5EMJA

Crystal structure of prmt5:mep50 with compound 8 and sinefungin
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 207
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emjA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emjA02
3KQTA 5HIJA 5K03A 1R6AA 2OB2A 4HGYA 5CIYA 4IV0A 3BGIA 3E8SA 4OA5A 1XYLA 2UYOA 4ZB5A 3G2MA 3KBJA 3OZRA 2NYUA 2AOTA 4HSGA 4QE1A 2H11A 2YXDA 1JG4A 3CJRA 4HGZA 3G8AA 1P1BA 1T43A 3BWYA 4KIGA 4E2XA 4EKGA 1YX1A 2C7OA 2P7HA 2BR5A 2AOWA 2OB1A 4QTUB 1N2XA 1BXCA 5HILA 3C3YA 3ITVA 3VNMA 3VC1A 3SXJA 5K0NA 3BWWA 2AOUA 3LKDA 3UVAA 2G71A 3VNJA 3LPMA 3TQSA 1NT2A 8XIAA 1ZQ9A 3EVAA 3OFJA 4KDRA 1FP2A 3B3GA 5G02A 1SUSA 4QDKA 8XIMA 5DRTA 3GRRA 1XLJA 3UBTA 1A0DA 3NWEA 5DX0A 5FQNA 2AZTA 3EVBA 1XIEA 4WVLA 4RTSA 3G2PA 2NP7A 3E7PA 4V0QA 2YXEA 3C6KA 2EJUA 1RJGA 5HFJA 1H1DA 4A6DA 3GDHA 4QEHA 1DUSA 2PVCA 3TR6A 2HK0A 1MJFA 4GOND 3P2IA 3VYWA 1DIDA 1R74A 1JTFA 4CTJA 1SG9A 3EMBA 5DXJA 4RVGA 1XYMA 4LECA 2GLKA 1G38A 3AY0A 3HM2A 1KP9A 3UZUA 3NTVA 2AR0A 5K01A 4FSDA 2KW5A 4GEKA 3A4TA 2ZIGA 4PGGA 5CVDA 3HCAA 1VP3A 1XLDA 3DXXA 1G60A 1XIBA 3KPWA 3P14A 2FHPA 1B42A 5T67A 5LQKA 2YR0A 1UFKA 4WXHA 4LNCA 5GINE 3PFGA 4QPPA 4XKMA 3E23A 2IDJA 2BM8A 1BHJA 3AXSA 5ICCA 2O05A 5CVJA 4C06A 2HNKA 4FP9A 2OY0A 3LKZA 4HNOA 1G8AA 2EFJA 4FZVA 5LQJA 3XINA 3C6MA 1FPQA 2IGTA 4IWNA 1KYWA 2PWYA 3QC0A 4L7VA 2B25A 3EEYA 5CVVA 4EMSA 5EMJA 3CKKA 3SSOA 3XIMA 2DPMA 3HCDA 3HVJA 3Q7EA 4CKEA 5EKUA 4H0NA 2X7WA 4P7KA 2AVNA 5HZMA 1A0EA 4DKJA 5DSXA 1WZNA 2I57A 3IHTA 3Q87B 5CVEA 2AN4A 5LSAA 4QPNA 2ZBPA 3BWCA 3FUWA 1NV8A 4QE5A 3A7DA 3HA7A 3P9IA 2R6ZA 3MCZA 3P9KA 3B3FA 3THSA 4PWYA 5DM2A 2Y1WA 4RTRA 2PT9A 3GRZA 4QEEA 1VLMA 4GC5A 5K0BA 4R05A 3KBMA 3LCVB 3CC8A 3FYDA 2JHCA 3UJAA 2GYIA 3EMDA 2HCVA 1VPTA 4C4AA 5F2KA 4IV8A 4PNEA 5GOZA 4ZB0A 2FPOA 1XCLA 3NVMB 1TZ9A 3OU6A 3UJ7A 1WY7A 3M70A 2Z6UA 2O07A 4U7PB 3BWMA 4XCXA 5EMLA 1EJ0A 3HVIA 4CWAA 4US6A 1F38A 3QYSA 3HCEA 1IXKA 3KQYA 1V39A 3G2OA 2PKWA 5D1HA 5K0JA 5E2AA 1O9HA 2QRVB 4GOLD 3PTAA 3BKXA 4HHMA 1FP1D 4HTFA 5XIAA 1DL5A 3HCCA 4MHTA 1KYZA 5KVAA 2YUIA 2AS0A 3FPHA 5EMMA 2AOUB 2O06A 3NDIA 2P35A 4GUAA 4AUKA 4OX9Y 1XIIA 5EZSA 2VDVE 3C0KA 3F4KA 1XICA 3LDFA 4KW2A 4EACA 4CXMA 3TFWA 3ITLA 4HH4A 5H6HA 3R0QA 2BZGA 5CUQA 5GWXA 2PT6A 1INLA 1JR4A 1JQDA 3ELYA 3LBFA 2QUMA 2OYRA 3DMHA 3AYVA 3S68A 3JU2A 4J4KA 2BR3A 3T7SA 3M0YA 2WA2A 4RVFA 4BLVA 1RI2A 1KPIA 3B7PA 4ZBCA 1QANA 2HV9A 3FUUA 4KWCA 5E1OA 3O4FA 1Q0TA 2BH2A 2O0LA 2V74B 2CMGA 1ZGJA 2JH9A 3DXYA 1RI3A 4EAYA 1XIJA 2QULA 3TVAA 3C0SA 2Q02A 1NBHA 2QRVA 4GF5A 1RI5A 2IP2A 5E1MA 4YUZA 2NNWB 3L8DA 1M0EA 4KDCA 3BKWA 2P8JA 6XIAA 2PBFA 3K6RA 4GBED 3PX2A 3UA4A 2XVAA 1L1EA 3RIEA 3P8ZA 5DT2A 2GAFA 1I1NA 1I60A 1K77A 5B80A 2AN3A 1JQEA 7XIMA 3BANA 3GRYA 3C3PA 4RX1A 5EOVA 4P58A 4DA4A 1XIFA 2I9KA 5E1BA 1XDSA 2EX4A 3KPJA 5FTWA 3SR4A 1NV9A 1JQ3A 3M6XA 3B3JA 9XIMA 3G7UA 3CQKA 5HOQA 4GC9A 3AYTA 2XINA 3ITOA 3DP7A 3UJ9A 4F84A 5JUWA 2EJTA 2ZLBA 2GS9A 4YV2A 2PXAA 3P97A 4CTKA 5EZQA 4BLUA 3ER8A 3HA3A 2OU4A 1G55A 2P3QA 1NKVA 3CCFA 1Z3CA 5CM2Z 5FHQA 2AOXA 3ORHA 5EIFA 5KQRA 4RSRA 3UJ8A 2IH5A 3BT7A 4YV1A 1EIZA 4AX8A 3NVKI 4E33A 1OR8A 1TPYA 3UA3A 3KPVA 2FK7A 3DXZA 5C1IA 2XYVA 2QYOA 1R00A 3A26A 1PRYA 2O57A 1XVAA 2B3TA 4O29A 5LQRA 2BM9A 3CNYA 4C08A 1L9KA 2PX8A 4POOA 3UJCA 3PT9A 3TPZA 1XINA 3FZGA 3LGAA 5B7ZA 3V8VA 3U0HA 1XYBA 4QVKA 3M33A 2ZDSA 4YMHA 4YUWA 2JH8A 3FUVA 3KR9A 4Y2HA 3KBSA 5D1NA 4FGZA 4HG2A 3KBVA 3LECA 4ER6A 5XIMA 3FTDA 4CKBA 3GRUA 3NDJA 8MHTA 4C05A 1ORIA 2H00A 3BGVA 5DM4A 5EIWA 1XLIA 4RVHA 3BXOA 4XUCA 4ER5A 3T7RA 3FVMA 3BZGA 4ZB2A 5AVHA 6XIMA 1X19A 4QDJA 3EEOA 5XINA 1BOOA 5DWQA 2ADMA 2PJDA 3I5UA 3KQQA 3LHDA 1L3BA 4GOOD 5DTQA 4DZRA 5DX8A 2PX4A 2CWWA 2G8NA 1KXZA 3JWIA 2GPYA 2ZSUA 