5EMJA

Crystal structure of prmt5:mep50 with compound 8 and sinefungin
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 207
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emjA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emjA02
5H1WA 5DSTA 1AQIA 2HTEA 2Q41A 2IH2A 2G70A 5ICFA 1RI3A 3AWIA 2P3QA 4JXJA 3BKXA 4PGLA 1RI5A 1UFKA 3L23A 1SG9A 1YZHA 3EEYA 3I5UA 3G8BA 4AZVA 3XINA 3HEMA 4QE4A 1Q0SA 1JR4A 1QYRA 3FPJA 2CWWA 5EZQA 3KBWA 1A0EA 4RTSA 3M0VA 3ELUA 3HTXA 4DVOA 3FPFA 4PYJA 1TW3A 3OPNA 1XICA 2Q02A 4F85A 3DLCA 3KPUA 2VDUE 5HFJA 1QT1A 1ZQ9A 3P2EA 3G2PA 4XSLA 3I58A 5HZMA 3CWHA 3KQVA 4PYQA 1YFLA 3BWCA 4POOA 5GM2A 3R9XB 5FWDA 4KVZA 5GM1A 2FHPA 5CCBA 3IHTA 2VZ9A 2VP3A 3BXOA 1XLMA 4YTUA 4RWZA 1Q0TA 1PJZA 1SVUA 3C6MA 3M6UA 4RTPA 3B5IA 1OADA 3G89A 3LMZA 4OQEA 3AALA 5B7YA 4GJIA 4Q7IA 1JQ3A 3ITOA 5DTRA 5E1DA 3S68A 3PFGA 3CJRA 3NJRA 5LR6A 4PCLA 3KWSA 3DBNA 2AOUA 2ONYA 3VNIA 4AX8A 3NVMB 3VSEA 5CCXA 2AN3A 3BZBA 3LCUA 3TMAA 4M7RA 4KIFA 3B89A 1JTFA 3UJ8A 5E2BA 3BUSA 3DXXA 4YUVA 4YUWA 5K01A 6XIAA 1NKVA 2G0WA 3HCBA 5EOVA 3KBVA 4H0NA 1XIBA 5M5BA 4CKEA 3GRZA 1DIEA 1XYLA 4UOEA 3P6LA 4EVIA 5F2OA 3VC1A 2AOWA 3IYLW 3EGVA 3M0HA 4DCGA 1XLBA 1G55A 5AVHA 3SGLA 4PGGA 5GP1A 1NE2A 3CJQA 4HSGA 3GXOA 1X1BA 4AUKA 3EMDA 1QUMA 4BLUA 4K3ZA 2HWKA 3JWJA 4QEEA 4US6A 2AOTA 5G02A 1MHTA 4RYLA 4C07A 2QUMA 3LKDA 3KCJA 1JG2A 3PLAE 3ME5A 3BWBA 5LQCA 1XLHA 1FPQA 1KYWA 2PY6A 2YVLA 2AN4A 1ZGJA 5EMJA 4XKMA 3QYSA 4RTRA 2B9EA 2BH2A 2ZDSA 5D1HA 4MIKA 1XLJA 9XIMA 1IY9A 1R8XA 2NP7A 3KQTA 5HIJA 2O06A 3TM5A 3ELYA 4KRGA 2IDJA 2FPOA 3MAGA 1XLLA 3SVZA 2I57A 1A0CA 1G6Q1 1G8AA 2LD4A 4X63A 2NXNA 3BZGA 3AXSA 3FRHA 1EJ0A 3GNLA 3KQSA 4YUYA 4XCXA 4ZB5A 3IUIA 1V39A 2Y1XA 2PXAA 1JQEA 2PKWA 4GF5A 3O7WA 5K0NA 2CKDA 2G1PA 2IBTA 3P9IA 2KW5A 3CQIA 3MHTA 3NW9A 4E70A 3P8ZA 2P8JA 1DXIA 1QTWA 5B1SA 3B3JA 4HHLA 1XP3A 1QZZA 2O57A 3D2LA 3MTEA 5CUQA 2V74B 2XINA 3SX0A 1BHJA 2ZZKA 4J4KA 3VYLA 7XIMA 4R6XA 2ZIFA 3KBSA 2GAFA 3GNXA 2IFTA 1EAMA 3ELWA 4RVGA 3MTIA 1KP9A 4PYIA 3BGDA 4YTTA 1INLA 3JU2A 2AVNA 3CBGA 1XDUA 1KHHA 4ER7A 5DX1A 1WZNA 6XIMA 2GVEA 1ORHA 4C08A 1XLDA 1A0DA 1XIJA 2HCVA 3FTDA 4R6WA 4YV0A 3LHDA 3JWHA 5DTMA 2NQJA 1D2GA 1N2XA 2B25A 2G71A 5LQJA 2C7QA 4AZWA 2AOTB 2C7OA 1DCTA 3DH0A 4LWOA 4RTQA 3ITTA 1NBIA 3U0HA 1DIDA 2EJTA 4E32A 3KQYA 2P3OA 3DULA 4U7TB 4GOMD 3FUUA 4EMSA 3QZAA 2AOUB 4QVKA 5E1BA 4C03A 1JSZA 2YXEA 2WK1A 2O0LA 3NTVA 2J6VA 2YXDA 3BWYA 3FUWA 3O4FA 5DXJA 5E1OA 1VBFA 4MTLA 4YTRA 3PB3A 4KIGA 1Y8CA 4LG1A 4BLVA 3RIEA 2OB1A 3EGEA 3BKWA 1PRYA 2ERCA 3FTFA 2I62A 1FJXA 3EMBA 3K0BA 3JWIA 4Z2YA 3SSOA 3PTAA 2ZCJA 2YQZA 5FA8A 3UJAA 3TKYA 3TPZA 3LPMA 1R18A 4PYNA 3TLJA 3VNMA 5HILA 3UJDA 1Z3CA 5BW5A 1SUSA 2IIPA 5B80A 4QPNA 3CQHA 2GH1A 3A7DA 3EVEA 3HCEA 4R05A 2HK1A 3M0XA 3C6KA 4RV9A 2K4MA 5DTQA 2AS0A 2I6GA 3GU3A 5FADA 1XYMA 4X41A 2HK0A 1NBHA 1MUWA 1XDZA 2I7CA 4KDRA 3HA3A 1XTPA 2YR0A 1O9GA 5EKUA 2GLKA 3M70A 5FHQA 4ATNA 5K03A 2FK7A 4GOLD 1XIDA 5EVJA 3KBMA 1CLKA 3DUWA 5FUBA 3C0LA 3G5LA 3IEIA 2P7IA 3UFBA 1L3CA 3BGIA 1R00A 4XUCA 5HIMA 4M38A 3M0MA 5FQOA 5K05A 5EEGA 5IKMA 4HC4A 2GYIA 3MERA 4E30A 4QVGA 3DTNA 3G7UA 4MHTA 2ZWAA 4M36A 3LDFA 5FQNA 2QRVB 3KQOA 2X7WA 5DM1A 1YX1A 1L3IA 1NW8A 1XLCA 2PBFA 3GDHA 3UVAA 4Y30A 4PONA 4YTQA 5DM0A 2OXTA 3UJBA 1XINA 4PINA 2Z6QA 3BANA 3KU1A 3EVDA 4CTKA 2P41A 3EVGA 3GGDA 4E33A 2B2CA 1JTEA 3FUTA 3LDUA 4C04A 3NMUF 1VL5A 1NV8A 4FZVA 4BY9E 2IDKA 2NXEA 1WS6A 3REOA 5K0FA 2VS1A 1ZG3A 3P2IA 4FT4A 5DX8A 3KR2A 2NQ9A 3OZTA 2ONZA 2ZW9A 3DOUA 3A7EA 3NWEA 4YUZA 2N47A 3LECA 3E8SA 2NXJA 1I4WA 3HVKA 3OCJA 3OZRA 5KVAA 4PCAA 5K8VA 3AYTA 3I53A 4BP1A 4OVXA 2PX8A 1JG3A 9MHTA 1BXCA 2GA9A 3DP7A 1YB2A 2A14A 3NWBA 1XLIA 4GQBA 2YXLA 3M6XA 3VNJA 3KR9A 3WSTA 2R3SA 2XYVA 3GRRA 5K0CA 1YFJA 3G2MA 3LCVB 3EEOA 4QDPA 3G5TA 3PVCA 1XIFA 1NV9A 4E2YA 1OR8A 5EG5A 3G88A 5E2AA 3BZJA 4CKCA 5EQJB 3EPPA 3EVFA 4PFHA 1TW2A 5DRTA 5JUWA 2Z6UA 3NDJA 3B3FA 3GIWA 5C0OE 1K77A 2ZZMA 5DM4A 2FYTA 5JR3A 1D2HA 2OY0A 3CVOA 3DXZA 1WXWA 3AAMA 2AZTA 3KPJA 1VPTA 1X1DA 2E5WA 1WXXA 1GW9A 2XIMA 4QEHA 2FK8A 5K0JA 3HA5A 1I1NA 4QTUB 3HCCA 3BWMA 3KQPA 4DMGA 3FYCA 2NXCA 1NW5A 1JG1A 3FPGA 4ER5A 4A8IA 1HNNA 2VDWA 2ZIEA 5EMLA 3CKKA 2JJQA 3G2QA 2P35A 4KDCA 3KTCA 4FT2A 2ZVJA 2BM9A 2XVMA 5XINA 5K0LA 4ER3A 3ID6C 5I7GA 4OX9Y 5E9QA 3FPHA 4OA8A 3TQSA 4ZTBA 1XYCA 5EHIA 3KHKA 5EKXA 1KR5A 4QE5A 1H1DA 3KPWA 2BR4A 2PV0A 2H1RA 3CGGA 2UZ4A 3F4KA 3UJ7A 5LQUA 3KR0A 4RVHA 5FULA 1NW6A 3KKZA 2XBMA 1EG2A 1VIDA 3UA4A 2HV9A 5CVDA 3P9CA 4CTJA 1XIGA 3C0SA 3QV2A 4E3VA 2QUNA 1SQFA 1XDSA 2PWYA 4FGZA 2QM3A 3ANXA 3QOWA 1FP2A 4A8LA 3P9KA 2UYHA 4QE1A 2AN5A 1YZ3A 1WG8A 2OU4A 2FRXA 2YUIA 3LL7A 3M4XA 3A25A 4ER6A 4IV8A 1BXBA 3NGFA 1M6EX 2JH8A 3KPYA 4XUEA 3P71T 2ZULA 3B7PA 1X1CA 4RX1A 5CIYA 5TNVA 4EK9A 4RTNA 5HOQA 2ZBRA 1P39A 2IPXA 1XIMA 2GB4A 3FTCA 2CL5A 5FCDA 5KQRA 4V0RA 1G60A 1QAMA 2PJDA 1P91A 2O07A 3HM2A 3M6VA 3AXTA 4V0QA 2PX2A 5HIIA 3EGIA 3HA7A 5T64A 4A6DA 5BW4A 2NP6A 3DMGA 4GBED 2UYCA 1RI2A 1AV6A 3BDKA 3DMHA 2ZBQA 2PSSA 3AY0A 1G38A 5K09A 3P14A 