E3JA 2XROA 4P87A 4ZRRA 2QKPA 3S4XA 2XF3A 4N92A 2ZM8A 1XFNA 3AGEA 3M6HA 4BD1A 2Q0OA 2ZBBA 3VOZA 5FI7A 3C5AA 3LFVA 3PBSA 3UB6A 4NXGA 3T1RA 1SZVA 1K54A 2W3GA 1ES5A 3IX3A 5EM1A 1XKZA 3UPPA 4E3MA 1F2KA 2ZJ9A 3DWZA 2HZ5A 1ZKJA 3MBZA 2J9PA 1KE3A 3F1PA 3IBJA 4DF6A 4O0PA 5HAPA 4LRYC 1EI5A 3SOIA 3F1NA 5FDHA 3M6BA 4UEYA 2Y79A 3OOVA 1SHVA 2V1BA 2XD1A 2OLUA 2D01A 3IH8A 2H0TA 1VB6A 2QJ7A 5G4YA 2Y2IA 1C3BA 3Q7VB 3MR0A 3ZFZA 3A0RA 2G2UA 3K3CA 4QU3A 1Q2QA 3TW8A 1P0ZA 3MS6A 4FSFA 4G3KA 4YINA 4HP9A 5EVIA 1PFLA 1FCMA 3N4IA 3UB9A 1FSYA 4L9EA 2Y55A 1W7FA 3N8LA 1G5UA 2ZQ7A 4Q0JA 4WBGA 2VEAA 1E3UA 5HAQA 3L7HA 3CAXA 2ZMAA 4PKYG 1FQGA 1K56D 4IBXA 3CJMA 2BG1A 1YLZA 2ZC4B 3V5MA 4BENA 4BBUA 4QHCA 1EW0A 4BD0A 1OT6A 1LSXA 3S7QA 4Y0TA 3MXRA 4RQ9A 1WE4A 4P6ZM 3G2ZA 5HX9A 4KQOA 3ZGAB 5CGWA 2FFYA 4S2MA 2V9AA 3BY8A 5KZHA 1TS7A 2R9XA 4KZAA 3BWLA 3A3FA 1GSVA 1K38A 3O3VA 5EECA 5DTKA 4DE1A 1GHMA 3GSGA 4E3NA 2HJ9C 4BL3A 3LO7A 4HEFA 3VMAA 4R38A 1ERQA 4MN5A 3KSIA 4JF5A 5F5YA 4EWFA 4DE3A 3S22A 4DJ3A 4UAAA 3EWKA 5FQIA 2WADA 1IELA 2PR6A 4QY6A 3ZVWA 3IS2A 1YSQA 3OPHA 1SKOA 1JTGA 2XFTA 4GW9A 4K08A 2P9VA 1YLYA 3Q1FA 1FSWA 3V3SA 4QY5A 4XXRA 4EXOA 3UDXA 3FPVA 3MMHA 3PTEA 4WEJA 3BM6A 4EV4A 2V8CA 5CTNA 4LRZE 3IT9A 2DMWA 1PWCA 4OPQA 4LGWA 2CMNA 3LIDA 1VHMA 2E8IA 4NXEA 3UDFA 4X53A 5C5KA 2A24B 3MXQA 4YOFA 4NEED 2EX8A 4DDYA 1XGIA 4Y5FA 1SCWA 2WGIA 4R3JA 1IFQA 1Y28A 3S1YA 3CMZA 5F83A 3WS2A 4KZ9A 2PBYA 3DWKA 4DXCA 3CI6A 1GHIA 1HD8A 1JVJA 1OTAA 3TOIA 3MQ0A 4EUVA 4KG6A 2Y2PA 4QPRA 3IX8A 3RXXA 4KG5A 1NYYA 3KX0X 2UWXA 4BL2A 4PMAA 4Z1WA 3LY4A 4OP5A 1IYPA 2C5WB 4CQHA 4Y17A 3ZHHA 4MEZA 5FEGA 1K4FA 5GLAA 3SS5A 2WGVA 3TSGA 1YT4A 3FG8A 2J3TD 2VJWA 3Q7ZA 2ZQAA 3NECA 4S2PA 3V39A 3IBRA 4OLGA 2YKFA 2ZQ9A 4UQIS 1L0GA 1BZAA 4X1LA 4PAUA 2HF6A 5DTTA 3NBLA 5GHZA 5M19A 2KLIA 1PZPA 3HLCA 3FWLA 3DTEA 3VP1A 2R9WA 3F1OB 3CPTA 3LUQA 4OOMA 1YSPA 3QP1A 4M3KA 5EUAA 1ACFA 4R1GA 2XSSA 2BTFP 4OPYA 1BUEA 4KQRA 3U4LP 3R4KA 2A2LA 5FQ9A 2J9OA 5FA7A 2ZL1A 2W0NA 2XQZA 3DTMA 4MDZA 4DN0A 2PAVP 3GVBA 3LI8A 1W63M 1Q2PA 3IX4A 2ZC3B 3GQZA 3OPPA 1L0DA 2DRWA 2HPBA 4UQIM 4JGPA 4Y13A 4IVIA 2WZZA 4Y3IA 1J9MA 1OTIA 3A3EA 1BT5A 5EVEA 2G7UA 4PM6A 4I3IA 3G32A 3N7WA 3BFGA 2J3TC 4LPZA 1DJAA 3EGXC 3W4QA 2JKFA 5GLDA 3VP3A 4BLMA 4H6JB 3BLSA 3ULFA 4R70A 2B02A 5EOOA 1L0FA 2JHEA 2V8FA 1PZOA 1GA9A 1QMEA 5M1AA 4K91A 4HHDA 1NRFA 4JXSA 4ETXA 3T4LA 1W5DA 1T1BA 4JKTA 5CX7A 4LV1A 5HDSA 5IHVA 3PYPA 4O01A 5E2GA 4M4XA 4HOIA 3T4OA 2L0WA 3NULA 1E25A 4A5RA 3PBOA 3A3IA 4R6LA 3GTCA 3T1XA 2DCFA 3OCLA 2JBFA 3MSHA 2JN7A 3HLDA 1PI5A 2Y2KA 1BULA 4G3WA 5KMWA 4R3AA 2ZD8A 1K25A 3GRJA 