3M6UA 4FT2A 5HIMA 4E2ZA 2JHAA 5CCBA 4C04A 3FTFA 1SQFA 4NECA 3BZJA 4X1OA 5LQCA 4BP3A 1IY9A 4C07A 1ZG3A 1X1AA 2GA9A 3DOUA 1JG2A 3LDGA 3QOXA 5HIIA 4ER7A 1EJ6A 2CL5A 2I7CA 1MUWA 3P2EA 3GRVA 3FPEA 3I58A 4W4QA 4M37A 1X1BA 3EGEA 1XLEA 5K0CA 2ZZMA 1R8YA 4RTPA 3IUHA 4GOMD 3CQHA 1XJ5A 4LWPA 1XLFA 2PSSA 1TW2A 3IUIA 1RJFA 2IBSA 2HK1A 2X7VA 4RTQA 4Y30A 4DM3A 1S5NA 3DLCA 2C7RA 3EVDA 5ICGA 3JWGA 2EG5A 3ERCA 1A0CA 1WG8A 3G89A 1JSXA 2PWPA 2PXCA 2QM3A 5K8VA 1MNZA 4P7GA 5FWDA 2YTZA 5E9JA 4M36A 2OXTA 2A14A 3TRKA 5FADA 1JSZA 3JWJA 4AZVA 3EVFA 5GIOE 4QQKA 2NXJA 4DUOA 2YXLA 3TM5A 4YUYA 1YUBA 5EEGA 3G8BA 2P1DA 3SMQA 1QAMA 4FT4A 2JJQA 1ZHFA 3DH0A 3ER9A 3EGVA 3IEIA 3K0BA 3R9XB 1ZKDA 4DCMA 4X63A 5P8WA 4YTUA 5DLYA 4PINA 1XIDA 3NGFA 1BXBA 4U7TB 3GO4A 2VZ9A 2PV0A 3HEMA 3OCJA 4OVXA 1R18A 3CVOA 3ME5A 2Z6QA 1AQJA 4KRGA 4GJJA 3KQPA 3P2KA 1XLGA 3UU0A 1QAOA 5K09A 4Q7IA 1FJXA 3M0HA 3OBEA 3MCTA 4R6WA 1JG3A 3GNLA 3KWSA 2B2CA 3EPPA 2P3OA 3M6VA 5FCDA 3HTXA 5M5BA 4PCAA 5E9QA 3AWIA 4PYIA 4A8RA 1TW3A 3X0DA 1XLBA 4YV0A 3HVHA 1ORHA 2J6VA 2ZVJA 5K0EA 3MHTA 4G56A 1Q0SA 1JG1A 1Y8CA 2IPXA 5EHGA 1D2GA 5DTRA 3U81A 3HNRA 3REOA 2B78A 1N7IA 3UJ6A 3GJYA 3SGLA 3R3HA 4M38A 1D2HA 3MGGA 1YF3A 4PGLA 5FQOA 3FUTA 3P6LA 4E3VA 1NE2A 3LDUA 1QUMA 1M6YA 4XISA 3KHKA 3FYCA 3RODA 5HEKA 1QTWA 2WK1A 3A25A 3CGGA 4R6XA 4PYOA 2XBMA 5KQSA 1XTPA 1XIMA 3KTCA 1DE5A 3KQWA 4UOEA 1HNNA 1M6EX 1YB2A 2JG3A 1YFJA 1NW5A 5E1DA 3KR2A 3PFHA 5U4XA 2PY6A 4FS8A 3M4XA 1BC5A 3TC3A 3KR0A 4OQEA 3LMZA 2PGXA 3B5IA 3V97A 2HR1A 5FA5A 1CLKA 3C0QA 4QVGA 2H1RA 1GW9A 2ZIFA 3OU7A 3SSMA 5EHIA 3U3HA 3HP7A 3MTEA 5KS2A 2V7EA 3EVEA 1G8SA 3GU3A 1SVUA 4OBWA 4HGXA 3DBNA 1QT1A 2CKDA 5E8RA 2XYQA 2Z6AA 4IKPA 1XYCA 1NW8A 3EVCA 3KU1A 5BXYA 4RTJA 4HRAA 3GGDA 3MTIA 1XP3A 2QW5A 3PS9A 4RWZA 5LQUA 1XISA 5E2BA 3UJBA 4KIFA 1PJZA 4KW7A 5EQJB 4XSLA 3P9NA 1EAMA 4EK9A 3MERA 5F2OA 4PYQA 4A8NA 4EKIA 1NW3A 3MQ2A 2FK8A 4X60A 4BLWA 1I9GA 3DMGA 3OZSA 3ITXA 1KIAA 1VBFA 2ZTHA 1FBNA 3KKZA 2Q41A 4QTTB 4B17A 5TNVA 1SUIA 2AN5A 1UIRA 3DULA 3GNXA 2Y1XA 5DSTA 5T64A 4YMGA 2QUNA 3R6TA 1XIGA 4K1GA 1XYAA 4P7FA 3WQOA 4V0RA 4PYJA 1P39A 2AVDA 2HMYB 3E05A 3AAMA 3ANXA 3N4AA 3UJDA 4PIMA 4M7RA 3LCUA 5LR6A 2ONYA 3G2QA 4E2YA 5ICEA 5DX1A 5J8LA 3BZBA 4E32A 3GCZA 4HC4A 2VP3A 1YZ3A 3FRIA 3OE5A 5H1WA 3P9CA 4ZTBA 1D8WA 1NW7A 4E2WA 1QZZA 2LD4A 2PX5A 2GVEA 3ELDA 3O31A 4R8SA 4EQZA 10MHA 2P7IA 5F2NA 5FHRA 2G70A 2UYQA 3G88A 2VDWA 3GXOA 4FR0A 1AF7A 2I62A 5T6BA 3OZTA 3EVZA 4RTNA 9XIAA 4GQBA 4MWZA 5EVJA 1O1HA 1XLKA 2NQHA 2VS1A 4PGHA 5GM1A 2YX1A 4MIKA 1O54A 2XYRA 3TKYA 3FUXA 2ZWVA 1AV6A 2QE6A 4RVDA 1X1DA 4FSXA 2ZBQA 2ONZA 4LWOA 3PB3A 2UYCA 1DCTA 3VNKA 4RTLA 2PX2A 3KCLA 3DX5A 2ESRA 1SKMA 5DPMA 5GM2A 5HIKA 4A8IA 1XLCA 4OBXA 4QDPA 3ITYA 3CJTA 4JXJA 3UFBA 3KQVA 3FPGA 5BW5A 4AZTA 1KPHA 2OBFA 4R8RA 3CBGA 4PCLA 9MHTA 4YUXA 2ZVRA 1AQIA 2G4JA 3OU2A 4OQDA 3TM4A 4AZSA 4DMGA 1QAQA 1VQ1A 4XIMA 3VNIA 2FRXA 3KQOA 5CD1A 4XSMA 5K0LA 3MB5A 5I7GA 3DUWA 3HCFA 1MHTA 5H02A 1DIEA 1VP9A 4QE4A 2F8LA 3G5TA 3QOWA 4XUDA 4PYNA 4YTQA 2WA1A 3VYLA 5EKXA 3SVZA 3TOSA 2ZZKA 5FULA 3SX0A 3T7TA 1XIHA 4PYLA 1RJEA 2NP6A 4QQNA 1OADA 1QYRA 3G5LA 2R3SA 2ZIEA 1RI1A 4KVZA 5JR3A 2IH4A 2HTEA 3NMUF 1DXIA 3FPJA 3LSTA 4MTLA 1L3IA 3QZAA 2NXCA 2GLUA 1RI4A 3EGIA 1WS6A 2I56A 5ICFA 4YUVA 2C7PA 1RJDA 3JWHA 2B9EA 4PIPA 2BR4A 2IIPA 5DTMA 5MHTA 3AXTA 2DULA 3KBWA 4X61A 3A7EA 3I9FA 2NXNA 4PFHA 4YTSA 3KPUA 3O7WA 4K6MA 4E70A 3I53A 2ZBRA 3LL7A 5E9WA 3TKAA 5LQNA 3SSNA 2K4MA 2C7QA 2IBTA 1D2CA 5AVNA 1NW6A 3VC2A 4XUEA 3M0LA 5K0GA 3VSEA 3IUDA 1VE3A 1P1CA 1P91A 2G0WA 3GIWA 3EVGA 3OE4A 4AZWA 1SQGA 1I6NA 3ELWA 3ITTA 1NBIA 5DRYA 2AOTB 5IH3A 4QDWA 3AALA 1KPGA 1F3LA 1KHHA 3BWBA 3LCCA 2NQ9A 1N7JA 5FA8A 2ZFUA 4ER3A 1X1CA 3KCOA 5EPEA 