1XLAA 3HP7A 3OFJA 5E8JA 3SR4A 2X7VA 5DRYA 3T7TA 3PT9A 4KWCA 3SXJA 4P7KA 4E31A 4M37A 4RSRA 5K0GA 4CXMA 3UJ6A 1KPGA 3LGAA 3I64A 1VQ1A 4YTSA 2OO3A 5DSXA 5CVVA 5ICGA 5IH3A 3QXBA 5J8LA 3CQJA 1XCJA 4HHMA 4U7PB 2PT9A 2G72A 5DPMA 4RTKA 3AJDA 3HCDA 4HGXA 4RVDA 2XISA 2PX4A 5EZSA 3M0YA 3RW9A 5CD1A 2DPMA 2HMYB 3SSMA 8XIMA 5GIPE 3DMFA 1DE6A 3HVJA 4WXHA 4GEKA 1X19A 3KQQA 5EMMA 5FHRA 2DULA 2IP2A 5CVUA 3SM3A 3TOSA 3BT7A 2PGXA 2CMHA 2G8NA 4YMGA 4W4QA 1TPYA 4O29A 3XISA 5E8RA 3ITLA 1L1EA 1RI4A 2ZVRA 2PVCA 2YTZA 2ZBPA 1JSXA 3PX3A 4OA5A 3UU0A 1QAOA 1VP9A 3C3YA 4LWPA 4DZRA 4C06A 1M0EA 9XIAA 4Y2HA 2F8LA 4QQNA 1XISA 1P1CA 3E23A 2R6ZA 1R6AA 5F2NA 5T6BA 3ITYA 4HTFA 10MHA 3V97A 4FSXA 1X1AA 3ER8A 1BOOA 5F2KA 2P3LA 1S5MA 1O54A 4P58A 3TVAA 2H00A 2QRVA 1XIEA 5E1MA 3FYDA 3KR1A 2Y1WA 3TC3A 4A8NA 3QC0A 4GOOD 5EIFA 3GO4A 3VNKA 4PIMA 3H2BA 1RJDA 5T67A 1NT2A 1XCLA 2GPYA 3E7PA 5EHGA 5LQNA 4DA4A 2IBSA 3ELDA 2PXXA 3LBFA 3R0QA 1VP3A 3UJ9A 1DL5A 4E2XA 3C3PA 3MCZA 1DUSA 4XUDA 3LSTA 1AF7A 3I9FA 1B42A 4FR0A 3UBTA 3G2OA 1P1BA 3L8DA 3LX6A 5C1IA 1MJFA 4L7VA 5EEHA 2FCAA 5BXYA 3O31A 1SQGA 2ZLBA 3KQMA 3PS9A 2C7PA 3FTEA 3V8VA 2JHCA 2P40A 3OFKA 2H11A 3CCFA 4IV0A 4LECA 3T0IA 1QAQA 1RJFA 4ISCA 2B78A 3N4AA 4XSMA 4A6EA 5CM2Z 3DX5A 4PYKA 4BLWA 2GS9A 2WA2A 4X60A 3HCAA 4PYMA 3TFWA 5LQRA 2V7EA 3A4TA 3R6TA 2ORED 4ER0A 1KIAA 4K1GA 5DWQA 4A8RA 1EJ6A 1T43A 4HGZA 4PIPA 4R8SA 4R8RA 3OU2A 2QY6A 1G8SA 3XIMA 1NW3A 4HGYA 4KW7A 2PT6A 2PXCA 3KBNA 1KYZA 5E9WA 3KBJA 2HNKA 5DM2A 3LBYA 2BR5A 3P97A 1XLGA 3GWZA 4ZB2A 5EMKA 5U4XA 1BC5A 4EACA 3UJCA 3OZSA 4PNEA 3KPVA 2ZWVA 4YMHA 2Z6AA 2OZVA 5CVEA 3CC8A 3JWGA 2IH4A 3EVBA 1ZHFA 3C0KA 5BP7A 1DE5A 1S5NA 4QPPA 3G8AA 1VE3A 3MQ2A 4DKJA 2XYRA 4OBXA 1XJ5A 2JG3A 3ERCA 4RTLA 2ZZNA 1R8YA 3R3HA 1D2CA 4XISA 3Q87B 2AOXA 2EG5A 4IWNA 4C4AA 2OPBA 1NW7A 1HMYA 3IV6A 1O1HA 4HTFB 4B17A 4YV1A 1YUBA 3FRIA 4DM3A 4F86A 1MNZA 4QQKA 5KYGA 3OBEA 2CMGA 5EPEA 5CVJA 5FTWA 2EFJA 1BKYA 5DT2A 3RODA 5GINE 1F38A 1N7JA 2JHAA 4P7FA 3TRKA 2VDVE 2OBFA 4PYLA 4AZSA 4IKPA 1XLKA 4PYOA 5H02A 1XVAA 4G56A 4K6MA 3M6WA 5HEKA 4RTJA 1I9GA 4CWAA 2B3TA 4FP9A 1EIZA 5GIOE 1UIRA 4GC9A 4LNCA 1XIHA 2GUBA 5XIAA 2AR0A 5ICEA 1YF3A 5LSAA 1IXKA 2JH9A 3MB5A 3CNYA 1JQDA 2EX4A 1IM8A 4DQ0A 2P1DA 5E9JA 3BWWA 2QULA 4KW2A 1KPIA 1R74A 8XIAA 4PWYA 2ZSUA 3UZUA 1VLMA 3EVZA 3SMQA 1ZKDA 4EKGA 3P9NA 2PX5A 2NYUA 5P8WA 4YUXA 2QYOA 4WVLA 2OKCA 3FUXA 5GOZA 3THSA 2JHPA 1WY7A 3VNLA 3EVAA 5FA5A 7MHTA 3U81A 3NVKI 1UWVA 3A27A 4X1OA 2BZGA 4EQZA 5LQKA 4HG2A 4CKBA 4P7GA 3OU6A 2O05A 4HNOA 5D1NA 1I6NA 5EIWA 1N7IA 2ZFUA 3Q7EA 3DR5A 3WQOA 5K0EA 2ZTHA 2HR1A 2AOVA 3GRVA 1ORIA 3UXIA 1XIIA 1L9KA 3E05A 3EVCA 3K6RA 1XYAA 1U2ZA 3CJTA 3C0QA 3MGGA 3GRUA 5C9ZA 4AZTA 3B3GA 3ORHA 2GLUA 2AVDA 3M0LA 3P2KA 5XIMA 1RI1A 3OU7A 4MQ4A 5HIKA 3LDGA 5EGSA 3GCZA 4OBWA 3T7RA 1EQAA 5B7ZA 3ITXA 4FSDA 1XLFA 1XLEA 5K0BA 3IUDA 1XYBA 4BP3A 1QANA 2BM8A 5AVNA 3UA3A 1KXZA 4EAYA 3GRYA 4GLEA 5H6HA 2BR3A 2UYOA 3HNRA 4QDJA 4GOND 3KCLA 1O9HA 3QOXA 2P7HA 2YX1A 3GJYA 3HCFA 3OE4A 4OQDA 3TKAA 3R24A 2EJUA 4F84A 2I56A 3BGVA 3SSNA 5DLYA 2G4JA 5DX0A 3PFHA 5ICCA 4DF3A 5KQSA 2IGTA 2XVAA 2OB2A 3X0DA 3A26A 1SKMA 3FUVA 8MHTA 4GJJA 2PWPA 1F3LA 4X61A 2NNWB 4HRAA 4QDKA 3KQWA 3MCTA 3U3HA 4RTOA 4ZB0A 1M6YA 1RJEA 3UWPA 3VC2A 3LKZA 1D8WA 2OYRA 3CQKA 3DXYA 4GUAA 4PGHA 3HVHA 4GC5A 5KS2A 3FPEA 4MWZA 5EC8A 4YV2A 4RTMA 1L3BA 1TZ9A 2QE6A 3OE5A 3KCOA 4RVFA 3T7SA 4FS8A 1I60A 4DUOA 2ESRA 5FWAA 4P7JA 1RJGA 4E2WA 2NQHA 4QDWA 1FBNA 1XXLA 3FVMA 1ZGAA 2ADMA 2UYQA 2ZIGA 3PX2A 3THRA 2XYQA 4E2ZA 1AQJA 3TM4A 3M33A 1FP1D 4HH4A 5ERGB 4ZBCA 3ITVA 2I9KA 1SUIA 5GWXA 5DXAA 2QW5A 4C05A 1JG4A 3AYVA 2PLWA 3DLIA 4NECA 3VYWA 2C7RA 3ER9A 1KPHA 3TR6A 5MHTA 3FZGA 2WA1A 4DCMA 3IUHA 3LCCA 4EKIA 3HVIA 3NDIA 2IH5A 4XIAA 5LQAA 4XIMA 4QTTB
chains in the Genus database with same CATH superfamily
5T57A 3WX7A 4HNVA 1F17A 2A86A 3HN3A 3KELA 4JTKA 3IAS6 1TW3A 3L49A 1VBHA 4YCLA 1BMQA 4IIVA 2FTPA 3RGGA 4X85A 3M6UA 5AXBA 4LZZA 3B1JA 3REFA 3HPZA 4H9ZA 1GZ6A 5F7JA 3V4VB 1BJTA 1WE5A 4AEEA 4ZVTA 3BIJA 2JVJA 3FGNA 4RQUA 4ZMGA 4Z3DA 3OTWA 4NU5A 3F3MA 2XQJA 2WV9A 3U19A 1IOWA 2QUTA 3JD0A 4AG0A 4BBPA 1CCWA 2VN8A 3BL8A 3OA0A 4CD7A 2JFQA 4TWAA 4Q47A 3RBAA 4ALLA 5F7XA 5A02A 3DUGA 2G08A 3ABIA 3GL9A 2E5FA 2W2KA 4DDWA 3O03A 1JQEA 1RSZA 3RT9A 1UH4A 4HHLA 3NZ1A 5D7NA 3KS9A 1YZQA 2BCGY 1E66A 3W1XA 1P1FA 1KHHA 1XLDA 4C91A 3FJ4A 2QUVA 1VJCA 4GJ1A 5DTMA 3E96A 2YVUA 3AILA 4Z8YA 3MI3A 4BYGA 3GNOA 1GG8A 3D8RA 3DVRX 1XH1A 2DV0A 1WUHS 4AURA 4QECA 3RJZA 2I8CA 2OTDA 3KL0A 2EBUA 3A7DA 4IUDS 3EA3A 1AKWA 1O9GA 2G76A 3WO0A 2NLOA 4YCDA 4BN0A 3CS3A 1JDCA 1AQMA 3MJHA 1XWYA 2D5BA 4D9BA 4RE6A 5DNYB 2BKAA 1E2UA 1V6WA 1UXKA 1FYFA 3ZUGA 1B3ZA 3LDUA 3SWWA 5LYJB 4ECAA 4MDHA 3THAA 1JCJA 1QUFA 1AGRA 2J7PD 1CJMA 1U0LA 3DZ8A 4HN2A 2J7FA 2HBYA 4WKCA 4G67A 3EN0A 1YJXA 3Q8XB 5G4WA 4X6LA 1FS5A 5JSUA 4DMGA 3LCFA 3RRXA 2CC0A 3BGWA 5AM4A 1SZCA 3AY7A 5I3FA 2HCBA 4V1YA 2GF0A 4FX6M 2WLSA 3LAWA 2QVNA 1U2DC 3CZ8A 1EG2A 5L3QB 1XDSA 1Z47A 5CH5A 2OC9A 4LJYA 1KD0A 5HSGA 1DWQA 4QJ5B 