2UV0E 2ZOIA 4LRXC 2B5RA 3HUOA 2WGWB 4KQQA 2XDMA 2Z6CA 3OPRA 4NK3A 2BLSA 1WYBA 4AFIA 4Y0OA 2O0YA 1Z6FA 1BLPA 1DJBA 2O99A 2W1RA 2XD5A 3OBFA 2YKHA 4WZ4A 1LL9A 3IS2B 3BFCA 3MFXA 4CPKA 4E3OA 4EESA 1BLSA 3BW6A 4P6BA 2ZL1B 3DTKA 1N9BA 2PYRA 3ITAA 2W27A 2X01A 5FI6A 1K54C 3B47A 1IYSA 3DAVA 2WK0A 3IXDA 4E6WA 2WUQA 3UE1A 1TS6A 3EEAA 2QHKA 1S1YA 2JKTI 1VEUA 4C3QA 2A24A 4HNBA 3ZG0A 2J7VA 1M40A 1KDSA 3SH7A 4JXWA 1HVBA 4HH3A 3DW0A 4BBTA 1YAXA 2X02A 2B95A 3Q07A 3VOLA 2VV8A 4Y15A 2Y59A 4OP8A 5A92A 1W79A 2K31A 1XXMA 3IWOA 2PYPA 1NYMA 3TG9A 5FEFA 3CUEA 3P01A 5KSCA 3G6OA 1XX2A 1P9WA 2H0YA 3BYDA 3KSHA 2J80A 3B3XA 5CEDA 3PBTA 4FCFA 4E3LA 5HD3A 2NUTC 5DKLA 1RGZA 1T1AA 3T12B 4FOFA 4KZ4A 3RH8B 1BLCA 3CPTB 4ARZA 1PYYA 3JYIA 4N9KA 2VGJA 2R78A 1YLTA 3B33A 3P09A 3G30A 1ZC2A 3NDGA 2BASA 1N9LA 2Y2NA 3MQOA 3O87A 1CEFA 5TJJA 3EGDC 5KSHA 3S7PA 4GCZA 4E3KA 1NLYA 4WELA 3QP5A 4K0WA 4IVKA 2Y2HA 5EVIC 2XRNA 1OT9A 2W3HA 2W3EA 3ZYTA 1SKFA 4WZ5C 4CLCD 3ZG7B 1PWGA 4KENB 4LENA 4X25A 1A0KA 1TEMA 4I39A 2OWJA 2Y4AA 5EOEA 5F68A 1VEUB 5A93A 1N9OA 2P08A 3TE8A 3UB5P 5HWVA 5CERA
chains in the Genus database with same CATH topology
3KYEA 1VETB 1Y4OA 1D1JA 3CPTA 4X1MA 1PNEA 1SZVA 3T1RA 2V8FA 2ZL1A 3NULA 4FTXA 5EVEA 5FEFA 3T1SA 3T12B 3DAVA 3T1QB 3D9YA 1G5UA 1VETA 1CF0A 4QWOA 1AWIA 3NECA 1PRQA 1SKOB 5EM1A 3L7HA 4FUWA 5FDSA 3T1XA 2JKGA 1YPRA 2PAVP 1ACFA 3MSHA 3MS6A 1CQAA 4X25A 1A0KA 2V8CA 1F2KA 2BTFP 3LEQA 2VK3A 1HLUP 2B95A 4X1LA 1K0KA 2PBDP 4D60A 1VEUB 2HZ5A 4ESPA 3CHWP 2ACGA 1PFLA 5EM0A 5EV0A 1Z09A 2JKFA 2E8JA 3CPTB 3L9KA 1VEUA 1FILA 1FIKA 3U4LP 3UB5P 2PRFA 1CJFA 1J3WA 5FEGA 2ZL1B 3LGOA 1SKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYE A;  1VET B;  1Y4O A;  1D1J A;  3CPT A;  4X1M A;  1PNE A;  1SZV A;  3T1R A;  2V8F A;  2ZL1 A;  3NUL A;  4FTX A;  5EVE A;  5FEF A;  3T1S A;  3T12 B;  3DAV A;  3T1Q B;  3D9Y A;  1G5U A;  1VET A;  1CF0 A;  4QWO A;  1AWI A;  3NEC A;  1PRQ A;  1SKO B;  5EM1 A;  3L7H A;  4FUW A;  5FDS A;  3T1X A;  2JKG A;  1YPR A;  2PAV P;  1ACF A;  3MSH A;  3MS6 A;  1CQA A;  4X25 A;  1A0K A;  2V8C A;  1F2K A;  2BTF P;  3LEQ A;  2VK3 A;  1HLU P;  2B95 A;  4X1L A;  1K0K A;  2PBD P;  4D60 A;  1VEU B;  2HZ5 A;  4ESP A;  3CHW P;  2ACG A;  1PFL A;  5EM0 A;  5EV0 A;  1Z09 A;  2JKF A;  2E8J A;  3CPT B;  3L9K A;  1VEU A;  1FIL A;  1FIK A;  3U4L P;  3UB5 P;  2PRF A;  1CJF A;  1J3W A;  5FEG A;  2ZL1 B;  3LGO A;  1SKO A; 
#chains in the Genus database with same CATH topology