1EG2A 5EEHA 1G6Q1 3TLJA 4ER0A 1L3CA 3KCJA 4F85A 4DVOA 3H2BA 3HVKA 5EMKA 2ZCJA 4OA8A 2ZWAA 3ELUA 3I64A 5B7YA 1BKYA 1WXXA 3UXIA 2JHPA 2FCAA 3NWBA 4X41A 4LG1A 2UYHA 1YFLA 2VDUE 3AJDA 3PVCA 1XLLA 2GB4A 2GUBA 5KYGA 4BY9E 5EGSA 2QY6A 2OKCA 3BGDA 5EC8A 3THRA 3QXBA 3M0MA 5BW4A 1JTEA 3LX6A 4EVIA 2YVLA 4BP1A 1XDUA 5IKMA 3UWPA 2GH1A 3TMAA 3CWHA 2ERCA 4DCGA 3M0VA 2NQJA 2OZVA 3OFKA 2ZULA 4ATNA 3CQJA 4E30A 3WSTA 5B1SA 4YTRA 4PYKA 2XVMA 3IYLW 5CCXA 5GP1A 3DLIA 1XLMA 2IFTA 4A8LA 2PLWA 2YQZA 4HTFB 1XDZA 4GJIA 4PONA 2ZZNA 2I6GA 1XCJA 3MAGA 3DR5A 4GLEA 2IH2A 3C0LA 1ZGAA 4K3ZA 2P41A 2IDKA 2P3LA 3DMFA 5ERGB 3FPFA 1R8XA 4MQ4A 4CKCA 3FTCA 4C03A 5C9ZA 2CMHA 3FTEA 1IM8A 3KPYA 1S5MA 3M0XA 2ORED 1XXLA 5FUBA 3M6WA 3NW9A 3RW9A 3T0IA 2NXEA 1DE6A 3DTNA 3GWZA 4Z2YA 5C0OE 4A6EA 5K05A 3FRHA 4RTOA 4XIAA 5FWAA 1I4WA 5EG5A 3SM3A 1UWVA 3PX3A 5BP7A 5LQAA 3PLAE 3D2LA 4RTMA 2P40A 4E31A 1VL5A 1XLAA 1KR5A 3IV6A 2ZW9A 2G72A 5E8JA 4RTKA 3L23A 3KR1A 2XIMA 2OO3A 3CJQA 3R24A 4RYLA 7MHTA 1EQAA 1YZHA 4DQ0A 3XISA 2PXXA 5DM1A 3OPNA 1HMYA 2FYTA 3ID6C 3LBYA 4DF3A 1XLHA 3HCBA 4YTTA 3P71T 3KBNA 2XISA 3KQSA 2OPBA 3B89A 5CVUA 2AOVA 3VNLA 5DM0A 5K0FA 1O9GA 2G1PA 3BDKA 5GIPE 1WXWA 1VIDA 2E5WA 3BUSA 3HA5A 4ISCA 1U2ZA 5DXAA 3KQMA 4HHLA 3QV2A 3NJRA 4PYMA 2N47A 4P7JA 2HWKA 4RV9A 4F86A 2UZ4A 3CQIA 3A27A
chains in the Genus database with same CATH superfamily
4O0ZA 4JFAA 3KEHA 4AY8A 2VQSA 4CKXA 2HI0A 3TOVA 3H8SA 4GPD1 4B7ZA 3K8YA 1XKLA 1EDEA 2PWBA 3MJYA 3K15A 5HZKA 5JYBA 1NT2A 3NA8A 2W83A 5FOOA 3C6KA 1UD2A 3KBOA 1BVWA 4YQZA 4KQ2A 3DAHA 3A4VA 4B2DD 2X23A 4EF5A 3F5JA 1GZVA 3HJGA 2IV7A 3HCAA 1WCXA 3W8EA 2P9ZA 4RMGA 1J2JA 1SIBE 3HBMA 1X8JA 2XCIA 1L1RA 1PO7A 3W7EA 1U5BB 4BGDA 1ZD2P 4CD7A 3LGGA 2IXFA 4QPNA 1Z17A 4F2UA 2ZBPA 4YN3A 1RKUA 5C7LO 3KB6A 5DM2A 3PPHA 5GOTA 3HGOA 3NOEA 2POCA 3J81A 3BCRA 1WY7A 5K9CA 2D59A 2P1RA 1KM2A 4FI3F 1FTWA 1B8OA 1ADCA 4RHTA 4M1SA 1HKHA 3ZGVA 1AMYA 3MP4A 3R0QA 3EWAA 2AW5A 2RAUA 1TECE 1KM5A 4IIHA 5K2ZA 2D5BA 4ZTUB 1P9WA 4JI4B 3LY5A 2BE7A 5DCBA 3AL2A 1QMPA 2YYUA 3U3MA 5E1MA 1F05A 1O4UA 1ZC3A 3SJ7A 1NPDA 3IT3A 4MWEA 1A1SA 1BPLB 1J2EA 4G8DA 1WZCA 4G6CA 4EXBA 4OQXA 1DG9A 2E4UA 3DMRA 4OHCA 1TPYA 1UADA 5K4AA 2HOQA 3HGMA 4URHA 3PT9A 2D20A 3C2YA 3E9YA 4JB0A 3RS3A 3EDKA 3GZTB 5C53B 1RVKA 4Q1DA 3T4UA 2CE7A 3CS2A 5EXSA 5XINA 4NU8X 2A1TR 3KAKA 1G3UA 3L46A 4KXNA 4WXYB 4EITA 3PEWA 2WMGA 4EHKA 3MWCA 2RIRA 3W7IA 2BKAA 1LX7A 1APBA 2YHSA 1UKAA 5JAZA 1SO6A 1NTOA 4AJ2A 4JXKA 4Y30A 1L7OA 3MWJA 4PLPA 2BMJA 4U7WA 1J70A 2YFQA 4TOQA 4UULA 1ZDMA 2WTMA 4UBOA 4Q9DA 5I4BA 4GKAA 5FKYA 4DELA 1ILEA 3SRDA 4MKFA 4G36A 4U3JA 4GVGA 3K0BA 4I4LA 4YYEA 4AG6A 4QJ5A 4GNJA 3SMVA 3EFOA 4IDQA 1RA0A 2OG9A 2ZJ1A 5C34B 4OVXA 4XX0A 2OO7A 3ITNA 1T40A 4JB2A 3PDCA 2IC5A 5MFZA 4RAOA 2GJSA 4MWOA 1Y4ZA 5D38A 3TH6A 2UZ9A 4J0KA 4JI5B 4BEBA 5I6SA 3HXTA 3C6QA 3DUGA 5KYYB 1FFEA 2FFBA 3AL0C 2W2OA 1VE9A 4AJ4A 5LL6P 4W88A 2VXCA 3KJQA 5E38A 3C0QA 1V08A 4GQ0A 4PUJA 1OIWA 1Y7IA 2Z00A 3QLVC 3EZNA 2DSNA 1U1JA 2ZA1A 4FP1A 3N34A 2M9MA 1CP3A 2QTAA 2ZTHA 4CGYA 4UNPA 4Z49A 3OPXA 1XIGA 1JDBC 1W46A 5HJEA 1NLMA 3S2EA 2ONYA 1L5QA 3EGDA 4OXIA 4COKA 3OUUA 1WR8A 2FPVA 1K6MA 4D4JA 4ZT6A 3UJEA 4WCFA 1ZHOA 5CBBA 2I6UA 4IQFA 4XSGA 4EB8A 5FBVB 3ZX5A 2LKCA 4UAJA 4EGQA 2VZEA 1NONA 1RP9A 1QO7A 3F78A 1U2GC 1TV8A 4IS2A 1EPUA 1H2EA 1U8ZA 1X39A 3NASA 4A0FA 2YX0A 4DL9A 1ZZGA 1Y1KE 4TZTA 5HF6A 3RE1A 2ZUEA 4CMAA 4GPZA 5TR9A 4L4MA 3NMUF 1DXIA 1PFYA 3MELA 4IH3A 5BNWA 4JT4A 3CO5A 4KF1A 4TT8A 1N8TA 3DDMA 1CQPA 4LTSA 2BF7A 5K0GA 5LNUA 3S2CA 1CTQA 4UCGA 2XH8A 3MMPA 5LA1A 1AMNA 2ZI7A 2AOTB 1MB0A 7ADHA 2QG6A 2XGJA 3MKCA 1TJPB 3TL2A 3A9WA 2BJWA 3QW4B 5FUVA 4KQMA 1Q16A 3OZYA 1EJVC 2WIDA 4IHJA 3RUPA 2DRIA 5F52A 4BDTA 2JLWA 5J4KA 5BORA 3NEAA 