3PB0A 2CNWD 4BWVA 4OCZA 3RNDA 3BG9A 1W87A 4AC9A 4DLBA 4A92A 5IYZB 2O07A 1EHIA 3AVPA 4CMGA 1Y5WA 3A2MA 2UY5A 3MCAA 4MS3B 5J8LA 1G8JA 2CW6A 2PT9A 3IELA 5EJIA 3ZWOA 4P4TA 3K35A 3X1XA 4AM8A 5D02A 1B0ZA 4DEYA 1MO6A 2PN1A 1K0UA 3VIIA 3W27A 2ZB8A 3U3KA 1XDJA 4EB0A 1XISA 2MYUA 1K6XA 1FDOA 2P3LA 3H7IA 4WDUA 1QG4A 4BVLA 1B8NA 4DA4A 3EDOA 3ZKWB 1O5KA 4C6DA 2ZWIA 4L07A 3G7SA 1O89A 3VIHA 3OPQA 1X3SA 1CF9A 1H50A 2QW1A 5G4KB 2XUZA 5HINA 1XRFA 4HB7A 2NU6A 3ADBA 2B4QA 1Z36A 4EPDC 4FS9A 1KYZA 1WETA 1J06A 3WK1A 2LNDA 3H83A 1FFEA 5JFGA 1XA3A 3WFJA 4EGJA 4RTLA 2PSNA 5IHSA 2C94A 3H6GA 3I4CA 4O0MA 5CPBA 2HJSA 3H2KA 2ZA3A 1I2CA 2P9ZA 1ICPA 3VCRA 2FSHA 3GEPA 1FFGA 1TSIA 1PIIA 1PKNA 1EP3B 1KSJA 1Z4OA 5BWNA 5FEZA 2X3UA 1CRPA 2CCJA 1W4RA 4URWR 5DW3A 2AL2A 2W6NA 4KLCA 2QB5A 1U6IA 4L5ZA 4AC1X 3MPOA 2ZTHA 4WRHA 1C14A 2BEVB 1ATIA 4JELA 5LDDC 3ZDZB 3UJ7A 1AKYA 5EE3A 1EP9A 3EQ6A 2QDEA 4WMLA 1NSJA 3KCLA 3VDGA 1GT8A 1DAPA 4LW7A 4IQGA 1WUYA 1UBOS 4NX2A 4F11A 3OLWA 3KP1A 4LC8A 4MWZA 1FFBA 3A13A 1OLUB 4EY8A 4RM3A 3THXB 4AZ7A 2YN2A 1VI6A 4OQQA 3CQ9A 4HF7A 3ZR4B 1NQ5A 5J2TF 1S7CA 3ZIAD 1W56A 1NRJB 4GMFA 3GP5A 1SHLA 1R9ZA 5DSTA 1SVMA 1SPBS 2DWQA 2KPOA 3NU1A 4RF2A 3BMNA 2M6RA 4ZO9A 3WH8A 1IB6A 2BAGA 4DWJA 4DCPA 1K92A 2X0EA 3CNEA 1KMHB 3H87A 1E5NA 3AFNA 3BSYA 1VHNA 1DPMA 1V7AA 1UOPA 4ZOEA 1WKBA 4YPOA 1U1GA 3OZGA 4Y9PA 5E2BA 3USES 3F7MA 3PUZA 3NOQA 3NP9A 4YWIA 2OGTA 2Q7DA 2AG0A 2J7CA 3IDOA 1M04A 3PE6A 1ZLPA 3IEPA 2D0FA 3PI7A 3RAJA 4BAUA 3OHMA 1D8TA 3PQ6A 2JBHA 4M1YA 3ICJA 3D7MA 5DHQA 5HIJA 4MAMA 1OIFA 1W1B1 2FPOA 4LRTB 5IJZA 2GD1O 1G6CA 1EJ0A 4Y3UA 1JGIA 3EC7A 1IZYA 2FEMA 3VFLA 5AYVA 4CQ9A 4Z4FA 2UBPC 3V9AA 1XP3A 4QPJC 4S3JA 4CMEA 4J49A 4WWHA 2E1PA 2Y1GA 3EQ9A 1OKKA 3PNZA 3N70A 4YJ2F 4EMSA 3DFQA 3MGBA 1AFSA 3LN3A 1G5PA 3OOSA 3LPAA 2ERCA 1VJ5A 4ZYVA 1LUAA 4HUQA 4BNGA 2HK0A 1B41A 4AW9A 1NM9A 1NDYA 4KVAA 3KO8A 4HQKA 4RSMA 4JLOA 3IEIA 2WM2A 3DKJA 3PHAA 2YW4A 3LXAA 2WFLB 1V4NA 4E30A 4C6OA 1H8HD 3T07A 4AX6A 2P2NA 4D8LA 4D4HA 2QTAA 2PTGA 1A9YA 4DL9A 1A88A 1GKKA 2NXEA 3Q85A 3BC1A 2WVSA 4GNRA 5FYQA 5JH2A 3PWSA 5FEMA 1ZM4A 2XNDA 3QQ0A 4R5MA 1U8CB 4YYFA 2GWNA 5L3ZA 2P6RA 3AINA 3U09A 1K77A 3T06B 3WTCA 4ZJZA 1X1DA 2A5DA 2F17A 3G1SA 1NOUA 4JNYA 4LFBB 1K3TA 2K7ZA 2SKDA 2Q2QA 2HOQA 3PUJA 1EXMA 3KTCA 4TZ6A 3TQKA 5KZMA 2WDZA 5G5IA 4NDAA 3KR0A 3ZV3A 3WQQA 1T4BA 4GI2A 3OSZA 4UM7A 2E5LB 4MUFA 4MSUA 2WTUA 4PO8A 2YUIA 4ZSUA 2WBLC 4J1SA 5KINA 1Q6GA 3RJMA 2O4UX 5ITZA 3KEQA 1XF1A 2VPWA 3OLYA 4KMOA 2WMYA 4B5SA 3UB4A 1QCDA 4KWCA 1JQVA 2DU8A 4MV4A 3W3AA 3QXCA 1G2IA 1ZQ1A 1QNRA 1VHCA 1PZ0A 2GF2A 2YMQA 1DV2A 8XIMA 1UAGA 4W9MC 1WCIB 3QM3A 3KYCA 1EWKA 3KJQA 1LCIA 5LD2B 3QH2A 1XH0A 1ZK1A 2BF7A 5ABFA 3MJYA 4XVQA 2F8LA 4RH3A 5C52B 3ITYA 3HL0A 3P3BA 3LTNC 2DPYA 5BCAA 2JFFA 1OFBA 2FR1A 3HXLA 2EPMX 4HATA 3WGKA 2GPYA 6ABPA 3R0QA 2X9VA 3LRPA 3TU9A 4PB5A 4BOYA 3WNNA 3ZWKA 5EEHA 3VOFA 4Q03A 1POJA 3O3NB 2FWNA 5H0IA 4J0HA 4BLWA 5KVQA 5D9OA 4EYQA 3I61A 4BKQA 4HDQB 4QBHA 4JBNA 1JG7A 4ZGYA 3DDMA 3W4IA 1JWAB 1CQPA 1M6JA 2IEBA 2J6BA 4KTVE 2W6MA 2XPCA 2PX6A 2XG9A 2H9IA 2EPOA 2ZTSA 3N2LA 5IXYA 2QW8A 2I7TA 4P93A 5EHQA 4A4DA 1P2FA 4IGFA 5A5FA 2HE5A 3HBJA 5HEKA 1W5SA 1SXJD 5KYKA 1E9ZB 3EEBA 1BX1A 2OZEA 2R1PA 1HWYA 2BBWA 3TUJC 3OKAA 3EF0A 3VU9B 1E3XA 3OU6A 4RPIA 1SKQA 4MMYB 3SZLA 5FF3A 3S5NA 2JL1A 1XYAA 2DU2A 2O0KA 1Q63A 1TJ0A 3MWFA 3PQFA 1P0EA 5J3JA 1E3WB 1QR6A 1OASA 1IZCA 1XMVA 4JIGA 4YJ2A 1SXPA 4ZEVA 3CLRD 2NNWB 2KLBA 4CKCB 2H1SA 3H24A 2YHIA 3PNSA 1T2VA 3AHHA 3GJ5A 4LX4A 4C3UA 4LRQA 2JJ1D 3HJAA 4F06A 3THXA 1JD7A 1EYEA 1Y48E 1SB9A 1MJGM 3SYKA 3I73A 1QRAA 3R20A 4AZVA 2YINC 1CZNA 3VMFA 4EPVA 1TAUA 4F8YA 4I1PA 1E3TA 4JLSA 3KPUA 3VDNB 3AHYA 1LBEA 2Q9CA 2VOEA 4JR1A 1RBQA 3KIPA 3V3TA 2Y2UA 2FAXA 4H6XA 2HLPA 1B3XA 2PGWA 1ECGA 3AEUA 4F0SA 4IGHA 3EISA 1FRFS 2Y66A 2R97A 3PJTA 5JXHA 3OEXA 1HQYE 4KO4S 3D47A 1YUNA 5IDIA 3VC1A 1UW9A 4PANA 1IB0A 4AL4A 4KO8A 3GC2A 1XTTA 3DAPA 3SCWA 1CZUA 4GG9A 4CF4A 4QTXA 2YVLA 1Z88A 4AJIA 1XXHA 3EJWA 1T91A 3KVYA 3IV8A 3LBIA 4KRUA 4BGDA 1A7UA 2WNQA 3TYDA 3VD7A 4UDOA 2PKWA 2R7LA 3K5WA 1XCWA 2AMLA 4P34A 4MGYR 3X1KA 2GM4A 1ME8A 3THUA 4M7TA 3C45A 3PWGA 3C2EA 3SCSA 3NHFA 2BYTA 3ZGOA 3TBFA 1Y1TA 2IEAA 2KHZA 1JDTA 8CGTA 1D03A 4A2QA 1RYYA 4B90A 2Z29A 2F1JA 4R8KA 1U8UA 1OCBA 5KYXA 3GHTA 3TN3A 5U9CA 2B9VA 4E22A 3UJDA 4MVAA 4E0CA 1WTCA 1TU0A 3UW3A 3M0XA 6NULA 2O8DA 2HU7A 3AF6A 1NW4A 2UVQA 2A59A 4ZCLA 1G4TA 1QR2A 4RNCA 3P94A 1KGWA 1V43A 2D5LA 2O8VA 1YVUA 3LBHA 4AICA 3RJTA 4EB8A 5HMFA 4WZAB 3K5XA 3RH0A 1LV7A 2REXB 4BMPB 2Y77A 3WGZA 2AX4A 4KKXB 4ETNA 4I90A 2RI0A 3DOUA 3B9AA 2JGYA 3TX2A 4IUYA 2GA9A 1D6SA 1JQKA 4YGXB 3QYPA 3TQPA 2VK2A 2CL7X 3BZJA 1IE3A 3RVJA 1DAIA 3VIMA 2PMQA 2PUFA 3I32A 1CZRA 3AAMA 3D2AA 1EM8A 3GVWA 3JZUA 5DANA 2NU8A 3M6MD 3U40A 1UJBA 4D2JA 4MPDA 2NXHA 4R51A 3A4MA 3U4AA 4A2PA 1NXWA 3CEJA 4ZZ2A 1QHGA 3AIQA 7CGTA 1VQTA 5JQWA 3NONA 3ZVRA 1PVDA 2XWDA 2FN8A 4LZWA 4A1OA 1MOZA 2ST1A 2AN5A 3AZOA 4TMTA 3C2VA 3KQLA 2QLYA 4XZHA 4H7IA 3SHVA 1IIBA 1IZ9A 3A6EA 2NP6A 3WD4A 2QNRA 4R0NA 