 1H3Q A;  4DDS A;  3MZD A;  4EEP A;  4B9O A;  2B18 A;  3MFD A;  3PHY A;  4H6J A;  3CWF A;  2XLN A;  1MC0 A;  3NI9 A;  3UMD A;  2A3U A;  5TGF A;  1YLJ A;  3H7W B;  4CLC B;  4LCM A;  5HFO A;  1OTE A;  1W8Y A;  3SH8 A;  5FQQ A;  1KGG A;  3F1N B;  4EUZ A;  1SDN A;  4XUZ A;  3LR5 A;  3LIC A;  1DP8 A;  3ZNY A;  3P7N A;  4NG2 A;  4F94 A;  3A0S A;  2XK1 A;  4GOG A;  5K5B A;  1I2S A;  4KZB A;  3ZG8 B;  5CTM A;  5JYO A;  1OPX A;  3PBR A;  3BFF A;  3V67 A;  4JBF A;  2HDU A;  3Q7V A;  4KUO A;  1FR1 A;  5DF8 A;  4PM5 A;  4ZDX A;  1MPL A;  3D4F A;  5EVI B;  2EWW A;  1CI9 A;  3RXW A;  5IT5 A;  3MZF A;  5HDD A;  1TDL A;  5EVI D;  4MBK A;  1NJ4 A;  1YPR A;  4L9F A;  1P97 A;  1K57 A;  1HLU P;  5FSR A;  4EU0 A;  1XJ3 A;  5TBM A;  3T4J A;  1K55 C;  1PW8 A;  4Q0H A;  5F1F A;  3HLF A;  2WKE A;  1F9I A;  1BTL A;  3MQQ A;  4B4Z A;  1RGY A;  4R0Q A;  4IUH A;  3WRZ A;  4CJN A;  3PBQ A;  3FYZ A;  1TVF A;  2ZC6 B;  4L9G A;  4OKP A;  3DBA A;  2E8J A;  1FIK A;  2M7U A;  1GHP A;  2CC1 A;  3VOY A;  2JKR M;  5GLC A;  4X68 A;  1YMX A;  4X56 A;  2OAP 1;  2Z2M B;  4S2N A;  4UA7 A;  2VK3 A;  1GA0 A;  2PDR A;  4S2L A;  2ZQ8 A;  2P7J A;  3QHY A;  1ESI A;  2RCX A;  3ITB A;  3WS1 A;  1QMF A;  2Y8H A;  1CK3 A;  3IXH A;  1OTD A;  5G18 A;  1SKO B;  1K57 C;  1NY0 A;  2IWB A;  2O9C A;  4WUJ A;  3A3D A;  2HDS A;  2HP9 A;  1OTB A;  3W4P A;  2OOL A;  3BFE A;  5FQJ A;  4KZ3 A;  5DJT A;  4EER A;  3IF5 A;  1RP5 A;  4S2K A;  1G28 A;  3IHA A;  2M1C A;  1AWI A;  4MNR A;  3EEH A;  2INW A;  2M7V A;  4ARZ B;  2WYX A;  1DP6 A;  4D60 A;  4ID4 A;  2ZMF A;  1L0E A;  5CEC A;  3PAE A;  1K55 A;  2XEP A;  1MWU A;  1K56 A;  5I5L A;  2VV6 A;  4O7D A;  1MWT A;  3LIA A;  1LHY A;  3E98 A;  5FQM A;  1NZU A;  2RL3 A;  5GL9 A;  2HDQ A;  1STZ A;  3BEB A;  5TBM B;  3H82 B;  1LT0 A;  4GN2 A;  5KIZ A;  2GZA A;  3KO6 A;  1L2S A;  4WEK A;  5GHY A;  2J3W A;  3LGO A;  2Y2J A;  2H5S A;  3O88 A;  2VZW A;  4IJG A;  1CI8 A;  4D2O A;  5HPI A;  3C2W A;  4ETZ A;  3M2J A;  2PR5 A;  3SZT A;  1WYC A;  3BY9 A;  1ZHH B;  4DRT A;  4NKP A;  4L0L A;  1K6S A;  4II7 A;  2W1T A;  2Q9M A;  3WS4 A;  3S7N A;  2HDR A;  3VV4 A;  1VET B;  3HLE A;  3T1S A;  1KVM A;  4HH2 A;  2XH9 A;  2XFS A;  1FCO A;  3NHQ A;  1XP4 A;  2J8Y A;  4MLL A;  4C75 A;  1V9Y A;  1D06 A;  2H10 A;  3LR3 A;  1Z09 A;  4X69 A;  4DJ2 A;  1T1C A;  4NXB A;  5L10 A;  2LB9 A;  4NET A;  3IH9 A;  3VFH A;  2IWD A;  4KQD A;  3GMW A;  1H8Y A;  1CQA A;  3P98 A;  3W8K A;  5FAO A;  5L09 A;  3LEZ A;  2GJ3 A;  2L4R A;  4WF0 A;  4UA6 A;  2GX5 A;  4GD6 A;  2VGL M;  4X6T A;  4GHI A;  1DP9 A;  1FOF A;  4Y0U A;  2JE5 A;  4O8G A;  1H5X A;  4FUW A;  3IF6 C;  4KZ7 A;  4HJ4 A;  4C6Y A;  4ME4 A;  3QP6 A;  4N1X A;  2ZOH A;  3SS3 