1XZBA 2GHQA 4IFTA 5JZVA 4RZHA 2ZETA 3R7WA 4MIEA 5IYZF 2P62A 3ZVNA 4ECEA 2QGZA 1N3BA 2R60A 3O4VA 1H41A 3LY7A 2C1HA 2JZOA 1I3CA 2TMDA 1SAYA 1JAHA 2X1VA 2PCQA 3LO5A 2YJGA 2IU3A 3TYBA 5A69A 3BSSA 3WYDA 1E4EA 2XXAB 3IIVA 3WHPA 1WX1A 1N2BA 5AVJA 1X15A 1M8JA 1V3UA 4ND8B 1S4QA 1B93A 1E5DA 4X8LA 4NKRA 2OB2A 1VSBA 2H54A 4MS4A 3VA8A 2XMQA 3L0SA 2FLIA 4NS1A 2BISA 2BBFA 1JLKA 3H19A 1EX9A 3B03A 1E92A 1F3OA 5AM1A 1PLJA 3ABQA 5BWLA 1TQDA 1VFUA 2VL4A 4KDRA 2VATA 4PPNA 7REQA 1JKXA 1TVKB 1J90A 4QUEA 1UJ5A 3UXDA 1U3TA 3T42A 1RJGA 4RULA 1O95A 3TB6A 3S9ZA 3U7FB 2IZ7A 4RVGA 4R83A 4BLRA 1JRBA 2JLYA 1KP9A 3PZQA 4FFPA 4XV0A 1OAOA 4WXHA 4O25A 5IFLA 1LTQA 2QJJA 2AZMA 2JIPA 5K99A 4K28A 4HMNA 3XIMA 3IHLA 3L0NA 1JB9A 3WGLA 2AL1A 3NEPX 2J4GA 3A7DA 2HTFA 2HXUA 1G20B 1I8JA 2Q21A 2QYGA 2H1OA 3RVRA 3D5HA 3TLLA 2FMNA 3OBBA 4YMSA 3QW3A 5TEVA 1EJ0A 2CZEA 4N7QA 3DQQA 2ZXEA 5J63A 4FFOA 5LIXX 4QUAA 3JZIA 1G66A 4ETIA 2P35A 4PC6A 3E12A 3L4JA 4K05A 2IUSA 1OZHA 2XGIA 2WXDM 1EO5A 5C1OA 4KKXB 3WDSA 3I04M 4IUGA 1KKMA 2O8BA 3N25A 5I7EA 4PO3X 2H4WA 2PZAA 1FXQA 5L4SA 1KI6B 2WU4A 3QPUA 3AMKA 3B3JA 2ZB3A 2QQ0A 3ENLA 2AFHA 2VUIB 3WO1A 5FUXA 3KSBC 5MF5A 3J7AC 2V5BA 3N9SA 4TL8A 4XG1A 1YDFA 4IFKA 1J2BA 4QOHA 1TTPB 2WJ3A 4G5SA 4KI7A 2PX8A 4D4HA 4NMXB 5B7ZA 4B0OA 1C8XA 2C77A 3MZ0A 4XZ3A 4NJHA 3ABXA 1FFGA 3KLNA 3IJDA 2DT1A 5A6VA 3UVIA 4Z51A 2OFJA 1OROA 1ZD9A 4G37A 3DUFB 3A22A 3FCXA 4AY6A 3U3ZA 3RIXA 1JEZA 1RMQA 1XLUA 4CM5A 2HUNA 2KM1A 2IBSA 4BUZA 1K6AA 1CUVA 5BN5A 1XCGB 3HNOA 3R3UA 2YTZA 5A5DA 3K0CA 3V36A 2JEPA 2POTA 3FJ6A 3W1RA 1ZGZA 3A1SA 3NFUA 4R1LA 3H42B 4CF6A 3UMGA 1W37A 3RRNA 2JAXA 3VOAA 1W36B 5I24A 1XLGA 1OLUB 1I7QB 4B3MB 3FXAA 2FF5A 5CAHA 4S0ZA 5E0FA 4YPFA 4DB7A 1KMQA 2XD9A 1CB7B 1A8SA 2YVAA 1GHSA 4ZCSA 5AJUA 5FQOA 1TF7A 1RLIA 7PTDA 2DLDA 3LDUA 3HZZA 3MS4A 1LLFA 1OIXA 1KY4A 4C90A 2VZ0A 3KTCA 5JS6A 4DA7A 1ISWA 4H08A 3CRW1 1ITCA 1GUVA 1GNRA 4F0MA 1L4GA 4C3OB 4RDHA 3TZNA 2ZDGA 3KOXA 3BEDA 1WSBA 3QHNA 4CKCB 1HO1A 4AMUA 5CC7A 3ANYA 1XISA 3Q7TA 4B3HA 4LQ1A 1J7KA 2Q6ZA 2QP3A 4CKWA 4H60A 2CHGA 4YMGA 1G8PA 4JJ6A 2CHOA 3AAMA 3TTOA 4TLEA 2VYQA 1PJSA 3LCUA 1U2RA 4JTIA 3U3DA 1TC1A 1CJKC 3O1LA 3EGXB 4MGHA 4NP7A 2Y2UA 4K1WA 5KU7A 4IFEA 3TZQA 4MVJE 1BN6A 1UM9B 1U5BA 2NUYA 3FCOA 3VUEA 3OIYA 4MJXA 4H6KA 4UHEA 5AM2A 4HYRA 5I7HA 5IFTA 2PC4A 2ZVRA 3G1AA 5CXUA 3R7AA 4HNVA 2FR8A 1VBUA 3RG2A 3K0FA 2C9OA 4A0HA 3KTDA 4UCQA 3DS8A 4S1NA 4QQNA 3ZWQA 4PLYA 1X1EA 2GLUA 3FGZA 3NHKA 2VHXA 5ECDA 1XCOA 2R1PA 4PFHA 1L5GB 1ST3A 1FW6A 5H80A 1LT8A 1XR2A 4J3ZA 2JRCA 5AJZA 3G17A 1WE5A 4URZR 1BS9A 3ROPA 1FUKA 2R9RA 4WECA 2HH9A 3TU9A 3QMRA 5AW4A 1YTUA 2VTBA 2GB4A 3CR8A 4X44A 4W1RA 1ZI9A 3LX6A 3LNTA 3NIGB 4NTZA 1VBKA 2OLAA 2ABAA 3PB0A 5DK6A 1BEZA 2ZVPX 4ZYLA 1M34B 3U4FA 1VKRA 1YKSA 4JP2A 1XCWA 1XXLA 1NXQA 4DABA 5BNTA 3RS9A 4D80A 5DVZA 1G9TA 1UZLA 3R1ZA 2GQ8A 2QDGA 3KELA 5JADA 1OB0A 2IUEA 4P7JA 3RCYA 8A3HA 2H08A 2PTXA 4I14A 1UMBB 5T3YA 5ELMA 1LLWA 3INGA 4P5DA 5D01A 4B4UA 4E2XA 2PH3A 5AVKA 3RIKA 3TQKA 1JIBA 4J94A 2EXOA 3NWRA 1V8FA 4HMPA 4LXXA 5HRAA 1O89A 4DRYA 2YCEA 3DL7A 5FAJA 1Q91A 1QIJA 1WIWA 2NP7A 4N03A 2J8GA 4BJ1A 4U7DA 2G9UA 3TR6A 2E1PA 4KPUB 4REQA 1BN7A 4BS0A 2YYZA 3DAFA 1H60A 3E22B 5CFZA 3F4VA 3OLIA 3B5EA 1E3EA 3FA5A 4TVUA 4QDZA 1XIBA 4MF4A 2XWJI 3RSSA 3ONVA 4S2BA 4MPRA 1TCCA 4IPIA 3TR9A 3SZGA 2XMRA 3IMGA 3UTDA 2D8AA 1A3WA 2VPPA 3BTVA 4MCIA 3SUSA 4NESA 3GD7A 4DKJA 1GHRA 2HA7A 1S2UA 3BWDD 1X92A 3P9KA 1PVOA 5A7FA 5TPZA 1U7ZA 2QRZA 3C74A 1JHZA 3JSAA 5FNVF 4WY2A 1G4PA 4BO1A 2WCGA 4QJ4A 4UOZA 1XVTA 4IF2A 3TEVA 1QCDA 2GDUA 2OLSA 1CXHA 4HQ0A 3DKJA 1WAWA 1PT5A 2VTDA 3HM9A 2JAUA 4ZL1A 2YFHA 5C70A 1RBYA 2Z26A 1V0NA 1L8NA 5AW7A 3C1TA 3H5LA 1OBCA 2CCJA 2I5PO 3BKWA 2ZCVA 3U8GA 2P3ZA 3VE9A 3GGGA 