1JA0A 3V36A 4UFLA 4DUGA 3FPKA 3F5JA 4DMKA 3RLFA 2TYSB 3W2JA 1GCUA 4UBMA 5C4MA 4YCNA 4KLZA 1DS6A 3UY8A 3G1RA 4LUTB 1YZGA 1VZ2A 5EZSA 4MYHA 1Q7QA 3FNQA 4UUMA 3CW9A 3HXOA 2XZLA 1MTOA 1U9CA 3PRYA 4KR6A 2VMFA 4ICMA 2HA2A 1V1RA 3AIMA 2DF8A 2G8ZA 2AAMA 4FSXA 4AIIA 4R9XA 4Q9JA 3QU7A 4HVAA 2BB0A 5FEUA 2C13A 3WSUA 4C78A 3WICA 1U0HC 4G0NA 3H5RA 2JJ2D 4WUTA 2ZRWA 2VF8A 3AFHA 4ZVNA 5HNNA 2CFSA 4P7LA 4RGBA 3P19A 3CEUA 1GT6A 4H9YA 4XSMA 2Q0SA 2C8KA 3W7OA 1UQYA 1A5AB 3ETGA 4TQGA 4M9QA 4J4BA 1ZZGA 4K1GA 1WZLA 1X7ZB 1SUDA 4NXMB 4HXYA 5M1TA 4GY7A 1Q6LA 1JUBA 1QK4A 2B4TO 4WY8A 5TB5A 2HHCA 3P93A 3T40A 2FB3A 3USCS 3EXAA 1TA4A 3AVYA 4Y6GB 4BCEA 2DTDA 1W36B 1PZHA 4Q8PA 2ZIXA 1W5TA 2CDRA 1M2JA 3WO8A 2H06A 4IFRA 4GZ3A 2FGBA 1EVKA 5T6MA 4WR3A 1HLGA 4ZT5A 3TZFA 3Q5DA 1OZGA 1WDPA 1WY7A 2EBHX 1XO1A 3HG2A 3M5PA 4C14A 1T8TA 3LNMA 2V45A 2ISQA 2BC9A 4XVCA 1US3A 5K0BA 2Q2WA 1ZONA 1P7ZA 3CJPA 2E3JA 2BEJA 2ZVDA 2EJUA 3K0HA 1T0IA 3MJ4A 1MA0A 1DB3A 2FU5C 2NSLA 2BONA 1P0PA 3PE4A 1DC4A 1HKVA 5JSFA 2P4HX 1TZ7A 2FKPA 4R41A 2ZT7A 3ZY2A 4TGLA 4OQZA 3DEJA 3H2AA 4NCKA 1CNEA 2GKSA 1D1PA 5DXAA 4RIGA 4NECA 4OLBA 2WINI 3B06A 3FDZB 4RKFA 3ZSSA 1UT5A 4KDFA 1T35A 1V3MA 1HEUA 1X15A 4BHYA 1HG1A 5JPIA 1DYSA 4X0VA 1DWOA 4RHCA 4X1IB 4S0XA 2VX4A 5EJMA 1D5CA 4HWKA 4BQFA 2XE7A 1V16B 3PRKE 1M7PA 1TE1A 2NU7A 3UWOA 2DVMA 1P45A 3JQPA 5G4HC 1QCCA 2W6ZA 4Z2HA 2EAWA 5JI2E 3OZ7A 4DN6A 4YHEA 2PIDA 3L4YA 3HY4A 5ADHA 1A50A 1WZ2A 3DLTA 4HH0A 3MWEA 2OWWA 4HJXA 5AB3A 4UTXA 2WJZB 3LHZA 2QTMA 4GLOA 1MRAA 4OKIA 2AF3C 4R8VA 3SR0A 1HE2A 3BAZA 3GZ3A 3AR4A 1CUAA 3P4XA 1IHXA 3TCNA 1J0ZA 1GG1A 1CDGA 4ZANA 1MB2A 4YDHB 2PSJA 1US2A 4U2KA 3KFVA 2WZHA 3DE1X 1EBFA 1F0NA 2NQJA 1ADGA 2PTYA 2Z2YA 2AOTB 4H7HA 1OG0A 2QPAA 2HIMA 4ZVKA 3FHQA 2RI6A 2EKQA 3MK31 4B71A 4HB4A 1N7GA 4MUZA 2AKYA 4S3KA 1FRVA 4X20B 2UY4A 1IY1A 4WNAA 1L8XA 1V6AA 4BFWA 2FFQA 4FDTA 2IIPA 3B13B 1GSIA 3BAIA 2B8EA 3ZQUA 1I1WA 1JAEA 2ZCVA 1WHSB 2EHDA 3ASVA 3WNOA 4JJZA 5IKMA 3NWRA 1M1NB 5D9PA 1X97A 1B16A 3K0AB 2GPSA 1Q85A 5I8ZA 3ZQJA 3GGDA 3LUDA 1RVKA 5AJYA 3W1MA 1ZUD1 2CXOA 1JIXA 2C0AA 1EF2A 4K81B 4M80A 3W2MA 3PJRA 3RYCB 1R1DA 3PWKA 2VGIA 4BO5A 2POQX 3NV7A 1WCGA 4MUGA 2HJGA 5TC4A 1ME9A 5HMLA 3ABOA 2A3LA 3WEZA 1KI6A 3UFXA 4JJ6A 1R6BX 2ILVA 1QH8A 2DZDA 2NTNA 2Z4TA 2QJJA 2DUWA 4AJ2A 3NOYA 3EIQA 4K8OA 2VPTA 1OZMA 1GEHA 4UVDA 2P9YA 2C9YA 4ZTBA 5DNDA 1LGYA 5KBYA 2NZVG 5C8YA 2I87A 5DLQC 3NQ8A 5DBIA 4C7DA 5HWMA 3EEFA 5EP2A 5AIAA 4MMWA 4XBKA 4DXVA 1R4NB 9CGTA 3UEQA 1MF7A 1KIFA 1RD6A 4LJRA 1D07A 3HM2A 2IGBA 2POCA 2JAUA 4A6DA 2Y6UA 1IZZA 3CT4A 5FWYA 5KHLB 1GLNA 3LLXA 3E03A 4KQ6A 3G7NA 1KO7A 1WBBA 4LXQA 4P5PA 1V0NA 5CG0A 1Q0QA 3WRYC 4UTOA 3RU8X 1ZC3A 3MO7A 3DMFA 2NU9B 4GXPA 2XUIA 4JDPA 4W4QA 4D97A 2PP3A 4LSMA 1QHYA 4B6JA 4G5DA 2VTEA 3QLEA 4EF6A 3AU2A 1MEHA 1LQTA 2DWOA 1R6AA 3DEQA 3OGRA 3S70A 1XVVA 1BYAA 2J9GA 1R4NA 2R1KA 4F3HA 3WF1A 2QPTA 1VP3A 1U9IA 1B42A 1P19A 1DC3A 4RS4A 2YV3A 9GPBA 1QAQA 1C9DA 3A9VA 1JIQA 2YV1A 3N4AA 3HPXA 4I9HA 3W6NA 3KWFA 4QYMA 4LBSA 4M3PA 5FWNA 3K9LA 2LCIA 3STEA 3FMPB 1HO1A 4QG7A 3ABOB 1I5OA 4EACA 3N17A 5E7MA 1U6KA 2FPKA 1I2MA 4AMBA 2OECA 3P2VA 3A04A 4FJ0A 1T6XA 1VA4A 1WDLA 4HBKA 3ED5A 1UM8A 2P30A 3T7VA 3WNMA 5LJIA 1QC5A 3VMNA 4MDOA 2QX4A 3ZVIA 3FY4A 4E1AA 4DC9A 3U61B 4HLUA 4KW2A 1O87A 2JAPA 4N7QA 4RPKA 1EYZA 3JS3A 1UCFA 1SMAA 2PKXA 3RWOA 5D1NA 3AVVA 4B7XA 3E35A 4WZ6A 3A2KA 3ZV4A 1O6ZA 4CDRA 3IHKA 4LDRA 4TMXA 1YDWA 3Q15C 5IAEA 4I5IA 4JR0A 2RC6A 5AHWA 2HIGA 4C22A 1Y8RB 1KXZA 2OO5A 2BR3A 1GN9A 4J90A 5LJLA 2V3WA 3LUCA 4H9UA 3STWA 1YCGA 4BUZA 4CEJA 5CJ2A 4Z7JA 1LBSA 3LC7O 1E32A 4ZI5A 1KO0A 4NXSA 5ISMA 5A95A 5KS2A 2Y7GA 3G13A 4DEXA 3GLHE 1R6DA 3FX4A 2NV6A 1ZVMA 3UYCA 5CBPA 2ADMA 3EWXA 1Z4LA 3GHSA 5IANA 1YJQA 3LY7A 2BEUB 3DDZX 2MMCA 1XTQA 4RELA 2XN0A 5CDSA 3TL6A 3BMWA 4JL8A 2FSVA 1Q91A 3R0UA 5LKYA 3FTNA 2C78A 3KJNA 3VO0A 2GDJA 3B12A 5HRUA 4ML9A 3VDCA 3HEBA 5HUPA 4HPGA 4NK5A 3R3UA 2E49A 5BU6A 4PAMA 2Y5SA 1Y7PA 2R9RA 2VNKA 4X1IA 1QFMA 3ZO9A 4X6XA 4Y1RB 3FYPA 3WYCA 3WLSA 2ZFAA 3FA2A 5IP5A 5FNZA 4Y9RA 1EC8A 1MW1A 4O1AA 4KO3S 1PUIA 1TKAA 2QN1A 5LLDA 4EWJA 1ZGCA 3RM8A 1C3XA 4E3ZA 2OVLA 4J5NA 3VNVA 4Q1EA 4RTRA 2JIQA 4BIIA 1L6YA 2IUUA 4GKVA 3G1UA 3R10A 5ELLA 2NOAA 2I91A 2DT1A 2QTFA 3FRHA 4ZOLF 3MXOA 2ZRZA 5ED4A 4C6TA 2PDLA 2NYRA 4I9TA 1CJUC 4FM9A 4H35A 2GK1A 2OD9A 4B45A 3HPFA 2N3ZA 5D38A 3QQPA 3OU8A 3TRIA 2AIRA 1KI3A 5K3FB 4JEHA 3SSAA 2OEMA 4GE3A 1S8OA 1Z5OA 3EMBA 2FKNA 1LNSA 2DSNA 1OFVA 2GZMA 2R7MA 2I55A 3A1TA 1PFVA 1SZPA 1W48A 3WS7A 1S1CA 3WGJA 3SJ3A 3C5QA 3TSOA 2QV0A 4K68A 4QNRA 3JYHA 5FUBA 4DQLA 3ZI4A 3K8YA 1JZ7A 1KI2A 1WAWA 2TPSA 3QM1A 1LK0A 2X4DA 2HPMA 4E3WA 3QKSA 3C85A 3ZLFA 1TIBA 3OO1A 2HHHB 3PA6A 3E22B 3LCJA 1NV8A 5IG2A 1DJWA 2PTHA 1L5OA 3FA5A 3CLUC 2CF5A 1A8HA 3GQYA 2OV4A 5T4BA 1CZKA 4DIUA 4FP1A 2R14A 2C2ZA 4US2R 2UZ3A 4HMDA 5DP2A 4JUCA 4YIKA 2IY7A 3UNDA 2XM1A 2OY0A 1S2GA 1N8TA 3E8MA 1XCBA 3FPGA 4DCVA 2P91A 4IDEA 3BARA 2D2EA 4WDXA 4A05A 2FX2A 2O1SA 3W1PA 3WL0A 1AH0A 4FFVA 4CMCA 5AZ0A 2C1EA 2ZTVA 1CY0A 4OQFA 3S47A 