A;  3U2A A;  4BBV A;  2ZLY A;  3N8S A;  1PIO A;  2WAE A;  4CLC C;  3T4Q A;  4QD4 A;  4U0T A;  1MZU A;  5DKK A;  1KOU A;  4GLQ A;  2K7S A;  5TR7 A;  1KVL A;  4RX2 A;  3K3D A;  4FH2 A;  4E3I A;  3ISG A;  2PRF A;  1J3W A;  4YFM A;  5A91 A;  1OJ5 A;  5AVF A;  3BQ8 A;  4R4R A;  5DF9 A;  3TRC A;  4BWI A;  3HLB A;  1GSW A;  1L3L A;  4RA7 A;  2JKT M;  1MWR A;  1ODV A;  1H8M A;  5L2F A;  2C6W B;  3KSG A;  3Q81 A;  5GLB A;  4YWZ A;  3ZG5 A;  1ESU A;  5AQB A;  5J7E A;  4MBF A;  1MWS A;  3A0V A;  1AXB A;  3F1O A;  2WGW A;  4ZAM A;  1TF1 A;  5FDS A;  3A3J A;  4GJ4 A;  4PKY A;  3IXG A;  3IQA A;  2ZM2 A;  4R3B A;  5E43 A;  4DMZ A;  4KUK A;  4RVA A;  1IYQ A;  4MN7 A;  1P9R A;  3QNC A;  2GNX A;  3KYE A;  3VSL A;  4YNR A;  2KOI A;  2Y91 A;  5FQK A;  5E2H A;  3MKF A;  4GDB A;  3UO9 A;  3LY3 A;  3UPO A;  3JPU A;  3O86 A;  4U0X A;  5L8M A;  4LLO B;  4JGQ A;  2EWV A;  3UDI A;  3V50 A;  1XA7 A;  2PT7 A;  4XT2 A;  2AVX A;  2DNS A;  3HJI A;  3HUM A;  4DE2 A;  1NWZ A;  3HBR A;  4I5S A;  1W63 Q;  2QWS A;  1OJG A;  3SW1 A;  2I72 A;  5EVL A;  3NJA A;  2ACG A;  4KZ6 A;  1NRJ A;  3PAG A;  2NUP C;  4JGR A;  3O5Y A;  3EOI A;  4B93 A;  4PHT A;  3VE3 A;  2D02 A;  4N9L A;  3G35 A;  1S66 L;  5F6A A;  1S0W A;  1MBL A;  5CHJ A;  5AJG A;  4CLC E;  4IUK A;  3E2K A;  3IWI A;  5M18 A;  2W3D A;  4Z9Q A;  3MXS A;  5HWW A;  5HW3 A;  3L9K A;  4ZJ1 A;  3LR4 A;  4WYY A;  5HD5 A;  1ZTU A;  3ZQ5 A;  5DF7 A;  3RJU A;  2XR0 A;  4WLA A;  4X1M A;  2KDK A;  2ZM0 A;  4XUX A;  1LSV A;  1IOU A;  4OQ0 A;  3FC7 A;  3VP0 A;  3E0Y A;  1XJ6 A;  4OVD A;  3MZE A;  4LV2 A;  3CHW P;  2EXA A;  3OPL A;  1YLW A;  5L07 A;  3C7V A;  2V0W A;  2V2F F;  5JYP A;  3HLG A;  4ESP A;  2HJE A;  1KE0 A;  3GV9 A;  1S67 L;  4EW7 A;  3LEQ A;  2V1A A;  5J3W A;  4JPM A;  2Q9N A;  1JTD A;  3KYQ A;  4GDN A;  3UB7 A;  1M6K A;  3CUE C;  4KZ8 A;  1Y4O A;  3CG5 A;  4LV0 A;  1MKI A;  1BLH A;  5IS1 A;  1ES2 A;  4HIA A;  3CLO A;  2KX6 A;  1YQS A;  2HGV A;  5HAR A;  1FIL A;  2Z2L B;  5DVA A;  2PU4 A;  1XJ4 A;  2W3F A;  4ZJ2 A;  3WS5 A;  4PPR A;  4EQI A;  1LLB A;  4GKU A;  5F82 A;  1BYW A;  4LFU A;  1E3U D;  2EFU A;  3C38 A;  4WMC A;  4RX3 A;  1JNU A;  1PNE A;  1ONH A;  3PBN A;  5EFW A;  1TDG A;  2HV1 A;  3C7U A;  3T50 A;  4HP4 A;  3FZC A;  3ZCZ A;  3UE0 A;  4BMW A;  1ONG A;  1KGE A;  1X0O A;  3RTY A;  4FH4 A;  2ZQD A;  3OC2 A;  1NZO A;  2XA7 S;  4DKI A;  4RYE A;  1IYO A;  3BRM A;  3BFD A;  3JVV A;  3UB8 A;  4MMN A;  1TS0 A;  2QJ5 A;  3H9W A;  1SDE A;  1N4O A;  4IBR A;  5HSQ A;  1PI4 A;  3WWX A;  4PM8 A;  5EM0 A;  2OV5 A;  2ZC7 A;  5E2E A;  2V1Z