3A1EA 2AN3A 4LEIA 4G5XA 4IZOA 2FFCA 2MINB 4YRIA 1PEDA 1MC1A 2DBQA 4J3UA 3C3AA 2VI0A 3P97A 2C8VA 3RRFA 4AJJA 5TMPA 1CGXA 3LP5A 3N3TA 3CO4A 3QELA 3HM7A 1NF8A 1KRAC 4LUSA 3KEGA 4MQ5A 2JGIA 2GNAA 1FUYB 4M49A 4HDKB 2FN7A 2GARA 5JE8A 3RUHA 4YRZA 4DN6A 1NBOA 5H8WA 3TSCA 2VX6A 2XUOA 4YCLA 1OM0A 4MUFA 2XT0A 4NZ1A 1KFBA 5CDYA 2FVMA 5I4CA 4HR7A 1OYWA 3B1ZA 5AM4A 4PFMA 3DLCA 3KRTA 4UU0A 5JEDA 1W76A 1QV6A 2QPUA 3OX4A 2VT0A 4GC3A 2R7NA 3EJWA 5FL1A 3F7MA 3H13A 5DLYA 4CFSA 3LFUA 1M9NA 3BL8A 2WKQA 1QYVA 5B3AA 4PC8A 2G9NA 3D31A 1KOJA 1ZC4A 3KL2A 8LDHA 4Z42C 1SBZA 3V8EA 1B90A 4ND8A 2I3GA 4JJKA 1IBRA 3S81A 3IDOA 3IANA 2PLJA 1RBLA 1NMEA 3MWLA 1YR1A 3U5TA 4FDVA 5KQPA 1YB2A 1SM4A 3RVLA 3DF7A 3HR7A 4HSOA 1JTVA 1ELSA 3SK0A 3RUDA 3MPGA 4QJ3B 1A5LC 1I01A 3HE3A 2KYRA 5DHPA 3QF4A 1KFEA 4BPRA 4ZA0A 3PPCA 1QS0B 1QHHB 3OQHA 1QYCA 3NUGA 1P6XA 5DMNA 5FLEX 1QC5A 2XM2A 5BWOA 4BJHB 2Y24A 1CG6A 4GAEA 5CD9A 1HG1A 4H83A 1C4XA 1JE0A 3DW3X 3JD3A 3X1WA 1TJRA 1TU3A 5GNXA 4WXYA 4IJVA 2VAWA 1HDRA 4CCWA 4CMJA 5KPJA 1OCQA 3OT5A 1QAQA 3Q3GE 2GCNA 3AUAA 1WDMA 4R7TA 4BLTA 3KOUA 4LFCB 1R0MA 4UM5A 4PTMA 5FOXA 1Y5IA 2V5CA 3G0HA 2BELA 3QLDA 2NP6A 3VV3A 4CEHA 1POXA 1KKUA 3G2NA 3EKLA 3RC8A 1HMPA 3DG9A 1KR2A 2XCSB 2AJBA 4FR1A 4ADUA 3O4IA 3PPGA 2H2GA 1DKLA 1J25A 4ILEA 5JLAA 4HU8A 3EXIB 1MFPA 1F4PA 1E6NA 2Y05A 1BRMA 4XGNA 2PUWA 4MAMA 1AQFA 3ZJ8A 1RE1A 2J30A 2VGIA 2OC9A 4LDQA 4MS3B 3CF2A 4M19A 3NWBA 3LYEA 6ALDA 3ZGYA 3PUEA 1I36A 3DDSA 4JT2A 2CF5A 2LIVA 2P75A 3AERB 3AR9A 2X4DA 2GOUA 4XR4A 1CUZA 2OR2A 3KJNA 3RGWS 3IILA 2ERCA 2KWIA 1TKRA 2V3CC 3A28A 2DEPA 1UOOA 4PONA 1MAWA 3EXSA 4NNCA 1OFEA 3TLAA 3AR4A 2A1TS 1GCUA 1EBGA 2B99A 2X8WA 3F7OA 1HF3A 4IEIA 2BP1A 1XEXB 2R84A 2ET6A 1BMDA 4B31A 1W0MA 2VT2A 3PNOA 5A6KA 4CQ9A 4YTTA 1ZAJA 3O1JC 1R0YA 3K31A 1U2ZA 2C5BA 4RV9A 3PHLA 4YECA 1NMYA 2PZ0A 3BXGA 3LHYA 1MA0A 1DAIA 2QLNA 2WHQA 1WNTA 1JRLA 3LHTA 3GT0A 3HBNA 1ZOPA 3OSZA 1I6MA 3JQAA 3VJKA 2GX6A 5A6AA 5FD8A 1FS5A 1JNYA 1V6UA 5AUNB 4KQFA 1QU4A 1K89A 4H17A 1O8CA 1OLUA 5HVNA 1NULA 2WU0A 1NY5A 4NF2A 5BMVA 3K70D 3QYJA 3ABOB 4RJTA 2IITA 5ER6A 1E1RD 3UZYA 1Y63A 1QZ3A 1SZFA 4GR4A 1A5BB 2MSNA 1GNPA 1OIMA 2HRWA 2Z4TA 4LF2A 2WU3A 3TMYA 1E15A 2OOKA 1JCNA 2AMVA 5LHEA 3ICEA 3DHFA 3S44A 3F97A 5KEIA 1FXUA 3SSOA 1LROA 2QMJA 1F61A 2SKDA 5DSXA 1NI5A 1VBNA 1E3JA 1Z6QA 3CHDA 4PSUA 2H8XA 3GVVA 4LOHA 1TPUA 2NZVG 3L06A 1A7UA 1TIMA 3O84A 3WWEA 3ZHTA 3E70C 3GW8A 3S6TA 1DJNA 3GHYA 3Q58A 1HKIA 4CN4A 4ZQMA 1VMDA 3SNKA 5U9CA 4C2AA 4E0BA 4AS3A 2RH5A 3JYNA 3FTNA 1IC6A 1IZ7A 2DQYA 3L4BA 2KSQA 2QUHA 3HUDA 3HFYA 2HEIA 3V3TA 2DQ4A 1Y3BE 4LPKA 1TU4A 3TI7A 5DNAA 5I8ZA 1ZMOA 3CVXA 4P7BA 1ZNXA 4CZ2A 3L1KA 1FP4A 4ZYUA 1EUZA 3BH4A 1B4EA 4CN1A 5DYYA 3V4VB 2J7HA 1EF2A 2OQLA 4CKBB 1DC3A 2ACSA 1RRKA 1Z5WA 1O12A 1LPMA 2C2GA 1OH6A 2JGDB 1V6CA 4HD5A 2A6PA 1Q19A 3TNDA 2HFKA 2OODA 1D1PA 2RHGA 1M01A 1SKAA 4O3MA 1XYGA 2J0UB 1J6UA 2E4ZA 1RLDA 2REXB 2HK7A 1L3BA 4DEVA 1NVUQ 1NKTA 1DZIA 3QY9A 1JDNA 2WMFA 2B21A 1W8GA 4XWAA 3EARA 4GPAA 3OQNA 3I58A 4JB8A 4E3ZA 2DT0A 3MOIA 1ODUA 5CH3A 3KKLA 3A2MA 3GG2A 4PEEA 5DYNA 3EVDA 3JQ9C 3ZT7A 1TWWA 3LUBA 4HZUB 1OXUA 5EAIA 3AMVA 2OGWA 4DR6B 5ITWA 4Z9XA 4YVPA 1RR6A 2G9ZA 3OC0A 1BW9A 1DQYA 2V5KA 1MENA 4BQ2A 5GJNA 3F4BA 2O5EA 3JQDA 1KFCB 4UEKA 3F7JA 5C54A 2VJLA 1QV9A 5JOQA 2A0WA 4WKPA 3UXEA 1NVMA 3VJMA 5IAJA 3RN6A 4R34A 3EZ2A 1B0UA 1WB4A 3NPMA 2GPJA 4W5ZA 1XRRA 2GK7A 2WF5A 1C7FA 1IHXA 1K1DA 1DRUA 4JXCA 2GSEA 2IEAA 5DKFA 2AKZA 2QAGA 2PX0A 3TC3A 1E2FA 3SKYA 3VZYA 2B94A 4II3A 1L6FA 4S38A 5KYXA 2KI5A 1QT1A 3QY8A 1JHOA 2RE8A 2QW5A 4GBDA 1N2IA 5CX4A 1G5FA 1SHUX 3SFZA 2O5RA 3QEMA 2W62A 2X1MA 4DCNA 1EKOA 1EWVA 4Z2LA 2AVDA 3QUCA 4F93B 4CR6A 1I4OA 3ZO9A 1UANA 2P77A 2BHRA 4HL6A 1F0NA 4MPJA 4RHXA 