4JUIA 1EGVA 4KCTA 1WDQA 3C8HA 1R0XA 1H5NA 1KF0A 3FZEA 1RRPA 5TF0A 3DHUA 3CH4B 1H85A 3PZMA 2HWUA 1L8LA 3W74A 3LV6A 1ABEA 1WM1A 2E55A 3OC6A 4P7KA 4W82A 4LUTA 3DE7X 5CVTA 4JI0B 1M01A 2G72A 2H85A 2WU3A 2BX7A 4MO9A 1PFGA 2JKZA 3TVYA 3OFVA 4WKNA 3ISJA 2JI9A 1EQCA 3HPAA 1E1YA 4NAFB 5C80A 3V7PA 4CCEA 2HZBA 4JKIA 1I4EB 4I9GA 5LZ2A 5F2NA 5HJLA 5DVZA 1ZISA 1N6IA 3IPXA 3FYDA 1M6NA 4DJDD 1EXBA 2E9SA 2OBYA 4FFOA 4F48A 2IYEA 2BL4A 4YB8A 1D9EA 5A5VA 2C96A 1FS4A 1WXDA 2VP9A 3Q8MA 1RJFA 1W4CA 4RKQA 4MO2A 4BVBA 3B70A 3UK6A 4QT4A 5ESRA 4MV6A 1O95C 3KL5A 5DWQA 4PIPA 2FQXA 3DEFA 1AIPA 2IHKA 3RJ5A 4AU0A 4GI5A 4DX3A 1PDYA 1A8QA 1YQTA 3ZHCA 3PJFA 3W4JA 2EZ8A 1S2AA 4A5OA 2PX3A 3MGCA 2VDVE 4GO9A 3MQTA 1PCXA 4EK7A 3FNFA 2QQFA 1IN6A 4QR6A 4GZ5A 2JH9A 4G1KA 4XQ6A 3HVRA 2UXBB 5IUKC 2BZSA 4CQMB 1JIKA 2YFNA 5T41A 2GZHA 3ZWPA 1P2BA 3GF4A 3RANA 2BW0A 1YTDA 5C7OO 1DJIA 1ML4A 4V1CB 2J0QA 3GRVA 3JUGA 3MWKA 1XH2A 2GA8A 3LDGA 3T6KA 4LNYA 1PG2A 4X9SA 1EH5A 5A8GA 1C9YA 3SW6A 4CIXA 2H54A 5HPOA 1IJFA 2NZ8A 4RMJA 1SUAA 4PMXA 2WWCA 3B8UA 1P0NA 1SRRA 1BFKA 3ND6A 3ICCA 1HURA 2ESRA 3CNHA 4QDWA 3RLHA 3AS1A 1WX1A 4ME6A 1NVEA 2AV6A 3ZWWA 2FLKA 4YRPA 3NASA 3X1YA 4TMZA 2JBAB 4YHBA 3S29A 1J0YA 1A9QA 3BCFA 3L0PA 3N58A 3SBOA 3ELUA 4JIIX 4PPQA 2GN8A 2QLFA 2ON3A 1CULC 4KOEC 1DKWA 2VK4A 3CG4A 3UR2A 5ABPA 3R7AA 2F7FA 3LX4A 4BWLA 3BFXA 1FW8A 4DLSA 2DQXA 3JYLA 3G6MA 4Y2XA 3QN3A 2YZ7A 4E13A 3I4LA 2BJWA 4GUJA 4DBLE 2AC2A 5M5BA 1G4EA 1U04A 2I5PO 1UZHA 3KJGA 1EAYA 4G5OA 3RJ9A 4B8WA 3OTQA 4PXAA 4GH3A 4IPIA 2DERA 4CD4A 4MGZR 2ROQA 3RS9A 2QCGA 2VPXA 4LF8B 2X2FA 5A4IS 2PBLA 4G0QA 1SUBA 2QYGA 4P2VA 3RAEC 1F5NA 4ARBA 3OT5A 3TIXB 3KJXA 4URUR 3IQEA 1XZIA 1C81A 3STHA 1VRCA 4E08A 3CTLA 4O0KA 1JZTA 4YH1A 5GONF 4XPIB 1NQ6A 3ELWA 4DB7A 3D4IA 3HCWA 2B2XA 4MCIA 3OKPA 3PN8A 2X2OA 2YNMA 2C7OA 1E6XM 3U37A 2ZIWB 2PKQO 3T55A 4FILA 4XJSA 4BWFB 4LKRA 4PCFA 1V6SA 2QX9A 1JSCA 1SZFA 2XNSA 3WBXA 5C9UA 3QUAA 4OLFA 2DDXA 4XOUA 2Z7KA 1KVRA 3LWBA 5LKRA 4H60A 2I6GA 5CLGA 5JSZB 1OYWA 3QBUA 4UD2A 1ZU4A 1NJGA 4XYLA 1NUAA 3OKFA 5EEGA 3OQNA 3DDOA 4M36A 1EK6A 3QVUA 5DLYA 1SNYA 1G1AA 3UVAA 4BBJA 1L5KA 4PZUA 4RV3A 2AB0A 1F9EA 2I6FA 4I9AA 2C2KA 4WV3A 1ZG3A 3F3KA 3OPYA 5HK4A 3AQUA 5IVIA 4TZTA 2A5HA 3RRAA 3O1IC 5I7EA 4ZCTA 4DR1B 5KNDA 4O1FA 5JCJD 3TXYA 4ROPA 1BG9A 5EQJB 4C6SA 3SURA 3ENKA 1DE0A 4WJLA 4LXGA 4QEHA 1G8PA 1G01A 1CGVA 4YWSA 4UEKA 2Q5OA 3S46A 3ONWA 3CKKA 3G1XA 2VFDA 2DHEA 4QXOA 2V5DA 1K7CA 2CF6A 4GZIA 1WPRA 5A7HA 3GARA 1HLFA 1NXPA 2BKVA 1RTTA 1B30A 3KVLA 4UQBA 2ZYDA 3TQOA 4IWYA 5FSEC 4UEWA 1UJNA 4HCDA 4FGZA 5SYMA 2UYHA 3W3AD 5IJ0A 1M6VB 4CN9A 5JDIC 3IPYA 1USUA 4JIHA 4GD3Q 2OG1A 3GXDA 4IDNA 1WZEA 1BCRB 4RK8A 3VD5A 3G0HA 3IQGX 3MBOA 4PO3X 3EX4A 1VL6A 3ZDDA 4W1QA 1JTVA 2ZEJA 3PTLA 3E4DA 4L9ZA 4ZQBA 4OV6B 4CMBA 4OTKA 4EJMA 3GAMA 1FWFC 4Q1AA 1LPBB 2A3AA 2XYHA 1U9ZA 4AIOA 2XTJA 1S9DA 2JATA 2TS1A 1EFCA 3WKAA 2P1FA 1F61A 3RPMA 5LGZA 1G20B 1KMNA 3KTFA 4H59A 3UK2A 1O54A 5AYIA 1DMSA 4OHXA 5ALLA 1RJDA 2EWWA 4B3MB 3R2GA 3NC4A 4UMVA 4DBUA 4C0HA 1II8B 4AUNA 3HKEB 1ID1A 3OZAA 3R4VA 1M3SA 5K3OA 5BRJA 2VZTA 4ZPJA 1L5LA 2ZIAA 4A6PA 3GFPA 1ZH2A 2J87A 4CKBA 2B0MA 2Q4EA 1NGSA 1JAIA 1HTWA 2O14A 4NWIA 4MUIA 2GVNA 4X00A 1A8UA 1SBNE 3ZEIA 1WE2A 3G8AA 1TMKA 5B53A 1P6UA 3WUGA 1V96A 1JFFB 1QONA 4LX8A 3VO9A 3RJYA 4CIAA 3LRKA 3CUFA 4Q3DA 3RM9A 3AQ4A 1DFGA 4AO6A 2P0OA 5ABGA 4O3MA 5ALEA 1Y6RA 4PO9A 1WEKA 5K6AC 4JV5B 2XWSA 2YW3A 4PWYA 3P84A 5FAXA 2RH8A 1WCWA 1VFHA 1ZKDA 3W1VA 1PIFA 1WWKA 1UPFA 2VNCA 4AG3A 2PTZA 4DJED 4QUAA 1BCRA 3W88A 2RFGA 5EYPA 5MN4A 1X8FA 3PYXA 2QCFA 4MUBA 4UNPA 1WZIA 4RGYA 1XLEA 3HU3A 2CFTA 5FAGA 4G25A 3WA6A 2UYOA 4HXEB 3S2GA 4PPYA 4F96A 5DBUA 2W00A 4AX7A 3WV5A 2QSZA 2GCPA 3OP1A 5IM51 1T40A 3IBGA 4QOFA 3IEMA 1G9HA 4TM8A 4WRRA 721PA 3KJZA 5AJTA 5BWAA 1GUYA 3I62A 5KWJA 3GX9A 1AS0A 2AJ8A 3I1FA 4HB0A 1OLXB 1V11B 5TIIA 1YKWA 2ZI6A 2Y68A 2ASVA 4NBKA 1A0EA 3HTXA 1TO2E 3CZ5A 2BD0A 2HF8A 1TO1E 3LTEA 3WL8A 2ZCGA 5F1OA 3IHTA 1TRHA 2XVPA 1OADA 4XYMA 4KYVA 3H70A 1AMOA 3S4YA 3WBAA 1HSZA 4NNPA 5KZMB 5H83A 3BE5A 5HNTA 4MDFA 2IY8A 2VXCA 3OFND 2X0NA 3RTCA 4RL3A 1VYHA 3DYVA 2QN7A 4M0LA 4NHVA 3G17A 4AF8A 2H3BA 1OC6A 3EGVA 4AJEA 4ZXFA 1GTEA 4UTNA 3ZTWA 3EGCA 1IEWA 4RMGA 5FNVA 4IL2A 4CFYA 1VHJA 1A5TA 2ZX8A 4L4OA 4F40A 5K6RA 5K51A 3NW9A 1VDMA 3KYBA 5JYBA 2BFDB 3PFFA 5C1DA 1HG3A 2VBCA 5JAHA 1U2SA 3BSWA 2ORVA 4MCAA 3M82A 2CLKB 2XU2A 2W8BB 4JT9A 3N2GA 1PT6A 3H5LA 4OHVA 2PNFA 1TRDA 1QHEA 4UM8B 2HC9A 3FF4A 4XO6A 1VPLA 3GBPA 2UXDB 3KYDA 3UWVA 1A9PA 3CBWA 3AUJB 3SC2A 3RUDA 1T15A 2ZZ1A 4XIIA 3FYUC 1R5NA 1BVUA 4HX5A 3FWZA 4QBFA 3T5GA 2BDTA 5EE1A 4NCBA 2AYYA 4RE2A 1ZY9A 2VJAA 1ENZA 4RQTA 4WLOA 1FJ2A 1MABB 2PS0A 2X7WA 4V03A 1ETUA 3PZIA 4JAWA 5D3KA 1GZ1A 3N9KA 2VC2B 2Z98A 3EVGA 4NG5A 1NULA 3ZHVA 1JR2A 3REOA 3OVPA 2HXUA 2WJGA 2D73A 1US8B 5K9XA 4LYAA 3I04A 1IWAA 3LO8A 5I3ZA 3TSZA 1YB2A 2WSIA 3H04A 3VV2A 4LSZA 2CNWA 1DWFM 1QOZA 4IJQA 1WSDA 4BB5A 4DEFA 1QK0A 3OVQA 2ADAA 1UF9A 3BRWA 2ONKA 3NDJA 2J8ZA 3L7MA 3LNTA 4D6JA 1PHQA 3DXZA 3AFIA 3Q6IA 