A;  3SH9 A;  5GHX A;  4NXF A;  2PHY A;  2QZ6 A;  2VA0 A;  3NY4 A;  4GB7 A;  2ZC5 B;  2L1M A;  2VV7 A;  1BSG A;  3WS0 A;  2GDN A;  2PD8 A;  5HZH A;  3NOP C;  3PR6 A;  4JGO A;  2FH5 A;  1XA1 A;  2OLV A;  1K6R A;  2I9V A;  4HY8 A;  3G34 A;  3CZD A;  3LIE A;  2VGL S;  4JF6 A;  2X71 A;  2EX2 A;  2P9V B;  1IEM A;  3T4S A;  3M2K A;  3NCK A;  4OOL A;  1XPB A;  4FTX A;  5AQ9 A;  5HDC A;  2P74 A;  3OZH A;  1G6O A;  5DFX A;  5A8B A;  5J4E A;  5CGX A;  5FAS A;  1KGF A;  5IU1 A;  4WN5 A;  3OLO A;  1XGJ A;  4Q8I A;  4IHQ A;  1PW1 A;  5FI2 A;  4F3L B;  4HJ6 A;  4XT2 B;  1K4E A;  3KYZ A;  1RCJ A;  1YKD A;  5CGS A;  5HWT A;  3Q82 A;  4OH0 A;  5CRF A;  3D9Y A;  3VE4 A;  4QWO A;  3D72 A;  1JWV A;  5CHU A;  3NIA A;  4FD8 A;  1UWN X;  3HL9 A;  3E4Q A;  3MJQ A;  3QP8 A;  4EEU A;  3RFB A;  4QB8 A;  1ZG6 A;  3OCN A;  3QNB A;  1OME A;  3G2Y A;  3C4P A;  2EX9 A;  3FV7 A;  1PWD A;  1N9N A;  2EX6 A;  2MJ6 A;  3T4T A;  3VP4 A;  3UME A;  2WKH A;  3PXP A;  4X55 A;  3VP2 A;  2FFF B;  3H7W A;  2PD7 A;  4MN6 A;  4GS9 B;  2LB5 A;  5AQA A;  4ZBE A;  1WA9 A;  3AGF A;  1W8Q A;  4BJP A;  4GNU A;  4OLD A;  3MF0 A;  1E4D A;  3G4P A;  3HCY A;  3LR0 A;  3FPW A;  3VSK A;  3KSF A;  5D3O A;  3NOT C;  3BEC A;  4OQI A;  1G6A A;  4OOY A;  5CHM A;  1JWZ A;  4OQG A;  5CXW A;  4E6X A;  1DJC A;  5FAQ A;  3HUN A;  1YLP A;  4QJG A;  1NXY A;  5EE8 A;  1PRQ A;  4JLF A;  1KDW A;  1XFQ A;  3B42 A;  5FL3 A;  1MKM A;  2VLG A;  3R7W A;  3V3R A;  2O9B A;  1I2W A;  3EQV A;  1G68 A;  4UHU A;  1ZG4 A;  2HP6 A;  3T4K A;  3AGD A;  5U47 A;  4KG2 A;  4E04 A;  5DJU A;  4WM9 A;  4LV3 A;  5DTS A;  4R4S A;  1V9Z A;  2IA2 A;  4K0X A;  1GSX A;  4F3L A;  3FKW A;  4S2J A;  4DXB A;  4R23 A;  4OPR A;  4U3T A;  3HJK A;  2EA9 A;  3NOU C;  3CIT A;  4EBL A;  2QPN A;  3IF6 B;  3W2Z A;  3BQA A;  3UN7 A;  1IKG A;  1S4R A;  4EBP A;  3NC8 A;  1CEG A;  2OAQ 1;  2HP5 A;  5TFQ A;  3HVF A;  4IED A;  2XGN A;  2EXB A;  5J8X A;  5HL6 A;  3N8R A;  1TD5 A;  5BOH A;  1O7E A;  3UE3 A;  2PBD P;  4HES A;  1FR6 A;  3BJN A;  2VKS A;  1Y54 A;  2Y2L A;  1YM1 A;  1LL8 A;  3F1P B;  4GS9 A;  4N1H A;  2A49 A;  3T1Q B;  4HJ3 A;  1LI0 A;  4OON A;  4HI4 A;  1S6R A;  2H28 A;  4WMC D;  1K0K A;  1VM1 A;  3E2L A;  3BLM A;  1ERM A;  2JC7 A;  3E4O A;  3IHB A;  2WZX A;  3C4O A;  4GZB A;  1ALQ A;  5MC7 A;  4BQM A;  1D1J A;  3FKV A;  1HTZ A;  1JWP A;  4LCL A;  1DY6 A;  4OQH A;  1LSW A;  3GR2 A;  2IWC A;  2Y2M A;  3QP2 A;  4Y7P A;  2WKR A;  2WKI A;  1NLZ A;  2JCH A;  2WKQ A;  1FCN A;  1I5Q A;  2EFX A;  3LYX A;  5FAP A;  1O07 A;  4HQA A;  3DTI A;  5G4Z A;  1MXO A;  