2PAJA 2V6AA 5E7MA 4C88A 3VUFA 3ZJVA 1FQWA 4UC5A 4G8BA 2UUOA 3MUCA 1NN3A 5ES4B 3EZ7A 1T3TA 3NTYA 2G83A 5E9XA 4Y9AA 1WPGA 1ZRNA 2V65A 1D3GA 3TXYA 3T4WA 1V2HE 3PG5A 3COYA 2PP3A 3MB5A 3U3XA 4ZPJA 1YAJA 4BVBA 2EO7A 1PK7A 4ILSA 3DL0A 2X2PA 2NXCA 5SICE 4Z2AA 1JW9B 5K4HA 1I7PA 1MW9X 2GI4A 3TQVA 2QAIA 1WP6A 1VIWA 1AA1B 1E1NA 4Q3MA 4UTJA 3S2ZA 2G0WA 4IRMA 3VR5D 3PNBA 3EWUA 2JC3A 5HGXA 3ILXA 3PVCA 4IIYA 1W9VA 4JEUA 4DO4A 4M7OA 3M6YA 4WZHA 3IJPA 2CUZA 4LCBA 2GJ9A 5IKMA 1WF6A 3VGFA 1PQUA 5F5LA 5G4KA 1LBMA 3V5OA 4AC7C 1W8DA 1ULBA 5B1SA 4NT0A 2PMKA 1YE6A 1S1CA 5GQBA 3PZTA 1RVDA 1GDDA 2GSWA 3KYIB 4N9BA 1Q92A 2IH4A 2OXNA 5FKJA 5LA6F 1Q95A 2BFPA 3RTBA 1F0YA 2VHVA 3R13A 4P7QA 1R0WA 2F3SA 1SXJE 1JXQA 4D6HA 1GQIA 2X8AA 4L6AA 3RWBA 2UZ4A 5EBUA 1DO8A 2DJXA 5D6OA 4LBYA 1K27A 2HCJB 3KYDB 3N9IA 4J5NA 3TX9A 1RC8A 4DMLA 2ADFA 3VC1A 1JFVA 3PRHA 1T34A 5KKCA 4CRWB 2XIQA 1YQ2A 4RTSA 2XGMA 1TX2A 3QLLA 4DYEA 1I1WA 1VCFA 2ZUBA 4UR7A 3CHVA 3UJFA 2NV6A 1M2HA 4JKYA 3OZDA 2HYIC 3UZUA 3BIFA 2RDTA 4GM4A 2XKAA 4P8WA 3PFRA 4QDOA 2BFCB 3KJXA 4IOMA 4E09A 3I1JA 2G28A 2X1HA 5CG2A 2BDTA 3U60B 1DXFA 1C29B 2R11A 1P8AA 3MUNA 2IDMA 3L7OA 1JJIA 3G0SA 3AHHA 1C7RA 3TOPA 4QPZA 4JEQA 5DCDA 1F6PA 5ESRA 4EA7A 2EPLX 2I1LA 2VEPA 3NTOA 2HS8A 5BYWA 5IUJC 3DOHA 4ND5A 4WSKA 1PG0A 3R7NA 4F3NA 3V5FA 4NAUA 2D0PB 4EPEC 4MUNA 4D99A 1TSIA 3HKBB 1DCKA 1XG5A 1I0LA 1OGIA 3QG1A 5K4XA 2XNHA 2OZ0A 3NV7A 1A50B 1UBJS 3EMKA 2Z1WA 1CUHA 1RXEA 5A6BD 3FUUA 1K9SA 3MV01 1JIUA 1NAL1 2PGFA 2HRQA 4N6NA 5TGZA 3MVIA 1R6WA 5GNYA 1K02A 2Q5IA 4UTTC 3T0DA 1DAKA 3JR2A 4BFWA 2OCBA 4CM4A 3M7SA 1FQKA 3ZJKA 4JCOA 1QRQA 1U3VA 5AK3A 4ZXLA 3MMSA 2G3YA 1KM4A 3PM6A 1L5WA 4IGAA 4MKIA 4LXIA 1GFSA 3E5MA 2R2GA 2ZPTX 3QVTA 4WFIA 1VCVA 3DXZA 3A26A 1U3DA 4TL7A 3L21A 3DBRA 1PG5A 2G95A 8MHTA 5ANRB 1SFLA 3AQUA 1O5KA 1PI3A 2DQKA 6XIMA 1X19A 4QLOA 3EWYA 1J8MF 5C2GA 3NBZC 3QUAA 1QK5A 1C8QA 3U31A 2FTKE 2E25A 3EGCA 3LQRA 3VXKA 3TIMA 3DFMA 2ZI5A 2XLCA 3LENA 2PSSA 1QQ5A 4V39A 5ECWA 4LYQA 4LYAA 3TJIA 1RU3A 2NW6A 1ICIA 3JALA 1S9HA 2J79A 5HF9A 4ZI7B 4DCMA 4HQ6A 3BIJA 3HCPA 5I6DA 3OOEA 2HSWA 2QPAA 3M0IA 5M29A 1OA1A 1NQUA 3SIZA 1OG6A 3EPPA 2R14A 2J6CA 5TGTA 4YV0A 1GT8A 4AY4A 2C3PA 4R54A 3F5KA 2AQHA 4B3DA 2BJHA 4C21A 1R0LA 2NU6A 1NE2A 3BJEA 5I3GA 1RQNA 1WOMA 1XDMA 3O8AA 1NP6A 3QSRA 1M6EX 1SPXA 2VSXA 4B3TB 5HOSA 2J9GA 2DHCA 2NZYA 2H29A 2O8CB 1CUBA 4LHYA 3QWIA 1GZ1A 1DBIA 4BQRA 3RTEA 4N9CA 3VR3A 5IJZA 1U1DA 3B0UX 3GXMA 4TRMA 2X8JA 4KXFB 5EHNA 3LJKA 1FBNA 3LD5A 2P2CA 2Q1SA 1A5SB 3CLUD 2H8GA 4XDGA 2APJA 4YRLA 4PC7A 2W6RA 2QN9A 2W6OA 2QNBA 4MI9A 3DFPA 4ZAGA 1S5WA 3MK31 3JQCA 4DWWA 1NNI1 5E7QA 5HKBA 4UNIA 1UFRA 4ZCTA 2LD4A 3I6EA 3MHPA 5DGCA 4KP7A 4EYSA 1ZLYA 1UWKA 1EWKA 4ZYTA 1QF9A 1VHNA 2HSAA 1UPTA 3WGOA 5JWRA 2PX2A 4PPQA 2W63A 5BUQA 4XUGA 4WF7A 3IIKA 3STXA 4AZTA 4EFKA 4MA0A 1A7AA 4XRRA 4ZTXA 4B09A 5HJXA 3DMTA 5CRIA 3A9BA 4L65A 4LOIA 2B4QA 3IE1A 3LH5A 1TIBA 4K6FA 5M2QA 3R3XA 1ZZEA 1P1MA 1R15A 3MBKA 3HABA 3CMCO 2Q7XA 2FJ0A 3GEPA 2ZRMA 3EWXA 1KOFA 4ANFA 3Q6MA 3MJRA 4FX6M 4H7FA 4O8CA 3QY7A 4MI1A 5EERA 1UUQA 1X9IA 4IKOA 3GJ8A 1VHQA 3E9QA 1STOA 2CLIA 3AVPA 1VIAA 5C8YA 4KEAA 3LK7A 2A9RA 2YHUA 3TUZC 1I2QA 2BFEA 3FKQA 2IHZA 2C9DA 3LYAA 3ZD9A 1MV5A 4N3AA 3VSBA 4BKQA 2PMDA 4J9JA 3QVXA 1L4BA 4R88A 1Z7EA 3OLEA 3HDVA 5KVCA 2JJ2D 1KK2A 1VYTA 4UM9B 4RNFA 4F2GA 3S2GA 1FFXB 2ECQA 3TUUA 4I1UA 4I6KA 2I2XB 2JLCA 4GIEA 3PX3A 1Z9BA 3BURA 5CLQA 1M76A 3WGJA 2DDXA 3KJZA 3JAKB 2V7XA 1N5DA 3AEQB 1JVBA 1Y0BA 3QPBA 1XV5A 4OXQA 3ZVHB 3PGXA 1H2JA 1HSZA 5B6IA 4CU6A 1F4HA 4A9AA 1M0WA 2PLAA 1FJHA 3BJRA 4OAQA 4D0GA 3BG3A 1NSYA 3G8AA 4X7RA 3THUA 2I5GA 1N6LA 1K5GA 2H51A 1QNSA 4RHYA 5IC5A 8XIAA 4H9ZA 1GL3A 4CQ8A 3BF7A 3TX6A 2HS6A 3AEUA 3PTDA 2GZXA 1VFPA 5JZMA 