4LMPA 4R31A 1WZMA 2E6FA 2VZOA 4HCLA 5ALWA 4DRXB 1BFNA 3RHZA 3GG0A 1VJ1A 3UVIA 3ETLA 1XQ6A 3HO1A 4KH1A 3SIWA 1QI5A 2OK8A 1L4HA 3R8GA 1CY1A 4XZMX 3P0FA 4DJTA 1VIDA 4AD1A 4WBSA 5LL6P 3LI2A 1B8UA 4I2VA 1L8NA 2QM3A 4B31A 2GJKA 4WXRA 3DZ1A 4X0EA 2W2MA 1HE1C 2HRZA 3V1UA 4BQIA 3TNFA 3CAWA 4HK5A 2P6NA 4ZCQA 4IAOA 5ICMA 2FPVA 4R2KA 1B2LA 5DYTA 3PJUA 3M9WA 4GGHA 3GRCA 3BK1A 2BGKA 3PD7A 5AVVA 3ZK8A 2E6UX 2H0AA 2CDAA 4YRAA 4GEGA 4OLJA 3DQPA 2CK3A 4KRTA 2ODNA 1ONEA 1N6LA 3E1GA 3ICEA 5ALUA 4QAJA 3EZ4A 2H00A 4DBLC 5EJEA 3EY9A 4KAXA 4D45A 3BM5A 1PP4A 1ITUA 4L9SA 4HHEA 3P1JA 2EHJA 3JARB 5DGHA 3T3PB 5LGXA 3KEFA 4I7UA 2Z8ZA 2JHCA 4BJHB 1VYPX 1Z8FA 1U8EA 9LDBA 3Q6NA 1F2UB 2HBVA 1H60A 1VCMA 4HEJA 2XD9A 3WK3A 1IU9A 3BDAA 3EA5A 1ZCFA 2LGJA 1FWAC 2QP9X 5FV7A 2EHHA 3V2IA 1ZK3A 3LRXA 3KG2A 1SU6A 3OOEA 4PNEA 4MH0R 3H4TA 2FE1A 3KXIA 4OSOA 2VF4X 4L6HA 1E0SA 4A27A 1L4LA 2W2TA 3Q87B 3NKFA 5FL7D 2YHAA 4RHTA 4O4IA 3I4KA 2R6CA 5BW6A 2KS6A 4ED9A 4N3AA 3RS3A 4DQ0A 4IG2B 1ONSA 5CB0A 5IAAA 1Y80A 3LGDA 3S1WA 4LCRA 4NG4A 1FP4B 5EZYF 3RYIB 4NS1A 4GQGA 3AMLA 1LA2A 2QMZA 4YREA 1Z0SA 2PH1A 3CPHA 1OZQA 3K0FB 4MWTA 4G1CA 4DLVA 3K70D 3OHSX 1XYBA 4ATWA 4D8ZA 2PDAA 2X19A 3DE0X 4YJDA 4EAYA 4FYHA 4RZ5A 2VUUA 3L6EA 4RVNA 1MMFB 1CUSA 1E71M 4OSEA 1RQEA 3ZW7A 3O4RA 4LBRA 1S2UA 5EC8A 3SCTA 4XJTA 3ZOKA 3OZVA 4TMWA 2AQKA 4AJNA 2KX7A 2IPMA 2NQHA 2XYQA 1V6XA 5AVRA 3A06A 4I1OA 1OWOA 5DDIP 5DNUA 4XIAA 3EKZA 1CENA 3LXBA 1GKUB 2PDHA 3HKCA 3E5PA 3EUAA 3CU5A 3NEPX 3M0VA 3G8YA 3FPFA 1W5MA 1MI3A 1QI0A 1YR7A 4NZZA 2C1IA 3K3PA 4CHTA 1SBTA 4RC9A 1QPBA 1SIOA 5J40A 1J8FA 4WJKB 2CUTA 3WSVA 3N74A 2VEPA 2OCLA 4Q4JA 4LDZA 1I9CB 4GMHA 1K8ZB 3EIWA 3DZIA 4B7CA 2FZ8A 3O8NA 5C35A 3LP6A 3H4XA 5TPZA 4CEHB 3QQWA 2R65A 3WXMA 5DT5A 2ASEA 3ZK9A 3DMNA 2V7VA 1NG1A 4F0LA 2VQ6A 1FU4A 3THWA 2VH2A 4YJ3A 1MC8A 4B92A 2PZEA 1DL3A 2VPQA 3D3NA 3AF3A 3HDTA 4IUGA 1SUPA 3KOZA 3HJNA 1JEOA 4FNAA 1HTIA 4AZHA 3CWNA 3PFWO 4DV1B 3VYRB 2X1SA 3EOLA 4WESB 4CLOB 3TQQA 2YWDA 1QTWA 4QM6A 5AMXA 5TY0A 4AZWA 4H6WA 4D1JA 5HS6A 2P0IA 1RXUA 4UPVA 1E4IA 4C6RA 2GYVA 2CHRA 3FJLA 3JWHA 1TKCA 2NXIA 3BCSA 1XN1A 5E7QA 2F43A 3ECCA 4QLOA 4LOKA 2FWMX 4OBBA 5JASA 3PIDA 1X8CA 1RWOA 2XA2A 4BMCA 1QP7A 4CKXA 5TRTA 3BAWA 4Q33A 3OJOA 5CG7A 4JBLA 1YAJA 4WJEA 1KZ6A 4BO8A 4NNBA 4GBGA 2VCBA 1R3SA 3H9BA 2PKQP 3PQ2A 1M2WA 4TYPA 5JQGA 1YUMA 5U1PA 2CVOA 2C3YA 3TIVA 1NWRA 5IM4F 3KX6A 3ZGLA 3IESA 2VEIA 2MINB 3UCXA 5L9AA 3U60B 1TC2A 1FSPA 3PBMA 3TTSA 2P2LA 3KOUA 2N47A 2XSBA 4Q4OA 1H94A 1E6LA 4AYXA 4LJ4A 1IXRC 4FXSA 2V8BA 3I28A 4GQBA 4AAJA 1REQA 2TMDA 2BUCA 3HBNA 4PN7A 4IM7A 4FXPA 2Q5IA 2FZCA 1TECE 2PH5A 1RBAA 2GJRA 1FTQA 3MW8A 1QATA 2W93A 1PKYA 4XFDA 4J76A 4AD0A 1SO3A 1OFEA 1Z56C 4QDMA 1GQLA 3DE4X 1UWIA 3L4BA 1WUTA 1SQFA 2PWYA 3CH6A 3VPHA 4M9ZA 4KEAA 2FZ5A 1KAGA 5AICA 4CL3A 3S55A 4UUOA 3JQGA 3M7IA 1OSEA 4HWSA 5EJ2A 2GBGA 1FVXA 1VQ1A 2H59A 4R84A 4CMHA 3NM5A 1VPXA 3A6DA 5ARDA 4X7PA 2GYWA 5LNSA 1OZ0A 2FRDA 1XBYA 1UP6A 5BN3B 5E8RA 3AETB 2FLIA 3RC3A 4B15A 2WKGA 4URHA 4AN4A 4Q4AA 4OB7A 2F8MA 1PQUA 2PDXA 4DNXA 1QU4A 4IXXA 5LM3A 5HHTA 1FMCA 2Q7XA 3RFAA 2QRPA 2MJLA 2H3DA 3VABA 3T9BA 2GZ2A 5H91A 3TB6A 3HB5X 5JYDA 3LFHA 3NPVA 2V7UA 4QBGB 2NLIA 4TL6A 3UZZA 5IARA 3LQKA 5AHMA 2W8BA 3SQLA 1TZ2A 5EWLB 3K9CA 3QFFA 1YDMA 4DZ5A 1KOGA 4FFPA 4HQVA 2OXRA 3AXKA 2D24A 2Y1CA 4G07A 5DEOA 4MQ5A 3GVQA 4GVGA 3NM4A 2ZKIA 1Z44A 1GJPA 3TUUA 3IPCA 4AVOA 1GA4A 1U80A 3IKMB 5JY6A 4ZAGA 1X77A 2VUSA 1Y8QA 2CNBA 1PDOA 2PQ6A 2ODQA 3W7GA 3DDCA 2WD9A 4M8IA 1TX0A 1BYDA 1NNI1 4DJAA 3FKKA 5SY9A 4KLAA 4JJKA 4L3WA 4QBKA 2ZSUA 2V6JA 1U9JA 1WBHA 2R2GA 2OFXA 1N5MA 5EFOA 1XD2B 1PNRA 4XD5A 2ZCUA 1U98A 2CHGA 4HG2A 3B9DA 3WRYA 1NVBA 1UOQA 3QVSA 5DMLA 2ZE8A 3QBJA 4B43A 2XMPA 5J5AA 3I9MA 1CXKA 1F48A 2DUAA 1NF0A 4EGQA 4OM8A 4FCCA 3GLGA 1J8QA 4PS0A 1PEDA 5AC6A 3U2QA 4S3BA 4E4UA 2ZM6B 1E9RA 2P9FA 3NBKA 4JASB 1VB3A 1CTNA 4MDPA 4V38A 2WVVA 3IKTA 5JAUA 1Z45A 3JQ8B 3BPWA 3U9LA 4IGNA 3IDFA 1FUYB 5EVCA 5H5JA 3VVGA 3EE6A 3T34A 3QVWA 5LOVF 4RZHA 2RB5A 5ERGB 2PLWA 3RRZA 1Z68A 3C52A 4GP6A 4M7SA 4K38A 1GZ3A 3KVVA 1KXVA 1AGPA 3UWQA 5A6SA 3I5UA 3N59A 1H1NA 3W7LA 3T3NA 2VJKA 2HRWA 2X8RA 2D1YA 3BDVA 4W7VA 3MHPA 1SBQA 3I58A 2PB1A 5JCPA 4GRIA 4L5IA 4JT8A 3IVRA 5A8OA 3M0EA 3EUWA 3LWNA 3UMBA 3UERA 3T35A 3CJRA 3F0TA 1Y9EA 4MWAB 3ESAA 4L51A 5JBIA 2OOKA 1GDDA 2RK6A 1RVDA 3BUSA 4DIOA 1FNCA 1G20A 4FYMA 3P6LA 1HDYA 4EJ0A 3RR1A 3W7JA 3UESA 1UPCA 5FI3A 4Q7EA 3T5MA 3TG8A 2FVKA 2YV2A 2HMSA 3BLIA 3EOBI 4O2RA 5C31A 1E5JA 1UUFA 5C8YF 4R9OA 3X2EA 2W92A 2W6CX 1M2FA 5AJZA 1PWEA 4KRGA 4CFSA 4E4PA 3GJ0A 2BSQA 3JZIA 3WNBA 1FCJA 3HTWA 4AMCA 1FDIA 2B94A 1YQWA 2O57A 1DARA 2K87A 4FKMA 3STCA 4H2CA 2NXGA 1Y98A 3EEZA 4BFLA 3AC0A 4FYIA 3O94A 4W6ZA 4HDMA 3QOYA 1DIHA 5CCZA 3L4SO 1R86A 4JYEA 3SR7A 2JGQA 1FX0B 1PZ2A 3ANUA 4TKLA 1FVOA 3KM8A 3E2MA 3HYCA 3NTVA 5JNSA 2Y99A 3HGMA 2ABWA 3QW3A 2GARA 4IGEA 1F60A 3GQBA 5FADA 1MX1A 2Y6VA 2RH5A 3TLAA 1ZFNA 1YULA 3K9FC 4JXXA 3L8ZA 4J2HA 2FEXA 4PAGA 1THGA 3RTBA 3TTYA 4YJKA 4D8YA 5CJ5A 5K3FA 4QGCA 4QZVA 1PQ4A 