2P04 A;  1GCE A;  2FZ0 A;  4S2I A;  2V20 A;  1MY8 A;  4H8R A;  5A90 A;  2Y2Q A;  4JXV A;  4Y2F A;  4EBN A;  3UE6 A;  3H82 A;  4P0M A;  1UWP X;  3MKE A;  3HRE A;  1T18 A;  5CEB A;  3LIB A;  2JKR I;  4ZTK A;  2VGK A;  2QYB A;  1F98 A;  2WKP A;  2ZMV A;  3S7O A;  1LI9 A;  4P85 A;  5AVE A;  4MBH A;  3UPN A;  1DRM A;  3IF6 A;  2K2N A;  3JVU A;  1LL5 A;  2W1T B;  5F69 A;  4I3J A;  2Y2O A;  4S2O A;  5I94 A;  3QP4 A;  1TS8 A;  4Q0I A;  4UA9 A;  2ZQC A;  4WZ5 A;  3ICY A;  4JXG A;  2XA7 M;  1VET A;  4S2N C;  3IWQ A;  3LIF A;  4I38 A;  3HLW A;  5AQ7 A;  5EV0 A;  5HL1 A;  2V0U A;  4CLC A;  1ES3 A;  1CJF A;  2OSU A;  1H0M A;  3WRT A;  2VX8 A;  4HBU A;  2WAF A;  4GD8 A;  5FAT A;  2OWH A;  3UY6 A;  4WL9 A;  1IKI A;  4OPZ A;  4EET B;  4DE0 A;  1S4S A;  3VFF A;  1UGU A;  4B4X A;  2QMI A;  5F1G A;  4JF4 A;  4PM9 A;  3ZDJ A;  4HBT A;  1F5M A;  3SS4 A;  5LBR A;  3TJZ C;  3C8C A;  1ERO A;  3G31 A;  2Y2G A;  4ZJ3 A;  3EQU A;  3IXB A;  4GHI B;  4EQ1 A;  5HPF A;  2Z6D A;  5EPH A;  2JKG A;  1HZO A;  1T19 A;  3D3O A;  4KZ5 A;  3GDI A;  1S1Z A;  1ES4 A;  1U60 A;  1KE4 A;  1H8Z A;  3GEC A;  3LI9 A;  3C30 A;  2PU2 A;  4B88 A;  3UNW A;  1VQQ A;  2G2W A;  3LCE A;  1CF0 A;  3R7W B;  1XJ2 A;  4MCW A;  3N6I A;  4PM7 A;  5DFY A;  3ZG9 B;  1YMS A;  1EWZ A;  2O9A A;  3NDE A;  3ZVT A;  4I3A A;  3E4P A;  4P6Z S;  5E2F A;  3I7J A;  3W4O A;  3ZNT A;  1D7E A;  3K2N A;  4G3V A;  5HAI A;  4E3J A;  2XRO A;  4P87 A;  4ZRR A;  2QKP A;  3S4X A;  2XF3 A;  4N92 A;  2ZM8 A;  1XFN A;  3AGE A;  3M6H A;  4BD1 A;  2Q0O A;  2ZBB A;  3VOZ A;  5FI7 A;  3C5A A;  3LFV A;  3PBS A;  3UB6 A;  4NXG A;  3T1R A;  1SZV A;  1K54 A;  2W3G A;  1ES5 A;  3IX3 A;  5EM1 A;  1XKZ A;  3UPP A;  4E3M A;  1F2K A;  2ZJ9 A;  3DWZ A;  2HZ5 A;  1ZKJ A;  3MBZ A;  2J9P A;  1KE3 A;  3F1P A;  3IBJ A;  4DF6 A;  4O0P A;  5HAP A;  4LRY C;  1EI5 A;  3SOI A;  3F1N A;  5FDH A;  3M6B A;  4UEY A;  2Y79 A;  3OOV A;  1SHV A;  2V1B A;  2XD1 A;  2OLU A;  2D01 A;  3IH8 A;  2H0T A;  1VB6 A;  2QJ7 A;  5G4Y A;  2Y2I A;  1C3B A;  3Q7V B;  3MR0 A;  3ZFZ A;  3A0R A;  2G2U A;  3K3C A;  4QU3 A;  1Q2Q A;  3TW8 A;  1P0Z A;  3MS6 A;  4FSF A;  4G3K A;  4YIN A;  4HP9 A;  5EVI A;  1PFL A;  1FCM A;  3N4I A;  3UB9 A;  1FSY A;  4L9E A;  2Y55 A;  1W7F A;  3N8L A;  1G5U A;  2ZQ7 A;  4Q0J A;  4WBG A;  2VEA A;  1E3U A;  5HAQ A;  3L7H A;  3CAX A;  2ZMA A;  4PKY G;  1FQG A;  1K56 D;  4IBX A;  3CJM A;  2BG1 A;  1YLZ A;  2ZC4 B;  3V5M A;  4BEN A;  4BBU A;  4QHC A;  1EW0 A;  4BD0 A;  1OT6 A;  1LSX A;  3S7Q A;  4Y0T A;  3MXR A;  4RQ9 A;  1WE4 A;  4P6Z M;  3G2Z A;  5HX9 A;  