3RARA 4Y0AA 1JTFA 4O63O 3BLDA 4MB0A 1L5HA 2JKYA 3RLVA 4J2HA 1OT5A 3DKPA 1DP4A 4XYEA 4KREA 4IFOA 3PNUA 5EYPA 1E64A 4D9IA 3MRTA 3FLMA 4JTSA 5A8MA 3UG3A 1DEKA 3EC7A 2AG6A 2DPMA 3JRKA 3S8EA 3HGQA 4U5QA 3MUIA 3FG9A 4I6VA 4Q33A 1Y98A 3TOYA 3Q7QA 2PDIA 1TJ3A 2Q2VA 4UTVA 1AZLA 3KAPA 5CDHA 1NUAA 3HH8A 1MEEA 1PK9A 3MO4A 1B2RA 3OEHD 1DPFA 1ZSVA 3VZBA 1RHQA 2DT8A 3AZPA 4B75A 5C7HA 5AVXA 4HDOB 3LG3A 1O5TA 5BQOA 4LEFA 3IKJA 1DDOA 3DFNA 1TA3B 1XD9A 3CKMA 3KXIA 4Y9SA 2RB4A 3GLGE 3AK4A 1OT1A 3MI6A 2E67A 3UA3A 3B2NA 1KF0A 2EKBA 4H3KB 4UNLA 4G6ZA 4S1PA 1B8PA 1XG4A 5DY3A 4PUWA 4ARCA 3USES 3VI2A 3ZD7A 3VTFA 3RS2A 4NQRA 3MOSA 3P5SA 1AU9A 4W8HA 1O5QA 5HANA 1OW3B 2ZQ5A 1C7IA 4RJKA 2Z5VA 1B14A 4A29A 2YKKA 2XEXA 1Q57A 1H1TA 3A6PC 1N3YA 3WDJA 4NENB 4JKKA 3SE7A 3UF9A 5LFAA 2ZS8A 1JPNA 3GLFB 3DDCA 4QRDA 1SZRA 1USUA 2CEAA 1KNWA 3EDFA 1U7UA 5LIKX 5BQ5A 3ZR6A 3IEIA 4C2BA 3I65A 1ZINA 2OMAA 3SF8A 1CXIA 1H2XA 4YHBA 1BFUA 2BV3A 4O17A 4W5WA 2UUBB 1K7FB 4GLOA 2XIIA 3D6JA 3VC6A 1HFEL 1TM7E 2J08A 2G3MA 4MQLA 4XYBA 5TJ9A 1P7YA 3UERA 1QUMA 3KK0A 3KHKA 1G5AA 3ZCPA 4F2TA 1ZA1A 1XU9A 5AHFA 1F4VA 4MZXA 4AS1A 2CIPA 3FWKA 2FR0A 3EXG1 4C7GA 4TQTA 1PT9A 4WY0A 4PXYA 3R3ZA 4H9TA 1P75A 4GUIA 1DXYA 2ZE0A 4JUFA 4M9CA 1PSCA 4EKIA 2Y7DA 1TWZA 1UR1A 1XTJA 1KV8A 3UMJA 3II1A 1XNJA 2IYLD 2PCEA 3QV6A 1I24A 4BB9A 1DWGM 2WMYA 3WI7A 1WP9A 1OHLA 1X7FA 2GO1A 2GCPA 5D8WA 4OG2A 4CFZA 2XGBA 3TNOA 1SMAA 2G70A 4GLLA 4LFYA 2WF9A 2FXIA 4MJ4A 2C83A 2B4YA 4QO7A 2CN1A 1W1TA 3N2OA 2V38A 1E9IA 2R44A 4BO4A 3BILA 3KFVA 3VNKA 3KCLA 5ILQA 3BHNA 1U1CA 4OVKA 4R69A 5FBHA 3KQVA 4HDNA 5KYYA 4RPCA 4KFCA 1JFRA 4CBVA 3O3OB 4RWEA 1UH4A 1TV4A 2D5CA 1LZKA 2GPTA 1XCFA 5BSTA 2ZYWX 1YNPA 4OP3A 3CZRA 2C5LA 1H8ED 4BS9A 4CQMA 4DYDA 2CVOA 1MJGA 4KXLA 2GDQA 3CL7A 2QV0A 2OKOA 5AT1A 2JGFA 4RNCA 4HQLA 3L7AA 3CUZA 4CV3A 4V15A 2DR3A 3WH5A 2OECA 1EUQA 4TXLA 2DVUA 2PDCA 3W7GA 3RHSA 4KC0A 4J40A 3PI6A 5FORA 3H2EA 2BGJA 1ZQ5A 3S40A 1M6HA 2Z7GA 1DWOA 4KHPB 1I3OA 2VDKB 1WKFA 1C2TA 1DHTA 3WNMA 1M67A 2VP4A 4ETWA 2Q27A 2P4EA 1JPIA 4EL5A 3CZJA 4QXMA 1US8B 4LVGA 4HLUA 1E2IA 4J8PA 2Z3ZA 3BCJA 5EG5A 4CHTA 1WDSA 2HHAA 4BNGA 1C81A 4NE7A 4M53A 1I2NA 2O1SA 5J47A 1C1DA 3FCSB 1L0BA 3ZIDA 2KJQA 1EDTA 4D43A 4DR4B 1H1LA 1BMTA 1E2MA 2OPHA 5AC7A 3AHYA 2RGLA 3E0WA 3NL6A 1UM9A 4FGKA 3SYMA 3RDKA 3VOTA 2ZXFA 3BRSA 3S1VA 3L04A 4CLHA 3W6LA 2QMQA 3FH0A 1XTIA 3PDUA 4Q7MB 5GZ6A 1YTDA 4FOOA 4D4MA 2YXEA 4OMFG 3TBKA 1JPMA 4KEMA 1CENA 4EHAA 1S2CA 4QPDA 2ZRJA 4D8ZA 2REQB 3UY7A 3QX9A 3AEZA 2J7FA 3OFSA 3CPRA 2HKIA 1MI3A 3LYHA 3K20A 4FFRA 4UUBA 3ZDRA 3IT0A 1PNVA 3LPCA 2FZDA 3W1AA 1RJ9A 3BQ5A 2FKNA 1BFNA 4HJXA 1N33B 3B3QA 4PO9A 5KWSA 5EKUA 5CPSA 4ZDKA 3K1YA 3LTEA 2WVAA 3WMRA 2RHHA 4HD8A 2IX3A 5J2UB 1EWTA 2GVLA 4HPXB 4ZOLF 1I0ZA 3RO8A 2H1WA 2W2XA 1SBCA 3M3DA 1UT6A 2J09A 3IVXA 3WICA 1Y3AA 1WHTA 3BORA 3UR2A 2DFDA 3A6JA 1ODLA 4YMTA 4J4KA 2LGJA 1YZTA 2ZTSA 4J3VA 2GZAA 1FFRA 3A4LA 1OD0A 3C8NA 5EUQB 3PFMA 3PBKA 3HPRA 3K2BA 1H2ZA 2WJDA 2X77A 1SW3A 4BXOA 2AMLA 4BNYA 3G2HA 2HFJA 3DFIA 1W36C 4JUIA 4RUKA 1RIFA 2ZE7A 3F47A 2WSPA 4XB2A 2EP7A 3PUIA 2XBUA 3GNNA 2W00A 3GVXA 1QOXA 5EKDA 2WKGA 3PBGA 5TMBA 2YHAA 1EE1A 3LGAA 1V71A 4H7CA 1GQOA 1Y7PA 5IEBA 3BO9A 5PTDA 4J1SA 4EZIA 3LLFA 4C1BA 4WKGA 3UCFA 3M4NA 3PXCX 1H2RS 4EL0A 1PUIA 4ME6A 1GKIA 1W85A 2ZSBA 3M4HA 2KBFA 4L8VA 2ZJBA 2CYAA 4M9RA 2PXCA 3FRJA 4FBGA 3W0LB 4DUGA 2XA2A 4LF8B 4HPJB 4E5TA 4IXWA 3H12A 4AZ5A 2FGLA 2CLLA 3UZJA 1W5MA 5F76A 1GQRA 4REQB 2B0CA 4ZHQA 3JAKA 1B15A 2P0OA 3CLTC 4BLOA 4V27A 1QBAA 4DLSA 4H6WA 1WMFA 3HB7A 5AK0A 2X9GA 2MNRA 4BFSA 3WNQA 3R7LA 3B4YA 1D2NA 2XR1A 3NP9A 4S2EA 1RQ2A 1PK8A 4BFTA 3ROQA 3LW7A 4BO5A 4TZ6A 4YYCA 1TJYA 3T5AA 5JAQA 3DBNA 1V7AA 1PFQA 1ZGBA 1TTTA 2AQWA 4PCPA 3Q10A 2WJHA 