1VI2A 1RYHA 1LD3A 4BB9A 4BE7B 1U7WA 3A9IA 1XELA 4WBNF 1U5AA 1GDHA 4EJFA 5ITVA 4JU8A 2RGRA 5AHKA 4QBIA 3HNOA 5KOIA 2FP4A 4ZU6X 2Z3ZA 4QODA 2A14A 3NC0C 4QISA 4WZAA 2XBLA 1OR8A 4UASA 3G59A 4J1TC 3QMSA 4CM1A 3H4IA 4NY1A 3TLXA 2E5WA 3L05A 1R5JA 3FH0A 4KO1S 1H2FA 1CXEA 1D4AA 2YQ5A 2ATMA 1DC8A 1J07A 5ECYA 5JS1A 1UZ1A 3RS5A 2VF2A 1CNVA 3COTA 3PIRA 4Y8FA 3WL1A 3PHHA 3CIVA 2AN9A 2FPMA 4RUBA 2OHJA 1R0CA 3EFOA 1Z8AA 2N9UA 1G2PA 4OMDA 3P74A 4JEUA 3ZZ0A 3B8VA 3Q11A 2G25A 3H9JA 5HUQA 4D9PA 3CWQA 3S2IA 1RKXA 5MN5A 3LH5A 1G7CA 2GEUA 5KVSA 1PZ3A 3W2UA 3WTBA 4YTSA 3IMKA 1U2RA 3FYSA 1LY1A 1MX5A 2AC4A 3E5HA 4DKXA 2GLXA 4A3YA 1OCNA 4DLYA 4EW3A 4UCGA 3UPTA 4GM1A 2VNHA 2Y1LA 4BKRA 2O7SA 4F38A 2AXPA 2ZBFA 2VNSA 5AXCA 2G4LA 1IYXA 4UUPA 5TVGA 3NOEA 4HGPA 3DBPA 3ZJKA 4CLRB 1NY5A 5AKLA 5I6DA 4ROSA 1J8DA 2UY2A 3BFJA 1OFDA 2FETA 4NCAA 4NZNA 4ISCA 1KAHA 3RSQA 2DWCA 2MSWA 3ST7A 3T95A 4MVXA 3R9XA 4LBZA 2ID4A 1PCWA 2WB4A 4ACYA 2PUVA 4R8RA 1ITCA 3U2CA 4JQ1A 4INPA 4MP3A 2BKUA 2UYYA 1K06A 4YAGA 3I10A 3Q3JB 5IJWA 4ENPA 4IHJF 4Y6PA 1TKBA 2JG3A 2GRAA 5A9SB 3FWHA 3PHJA 4JX8A 5FT9A 4C3VA 3EOUA 1H23A 3GHHA 4YYEA 4K6HA 3FKSA 1TT5A 4I50F 3UHOA 4CM9A 2YASA 2GOYA 2XUPA 2LCQA 1E5VA 3E84A 1R38A 4OJQA 2FMIA 2YPIA 4ZE5A 3KEMA 3DE3X 4EG5A 3JRWA 3C8UA 4F9FA 2C4UA 4P31A 4N9EA 3F3SA 3SRFA 2JGFA 4C6JA 1S1PA 2E40A 2F61A 1QYWA 1NJSA 1LKZA 3N0TA 5TSDA 3SSNA 2XPKA 1GZHB 3IAFA 4JVOA 4Z17A 5K4GA 1QF6A 1F8UA 3MILA 2BV9A 4PGHA 1L9XA 4JTTA 5LZLA 3H4WA 3MPUA 4FFWA 4BNHA 5BURA 4P7JA 2ACQA 2EO7A 4DWDA 3UUFA 5KNBH 1W4LA 1AQNA 4DPMA 1Q2SA 3R7WB 2HDHA 4WJ8A 4Z1MA 3UGTA 4HLQB 2FWPA 4OSPA 3T4EA 3U2ZA 3QHMA 1PJ2A 1YAHA 3HLYA 3L8MA 1W0MA 2X14A 1NAL1 3CUZA 3AALA 3NJRA 5TGTA 5EL1A 1KQNA 3C24A 2WBGA 1YHYA 4X1YB 5FYDA 2ZE3A 3BS4A 1B31A 1Z0JA 3B89A 1SK8A 1R2RA 2O9RA 2B21A 3DEZA 2JK1A 4TKUA 4KMRA 2CWXA 4GE8A 1DG9A 2C77A 3OT1B 4IMJB 3LS9A 3AHXA 4L0QA 1SBHA 2VP5A 1R27A 4G1NA 2RHWA 1RPAA 3CSUA 3AI1A 1W1IE 3UPUA 5LKAA 2BMDA 4ITVA 3R76A 5EMJA 5FJTA 1JHVA 3K09C 2C9DA 4YP9A 1D0VA 3RG2A 2GL5A 2O2EA 1WQ4A 1PJRA 4V2UA 5IF3A 4FU0A 4LF4B 3IJ8A 1Z5WA 3VOIA 2WVVB 5CNIA 1YKSA 1J11A 2VA9A 5JYCA 3MJCA 3HKBA 2B25A 4ID9A 3QKZA 3GFGA 1XRSA 3RSFA 3OF5A 4ASTA 2J9YA 3LGSA 3BKWA 4BQ4A 1BROA 4ECLA 2FPYA 1HPLA 1NVGA 2BF4A 3EBLA 1WZKA 2V9DA 3BOXA 2IEYA 2ATXA 1KVSA 2ZRVA 2HI0A 3IAM1 5FHQA 1YD7A 4RV5A 2HXSA 1ZP4A 5C5CA 4FDMA 3KS6A 3DEKA 1U8XX 1UDWA 4IICA 3EXFB 2ZAIA 3ZDEA 4MAZA 1L3IA 3GUHA 2J3LA 1K66A 2XYLA 1UBFA 4B6FA 1M73E 1F51E 2BKLA 2WWYA 1WXHA 3DHFA 2VKTA 4I4TF 1PNTA 2QD5A 4DCSA 3NC1C 2VL7A 5KVAA 3DKVA 1F6YA 5CW1A 1ODLA 3NDOA 1IY2A 1H3GA 3ZR4A 1MUCA 4IS3A 4R2JA 1YC2A 4PE8A 2JW5A 4JLVA 5IVKA 3TJLA 3GUGA 4EYGA 5KAPA 2WANA 3WJ2A 2EC5A 3S7TA 2P8SA 2QSUA 1WU8A 5GPRA 3HSSA 4BO6A 4ZVVA 5LYRA 3ZBUA 4ER3A 2X8JA 1CNFA 3WL3A 3VPCA 2XF2A 4QD3A 3U7VA 4WX2A 2XE8A 2J66A 4K0KB 1M76A 4RYDA 2W0UA 3CRNA 4OHMA 1TMYA 3KVOA 1H2EA 4PNPA 1KOJA 1E3ZA 1KC1A 3DR3A 5D2WA 1X1CA 1FKXA 3KV3O 3GXMA 1E7WA 2ZRFA 1RSCA 1KI8A 3CNNA 1CIVA 3A3YA 5E0FA 1MJHA 2B5OA 4J2MA 4E5YA 3NGMA 3BMQB 5FL3A 5KSZA 1T6NA 2H1LA 4UVIA 3GOQA 4N0PA 1NR5A 3PPIA 2WVHA 4R1TA 3QVQA 3DYIA 3CVJA 4FPSA 3TI9A 4BATA 5EFZA 4Q4CA 1ACLA 1XRNA 5B6JA 8ABPA 3Q2KA 1ODCA 2H5IA 4PTNA 3I9KA 2WB2A 4Y9TA 2LKCA 3HB1A 4PRTA 2HLNA 2V30A 1A3WA 3CO8A 2RGMA 1TTIA 3AP2A 1ZUNA 5CMLA 5CNJA 1PK9A 2JD0A 1SQGA 1JPVA 1MBZA 3MJDA 4KFRA 4O1MA 1SVKA 5HE9A 3GLKA 1ICIA 5HKKA 3RTDA 2NX3A 4LCBA 3KWXA 2Q50A 4W5QA 1FX0A 5COQA 3XIMA 4FDVA 4H3SA 3T3EA 1Q1ZA 2HPHA 1N57A 2I5IA 3WDQA 4HAOA 3M49A 4XGNA 3MHUA 4M19A 1JDAA 1UXGA 5EKDA 5A2BA 1JWBB 1UWKA 2GZ3A 1E3EA 4FDUA 4AHOA 5AESA 4ZAVA 3CMFA 1ENYA 3MRVA 2L17A 4H17A 4JZKA 1A8SA 2GTHA 4IIJF 4ABTA 4FP9A 3AHCA 1QBAA 4CNSA 5F1UA 1VLMA 1J0BA 4DM4A 3BOSA 3D5QA 1DKMA 1OTHA 3PF3A 3WMLA 1QH8B 3TBKA 3V4LA 3CNLA 4JJEA 2PD4A 1GQQA 2PGDA 2RHOA 3Q8LA 4E15A 3V1TC 3HZRA 3H5IA 4IBOA 1UXJA 3ORHA 2Z8YM 3APYA 1CFJA 3MJRA 1FSSA 4XB6B 3OODA 2A35A 2JGLA 4DA8A 1FWRA 3RSHA 4GI7A 4EB3A 3OJ0A 2GN9A 2C2WA 1L4FA 1XOIA 1U11A 3N3TA 4KQFA 5I7WA 2W3ZA 4J7UA 3M33A 5EBAA 3V7UA 4HWRA 2X5XA 2ZX9A 5D9NA 2XTNA 4Y6OA 3Q40A 5HJ7A 1V5GA 1MV8A 1MPXA 2BEKA 3AWIA 1U0FA 2GBCA 2DEPA 5EZQA 1Z0UA 2GO1A 4MVJP 1PR5A 4LW8A 1XZDA 2B30A 2GOUA 4OBTA 2BBTA 4MRMB 4WBNA 2W6RA 1N5KA 1GEQA 2O92A 3KVRA 3M2TA 4QTZA 3SCRA 1YNQA 1NZDA 3WGMA 1SOMA 5TARA 3EXEA 5CA1F 1Y5RA 3DV9A 4KIFA 2ZJ7A 3E9MA 2J9FB 4YUVA 3WFAA 1QNQA 3FPCA 1J6OA 1U63A 3LWDA 3MT7A 3DHNA 1DRWA 1G4HA 2CMKA 1F8YA 2P27A 3LLMA 3WMBA 2EATA 2HZ7A 1EU1A 5I7SA 1ZL1A 4QQ3A 3MZ2A 2ZTUA 3FBWA 1TPWA 4IDHA 1IXOA 1R8JA 1W581 3EIEA 5EWLA 4GYYA 4GKKB 4QU5A 3TRJA 2IXDA 3RABA 2C3MA 1XI3A 1YS6A 4UMFA 1P4AA 4YJGA 1EJWC 4PMDA 3AHTA 2Q0XA 4OE7A 2HDWA 4DMHA 5CDTA 5I7VA 3NJ4A 3D6MA 4ZQOA 1OU0A 1X70A 1H0SA 2YL6A 2BHNA 1ZJWA 2O5CA 2VT0A 4DADA 3O4FA 1NQKA 1NSYA 1QO9A 2FRDC 2ZJBA 1RKUA 2PWHA 3ZLGA 2J5BA 2O2ZA 2DQYA 1E15A 2XUGA 4GMXA 4AXNA 2O8BB 2DPHA 1LRQA 1EIXA 1BQGA 4FE3A 3TG2A 4M0EA 3NTOA 2AA3A 3NBXX 1L7XA 4RO0A 2GUGA 1Y3IA 4M87A 1YZYA 2G5TA 4U5XA 4JIPA 3C3MA 4GINA 3KTOA 2I5GA 