4KQO A;  3ZGA B;  5CGW A;  2FFY A;  4S2M A;  2V9A A;  3BY8 A;  5KZH A;  1TS7 A;  2R9X A;  4KZA A;  3BWL A;  3A3F A;  1GSV A;  1K38 A;  3O3V A;  5EEC A;  5DTK A;  4DE1 A;  1GHM A;  3GSG A;  4E3N A;  2HJ9 C;  4BL3 A;  3LO7 A;  4HEF A;  3VMA A;  4R38 A;  1ERQ A;  4MN5 A;  3KSI A;  4JF5 A;  5F5Y A;  4EWF A;  4DE3 A;  3S22 A;  4DJ3 A;  4UAA A;  3EWK A;  5FQI A;  2WAD A;  1IEL A;  2PR6 A;  4QY6 A;  3ZVW A;  3IS2 A;  1YSQ A;  3OPH A;  1SKO A;  1JTG A;  2XFT A;  4GW9 A;  4K08 A;  2P9V A;  1YLY A;  3Q1F A;  1FSW A;  3V3S A;  4QY5 A;  4XXR A;  4EXO A;  3UDX A;  3FPV A;  3MMH A;  3PTE A;  4WEJ A;  3BM6 A;  4EV4 A;  2V8C A;  5CTN A;  4LRZ E;  3IT9 A;  2DMW A;  1PWC A;  4OPQ A;  4LGW A;  2CMN A;  3LID A;  1VHM A;  2E8I A;  4NXE A;  3UDF A;  4X53 A;  5C5K A;  2A24 B;  3MXQ A;  4YOF A;  4NEE D;  2EX8 A;  4DDY A;  1XGI A;  4Y5F A;  1SCW A;  2WGI A;  4R3J A;  1IFQ A;  1Y28 A;  3S1Y A;  3CMZ A;  5F83 A;  3WS2 A;  4KZ9 A;  2PBY A;  3DWK A;  4DXC A;  3CI6 A;  1GHI A;  1HD8 A;  1JVJ A;  1OTA A;  3TOI A;  3MQ0 A;  4EUV A;  4KG6 A;  2Y2P A;  4QPR A;  3IX8 A;  3RXX A;  4KG5 A;  1NYY A;  3KX0 X;  2UWX A;  4BL2 A;  4PMA A;  4Z1W A;  3LY4 A;  4OP5 A;  1IYP A;  2C5W B;  4CQH A;  4Y17 A;  3ZHH A;  4MEZ A;  5FEG A;  1K4F A;  5GLA A;  3SS5 A;  2WGV A;  3TSG A;  1YT4 A;  3FG8 A;  2J3T D;  2VJW A;  3Q7Z A;  2ZQA A;  3NEC A;  4S2P A;  3V39 A;  3IBR A;  4OLG A;  2YKF A;  2ZQ9 A;  4UQI S;  1L0G A;  1BZA A;  4X1L A;  4PAU A;  2HF6 A;  5DTT A;  3NBL A;  5GHZ A;  5M19 A;  2KLI A;  1PZP A;  3HLC A;  3FWL A;  3DTE A;  3VP1 A;  2R9W A;  3F1O B;  3CPT A;  3LUQ A;  4OOM A;  1YSP A;  3QP1 A;  4M3K A;  5EUA A;  1ACF A;  4R1G A;  2XSS A;  2BTF P;  4OPY A;  1BUE A;  4KQR A;  3U4L P;  3R4K A;  2A2L A;  5FQ9 A;  2J9O A;  5FA7 A;  2ZL1 A;  2W0N A;  2XQZ A;  3DTM A;  4MDZ A;  4DN0 A;  2PAV P;  3GVB A;  3LI8 A;  1W63 M;  1Q2P A;  3IX4 A;  2ZC3 B;  3GQZ A;  3OPP A;  1L0D A;  2DRW A;  2HPB A;  4UQI M;  4JGP A;  4Y13 A;  4IVI A;  2WZZ A;  4Y3I A;  1J9M A;  1OTI A;  3A3E A;  1BT5 A;  5EVE A;  2G7U A;  4PM6 A;  4I3I A;  3G32 A;  3N7W A;  3BFG A;  2J3T C;  4LPZ A;  1DJA A;  3EGX C;  3W4Q A;  2JKF A;  5GLD A;  3VP3 A;  4BLM A;  4H6J B;  3BLS A;  3ULF A;  4R70 A;  2B02 A;  5EOO A;  1L0F A;  2JHE A;  2V8F A;  1PZO A;  1GA9 A;  1QME A;  5M1A A;  4K91 A;  4HHD A;  1NRF A;  4JXS A;  4ETX A;  3T4L A;  1W5D A;  1T1B A;  4JKT A;  5CX7 A;  4LV1 A;  5HDS A;  5IHV A;  3PYP A;  4O01 A;  5E2G A;  4M4X A;  4HOI A;  3T4O A;  2L0W A;  3NUL A;  1E25 A;  4A5R A;  3PBO A;  3A3I A;  4R6L A;  3GTC A;  3T1X A;  2DCF A;  3OCL A;  2JBF A;  3MSH A;  2JN7 A;  3HLD A;  1PI5 A;  2Y2K A;  1BUL A;  4G3W A;  5KMW A;  4R3A A;  2ZD8 A;  1K25 A;  3GRJ A;  2UV0 E;  2ZOI A;  4LRX C;  2B5R A;  3HUO A;  2WGW B;  4KQQ A;  2XDM A;  2Z6C A;  3OPR A;  4NK3 A;  2BLS A;  1WYB A;  4AFI A;  4Y0O A;  2O0Y A;  1Z6F A;  1BLP A;  1DJB A;  2O99 A;  2W1R A;  2XD5 A;  3OBF A;  2YKH A;  4WZ4 A;  1LL9 A;  3IS2 B;  3BFC A;  3MFX A;  4CPK A;  4E3O A;  4EES A;  1BLS A;  3BW6 A;  4P6B A;  2ZL1 B;  3DTK A;  1N9B A;  2PYR A;  3ITA A;  2W27 A;  2X01 A;  5FI6 A;  1K54 C;  3B47 A;  1IYS A;  3DAV A;  2WK0 A;  3IXD A;  4E6W A;  2WUQ A;  3UE1 A;  1TS6 A;  3EEA A;  2QHK A;  1S1Y A;  2JKT I;  1VEU A;  4C3Q A;  2A24 A;  4HNB A;  3ZG0 A;  2J7V A;  1M40 A;  1KDS A;  3SH7 A;  4JXW A;  1HVB A;  4HH3 A;  3DW0 A;  4BBT A;  1YAX A;  2X02 A;  2B95 A;  3Q07 A;  3VOL A;  2VV8 A;  4Y15 A;  2Y59 A;  4OP8 A;  5A92 A;  1W79 A;  2K31 A;  1XXM A;  3IWO A;  2PYP A;  1NYM A;  3TG9 A;  5FEF A;  3CUE A;  3P01 A;  5KSC A;  3G6O A;  1XX2 A;  1P9W A;  2H0Y A;  3BYD A;  3KSH A;  2J80 A;  3B3X A;  5CED A;  3PBT A;  4FCF A;  4E3L A;  5HD3 A;  2NUT C;  5DKL A;  1RGZ A;  1T1A A;  3T12 B;  4FOF A;  4KZ4 A;  3RH8 B;  1BLC A;  3CPT B;  4ARZ A;  1PYY A;  3JYI A;  4N9K A;  2VGJ A;  2R78 A;  1YLT A;  3B33 A;  3P09 A;  3G30 A;  1ZC2 A;  3NDG A;  2BAS A;  1N9L A;  2Y2N A;  3MQO A;  3O87 A;  1CEF A;  5TJJ A;  3EGD C;  5KSH A;  3S7P A;  4GCZ A;  4E3K A;  1NLY A;  4WEL A;  3QP5 A;  4K0W A;  4IVK A;  2Y2H A;  5EVI C;  2XRN A;  1OT9 A;  2W3H A;  2W3E A;  3ZYT A;  1SKF A;  4WZ5 C;  4CLC D;  3ZG7 B;  1PWG A;  4KEN B;  4LEN A;  4X25 A;  1A0K A;  1TEM A;  4I39 A;  2OWJ A;  2Y4A A;  5EOE A;  5F68 A;  1VEU B;  5A93 A;  1N9O A;  2P08 A;  3TE8 A;  3UB5 P;  5HWV A;  5CER A; 
#chains in the Genus database with same CATH homology
 3KYE A;  1VET B;  1Y4O A;  1D1J A;  3CPT A;  4X1M A;  1PNE A;  1SZV A;  3T1R A;  2V8F A;  2ZL1 A;  3NUL A;  4FTX A;  5EVE A;  5FEF A;  3T1S A;  3T12 B;  3DAV A;  3T1Q B;  3D9Y A;  1G5U A;  1VET A;  1CF0 A;  4QWO A;  1AWI A;  3NEC A;  1PRQ A;  1SKO B;  5EM1 A;  3L7H A;  4FUW A;  5FDS A;  3T1X A;  2JKG A;  1YPR A;  2PAV P;  1ACF A;  3MSH A;  3MS6 A;  1CQA A;  4X25 A;  1A0K A;  2V8C A;  1F2K A;  2BTF P;  3LEQ A;  2VK3 A;  1HLU P;  2B95 A;  4X1L A;  1K0K A;  2PBD P;  4D60 A;  1VEU B;  2HZ5 A;  4ESP A;  3CHW P;  2ACG A;  1PFL A;  5EM0 A;  5EV0 A;  1Z09 A;  2JKF A;  2E8J A;  3CPT B;  3L9K A;  1VEU A;  1FIL A;  1FIK A;  3U4L P;  3UB5 P;  2PRF A;  1CJF A;  1J3W A;  5FEG A;  2ZL1 B;  3LGO A;  1SKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...