4Q7BA 1NBOA 2OC4A 1YXMA 1DTWB 1KEPA 4QAQA 1GGHA 5IBXA 3DBRB 2G9ZA 3P7YA 2A58A 1RHJA 3E8SA 1GQRA 4IX2A 1KAOA 3ESYA 3WSTA 2WPDA 2XYVA 3CNBA 3RMEA 1FHVA 1DIBA 1GILA 3UG5A 4OH7A 4R7WA 2DT3A 4RIFA 2OLAA 2QDGA 3UANA 1COZA 4FOTA 3RFTA 1U1JA 1K02A 4ZCMA 5CLHA 1LJ8A 2FEKA 4FZ3A 5EMLA 1QRUA 1VIYA 3K1DA 4XK2A 1PIGA 3PPWA 3CVXA 1XYCA 2GFTA 2QLNA 1M9NA 5LVAA 4YR9A 5AVYA 3W2GA 5DQPA 3CB8A 2AX3A 3WJZA 3S1SA 2AN1A 3WIOA 3EIFA 2A0WA 4PH6A 3G8EA 5HOQA 4P3NA 1QAMA 1GEEA 3FMOB 4QG8A 3M83A 3NXLA 4HUTA 3V4BA 3EZYA 3ZUPA 5CFPA 1D4ZA 3LCRA 3AI2A 3IP3A 1TWIA 2VWQA 3AL0C 4Y8VA 1KM1A 4GEKA 3SR3A 3ZJVA 1OEPA 2JAWA 3S1GA 2P3SA 3T4XA 1LLWA 1LV8A 4BIMA 3SDZA 2ZE7A 2E21A 5JZMA 4RL6A 3H2BA 3W9UA 2O48X 2E4UA 2Z1MA 2Y1HA 1UWAA 2WG1A 1OU4A 1WJGA 4ZMRA 3G3DA 4W1RA 3U16A 3PJWA 2PLMA 3Q65A 3R7FA 2X8JB 1CRQA 4ETMA 3T2OA 3DZDA 2H4ZA 2JK2A 5AYZA 1K97A 2B7QA 1BQ4A 1RH9A 4EITA 2EF0A 4N2YA 4MVWA 3ARRA 1HL9A 2I5QA 2JPDA 3SHTA 4UQAA 1GNVA 3L93A 3KKNA 3S0JA 3UC9A 1HMYA 5AYBA 2ZBVA 5EPEA 2P9JA 4JFSA 1Z06A 3MT8A 2HCFA 3RHTA 2PS9A 1O96B 3IV7A 3GK0A 2XGIA 4JYZA 1UXIA 4KKXA 3Q1LA 4M0DA 2Z1DA 2B2NA 4B6PA 4QUBA 4FKBA 1GPMA 2QAGC 2ANBA 1RUSA 3WQ8A 5K8JB 3AUUA 3NVKI 5LIXX 1OGIA 1R9XA 5M5DA 3M5VA 3NS7A 2GF9A 2JDIA 3LQ1A 3IR6A 3H5VA 4TO8A 4N8EA 1PG0A 1BLIA 4QOIA 3ALFA 3HA1A 2AL7A 2Y6ZA 3H1PA 1K3UA 1CK4A 2VP6A 3PDUA 3UHFA 1Z7WA 3AVOA 2NZUG 4OMFG 1BE8A 1R2TA 1HF3A 4JS3A 3CR7A 1W1YA 3O8QA 1L5ZA 4JFVA 2XUCA 4D8TA 3BCJA 3O6VA 5IMBA 1D8WA 4A1FA 4ZKDA 2NLYA 4D8WA 4C6CA 3DFKA 1V71A 1ST2A 3T7SA 3AU8A 3R11A 3TM5A 4AUMA 3TINA 4J4TA 4GWKA 3VYWA 1PE0A 3AY6A 2NUTB 2BJHA 2DOKA 1P81A 2JLCA 4F71A 5B12A 3HJRA 1UASA 1VHDA 1KS9A 3D1JA 4P6VF 1HZZA 1ADBA 3HEMA 3FPJA 4TU1A 4KEZA 2WJEA 3TDMA 1QH0A 1VSUA 1YFLA 3BWCA 4MUAA 3KOOA 2A21A 2EZ9A 3DW3X 1KK2A 1WXYA 5E95A 2E82A 1P0QA 3HPQA 3OPVA 4R1NA 1BSIA 1MRZA 5IFLA 1WP9A 1FJHA 1Q15A 3TMAA 2HSJA 4WZHA 3GH3A 4CUKA 1OF1A 4MZ8A 3E3MA 1G3QA 1QIEA 1BYBA 1RM0A 1ZWLA 1OWPA 4AMYA 3K8KA 2H1HA 2ZWMA 4BV3A 4QGFA 4FFNA 2DORA 1A69A 5DBHX 3B6IA 2OLHA 2VHLA 3GRKA 4ACZA 4URXR 1N7HA 3GRIA 4M99A 3W77A 2FZ9A 5AKHA 3VBCA 2PRLA 2X1UA 4HFMA 4V0SA 1VH7A 4WH0A 2BY0A 4FYPA 5AW0A 1RK6A 1VENA 5G2IA 3GW0A 1Z5UA 3JD1A 4PMJA 5HKBA 3WGTA 4QA9A 3COSA 4M22A 1JEDA 1QHHB 4EHBA 4UUIA 3GTFA 2WKQA 3EWDA 3C3AA 1YFZA 4PYIA 4AFYA 3HJCA 3JQAB 3I9JA 2GHQA 3DERA 1DBPA 5EE5B 4RF4A 3WNDA 4CN8A 5KWEA 3BB4A 1JYFA 4ZA2A 3AMKA 2A7NA 2NG1A 1J20A 5I01A 5DMMA 2W6IA 2I54A 3LM7A 3TLBA 3B6MA 4D3XA 5JANA 4RX0A 4KQMA 2JI4A 4LE2A 2WNIA 1T7LA 4QPNA 4CQ8A 1P4JA 4PRWA 4J0GA 4YCCA 4JB0A 4K9KA 5EVJA 1V26A 1FNDA 3NL6A 1ODJA 4L4UA 1TIPA 4N3GA 3WLJA 2BLEA 4PINA 3KU1A 3GXIA 4X54A 1UJ2A 3OZDA 4U28A 2P77A 2F3SA 3AHIA 3SJNA 4N7JA 1T3HA 2CW5A 2EXOA 4UTKA 2RJGA 1QJ4A 3G1WA 3DMYA 1AY0A 1D7OA 2ZA1A 1DCFA 4CG1A 3PWIA 1UIPA 4NAVA 5D9MA 4CLMA 1T34A 2NPFA 3LA6A 3GC6A 3SFZA 2FOIA 2WMDA 1FHUA 1ADDA 1ZB5A 2R96A 1EXVA 2J88A 4RNFA 4MUJA 4RPGA 1TVLA 1CDZA 2D5CA 4EATA 4W5ZA 1NM5A 1EVJA 2A94A 2VT3A 2G9NA 1EHCA 3CPUA 4PS1A 2QD1A 4FT2A 2OV1A 5A71A 3WY9A 3L65A 1CUDA 2OLJA 1GKYA 1XHGA 2G0NA 4PTXA 2PV0A 1YNOA 2Y71A 5H7XA 2YH2A 2PUEA 2W71A 4RY0A 3V4ZA 3CK5A 3FNEA 2VCHA 4KFTA 3KL3A 1X94A 1XIMA 1AZSC 3EF3A 4ZO4A 1GRNA 4BUJA 1TEXA 4O4IB 3FFXA 4BC1A 1F4HA 1T5TA 2Z8XA 1OSNA 1OC7A 2OOSA 3QEBZ 1Z6AA 3ZFHA 2V6GA 3M0YA 1NMYA 2HMYB 4JH0A 3JW8A 3CZKA 2J9XB 1X7XB 4UAJA 3C5HA 1GCIA 3HBAA 1KDPA 4KXWA 4O2BF 4K8GA 4RK6A 2X4LA 4JX5A 4QJ5A 5FPPA 3SE7A 1H65A 1FOBA 3WDLA 3V42A 4D5EA 1AE1A 3SIPA 3MCVA 2QGFA 1R66A 2QRVA 2XA1A 4BWLC 2ICAA 3JR7A 3FG9A 3U7JA 1E0XA 3C7TA 4ZT7A 4XAGA 2JFZA 2VSXA 4D8VA 4JJ4A 3GC4A 1PK8A 5THQA 2VDJA 1H6BA 5GZ3A 5ERYA 2IHYA 3PVSA 3WGQA 4E5DA 2FMNA 3KV1A 3GLFE 1XKQA 4EW2A 4UATA 4AECA 2CYAA 1H2AS 2XNKA 1E3JA 2HQOA 3EGXB 4L4LA 3MUAA 4DREA 3GNPA 2GXSA 3AFMA 1JZ2A 1XZCA 3BXXA 2R5NA 3MT1A 2XVXA 1X9GA 1CBUA 2OPBA 1UBNA 4MULA 4GLJA 1KKMA 3IDSA 4QUEA 3R3SA 4JSYA 4TTGA 4L8VA 4IKPA 1NVUQ 4B5LA 2PA3A 3PG8A 1QKIA 1E3QA 3B51X 2XJ7A 3AWNA 4FWTA 2V69A 1JIIA 1QW7A 5JJ5A 3FKRA 4ZZ3A 3SS9X 2FMUA 1VYRA 3SAZA 1RYBA 2C9CA 1C3EA 1HRKA 1ZNNA 3RO7A 5IDVA 2W63A 3MLEA 4N7BA 1DTWA 5CYFA 5LHFA 1W1VA 3ENQA 3OC0A 4IP7A 4CU8A 1BCSA 3IBSA 2ZZNA 4M6UA 2ZXUA 5EA9A 3U9SA 3HZOA 1R0MA 4OI1A 3E0VA 1ONRA 1V1MA 5JTUA 2NUWA 1H66A 1T8RA 4OQDA 4L8LA 1O7JA 2PRMA 2XXAB 2V7BA 4LXFA 2EGUA 2HQRA 3RVNA 2F9RA 4Y2VA 1KJNA 2F00A 4ZO6A 2IU6A 3EOOA 3CN9A 3RRMA 3HVHA 2W9MA 4NCNA 4B5KA 2XGOA 4HLCA 4XX0B 1Z28A 3V32A 2W79A 3LHTA 4K9QA 3WH9A 1O95A 2E9MA 2G09A 4G5RA 5K3AA 3GZ4A 3GHRA 3OPNA 3W5VA 5JVDB 3IPLA 4UDYX 4Q93A 1O5OA 4MKNA 5GM1A 3UMVA 3S27A 2E8ZA 1YDYA 1YOVA 3MMPA 1VA5A 3LT0A 3G89A 2P9HA 3OIFA 3L2OB 1W31A 3PFKA 3QXHA 4HPNA 3H7UA 3DD5A 1ORVA 4ZCRA 4UOEA 5FPTA 4RMNA 1NU8A 3I09A 2EW2A 2WE7A 4GVPA 5KNCA 2OZPA 3CJQA 3EZ2A 1XLVA 1SD2A 1BD0A 4UMBA 2GSHA 1VYTA 2C2BA 4TYQA 4EMBA 3M34A 1SULA 3A70A 2TRSA 3AVQA 2BBFA 3SPXA 3GNLA 2J3DA 1XBTA 2FX5A 4AWSA 5AQEA 3VYLA 3AVUA 1WDRA 1JXKA 1E55A 2PDCA 4G0PA 3QV1A 3EVNA 2EJWA 4LYJA 5CXUA 3ZIDA 5E4JA 3THWB 4P3YA 4QYWA 4HK4A 5E1BA 4EHLA 1YCF