4U2FA 2QJMA 2QRMA 3WHKA 2A35A 3LC1O 5B5SA 4KITB 1UPCA 3G0OA 3KB2A 1OLXB 2I8LA 3RYHA 4ZDIA 2QVGA 4LQ4A 3WHIA 4ITUA 4HEJA 2BDUA 2MJLA 1Q45A 4EQZA 4U6NA 4DF2A 1QHZA 1TAQA 3LQ2A 3KLOA 5DT7A 2VG8A 2J77A 2UY2A 5BSVA 5DB4A 4ZQCB 2D2OA 3U4GA 3WUEA 3VMFA 5K8LA 3ABRA 3KV1A 2XB9A 3H7IA 4RK0A 3BE8A 1ENUA 4G2NA 3VKBA 2RGDA 3UT5A 4Q4DA 4CT0A 1MVNA 4AVYA 4D0LB 3JAWB 5A3RA 4GVHA 1RABA 2P9YA 4A10A 4TVBA 4PTZA 2AKMA 5ECVA 5TT1A 2WAXA 4HDKA 1DJHA 3TMQA 2Y1DA 2X76A 4EB3A 3QA3E 2QAPA 4BY3A 1KEWA 3H4TA 1QDSA 2JGMA 1UM8A 4URWR 4NIMA 2NPOA 3FMVA 3DLAA 3DZDA 3H55A 1UKOA 5JPCA 1O1YA 1OWOA 1IH8A 1YR6A 4IHCA 5GP1A 3MJSA 1XLMA 4LBSA 2N0SA 1XMJA 3ZHSA 4CCZA 4HWOA 1WV2A 1PV4A 2BSAA 3ZGZA 3R44A 4YO8A 5DBUA 4FDUA 4ZENA 4E11A 1PHQA 3DNPA 4ZJPA 1XGEA 3VSAA 1Q7TA 1HDEA 1P1KA 2IKSA 3PZMA 4KESA 2BONA 5CVUA 4R16A 3VDAA 4F9TA 3EUWA 3VGGA 4AC9A 2EKPA 1KVRA 2HQSA 5AMXA 4HGYA 1ZAHA 3K9LA 4WDRA 5JS1A 1GTL1 3TDMA 2HSEA 2Z8XA 4R2LA 5A9RA 4YCOA 1KK3A 2NT4A 3RTGA 2VT6A 3SBDA 4RXMA 3DE3X 3K30A 2AZTA 4RPKA 1DBQA 1MNAA 2J0UA 4MKNA 3B8EA 5K3CA 4DV0B 1N75A 1XLWA 2O2YA 3IOMA 3QPWA 4OFWA 5JZ9A 4YJGB 2B5WA 2NO4A 1VFSA 3M6IA 5LQKA 2FPWA 4LNCA 4O5AA 4DC1A 3OG9A 5E2IA 1YADA 5AUPB 2W2LD 1IPEA 5IT5A 1PJCA 3DD1A 1N0VC 4Q8OA 4HPGA 4O2AF 1Y1LA 2C82A 3W23A 3T4EA 2WHJA 4CFYA 3CTMA 1E58A 3ADBA 1IEWA 3WF0A 4LB4A 4ZJZA 2NQ2C 3ZZ0A 3KKOA 2ZATA 5J9FA 4GBJA 4D42A 1N9GA 4Y2TA 1CY2A 5EJFA 3HYCA 3H2MA 3WS7A 1VHCA 4JX4A 4ETMA 4LCJA 5K8JB 3L7IA 1LK0A 4OQNA 2HPVA 4HLCA 3QZUA 3MWGA 2QUBA 4LTMA 2V74B 3FETA 5BPHA 2Q5FA 2QPLA 2UUPA 3CPSA 3ADCA 1K77A 3GRYA 4AUMA 2W42A 5HDQA 4LW8A 4WV3A 1OWLA 3SIXA 3TYXA 1TPDA 4BU1A 2DTDA 2DSWA 1EESA 2AOXA 1E6ZA 4FOLA 3M9XA 3WQRA 2YN4A 4C7VA 1GSIA 2YXPX 2CLFB 1XAIA 1JA9A 4J2OA 4C0BA 4ZREA 4UHFA 4QP0A 4C6IA 2QIPA 1R7AA 3V0SA 3HGJA 1VFTA 4BF7A 3O6VA 1NFBA 3ABOA 2ZIZA 1AJZA 5HIIA 2F8SA 4MMZB 2QXWA 3GD6A 1O5OA 4ZZ9A 3VIIA 1Z0FA 3WD1A 3DP9A 1XJ5A 5I9NA 2Q4DA 1P74A 1MRSA 4E8CA 5HMDA 2QM3A 1OJLA 3GUVA 1CB7A 3V42A 1WNFA 1XZ8A 2WJGA 4UUPA 2O9PA 1KRWA 4NABA 3OPSA 5C7VA 4RK6A 5AKKA 4BKOA 4MVJI 4S3DA 4F5WA 4KZKA 3NBXX 3HTXA 3VIJA 1K66A 1R10A 2A9VA 1YMQA 3AF6A 1R30A 5LQSA 3W88A 1C7ZA 1LL7A 1HT6A 1H11A 1GZ6A 4MLRA 3B8SA 4RDVA 2PKCA 3DYBA 1EJWC 3KTAA 1FCQA 4FNSA 3ZUGA 3OGSA 4OHUA 3O15A 4IXTA 4JDUA 2Y99A 4DIOA 4HGXA 1XC4A 5I9IA 2QT3A 4RNHA 2WFLB 3TQTA 1HGWA 2I54A 4M5PA 4CU2A 3IVSA 3E6AA 3RSGA 3ZHBA 1ZJAA 3WH8A 2WB2A 2Z2KA 1VSQA 3BZBA 2QPXA 4D8XA 5C3MA 3M47A 1S1PA 1YBQA 3FGPA 1BAPA 1AF7A 2VHWA 3A8TA 1XU7A 3EVZA 3DYIA 3BRQA 1NW4A 3ZQKA 4JPGA 2CB0A 4OLFA 4R3UC 1Z4MA 2H4XA 4AN0A 5MGNA 2HXYA 3BLIA 2CF6A 2POZA 5IKOA 1FB5A 1YE8A 4FLMA 2OBFA 5A6MA 1CXLA 3D02A 2C97A 3WK4A 1TV2A 4P3OA 1NLFA 1NWHA 4BMDA 2R3SA 1A8IA 1KQPA 4Q6JA 3W7CA 1YRYE 4FOSA 1M6VB 4WOJA 1G67A 1XPJA 4O2AB 5E6YA 4IMGA 4X84A 4WBXC 1JQKA 4B3JA 3NGMA 4L5BA 4O59O 3F90A 3HDGA 4D6YA 2JHPA 4TKUA 3BHMA 4QL3A 2B4AA 1YFLA 4Z2KA 4KCGA 1XLLA 3N76A 3ZLHA 3B5JA 1KFWA 5I7RA 2X5XA 1E79D 1E7SA 1JHYA 4J3XA 1FPMA 1PQPA 3FSUA 4I90A 1RHRA 3H4IA 1NJ2A 5E09A 1JQAA 2WM3A 3GAFA 3EQ6A 1E70M 1WBBA 4ZE4A 4DBVO 2CZFA 4ND3A 3M0XA 4MEJA 2NQZA 1G2PA 3PLAE 2CEKA 1OVMA 4JI8B 3GZAA 4PLTA 2WICA 3QXCA 3PL5A 4WHBA 5JQ9A 2O2ZA 1JDFA 2ZTLA 3U7VA 4HH0A 4I4CA 4EOGA 2BHTA 1BIFA 4JICA 4DJDC 3UT6A 2OAQ1 2QUKA 1JD7A 4KAJA 3BUSA 2EKCA 4PYMA 2Z9BA 3IV8A 4WSJA 2ZZ7A 2B20A 4PBRA 2FNAA 3PJTA 3W2LA 4BF9A 1FWBC 1JZQA 3GP3A 1FWFC 2YIVX 3KNZA 1O0BA 2H3EA 4Z9BA 1A9TA 4MR9A 2Q46A 1Q20A 3TCSA 3T9EA 1U8EA 4D4LA 1UIPA 5K5EA 1VE6A 1ONRA 3OQVA 2ZADA 3Q67A 1W9XA 2HBVA 3DEJA 3HM2A 1RCQA 1RVGA 1JAZA 4X2PA 1FOBA 2FVXA 5AI5A 2NX1A 1E6PA 2OEKA 3TSMA 1VJ1A 2XUHA 2FSVC 2W9MA 4OQ4A 3I01M 2A7QA 4LV5B 4PLFA 3FUCA 2QUAA 5JJKA 3A32A 2ZWMA 3WLPA 1XZAA 2CLDX 4FEGA 4BNVA 2OMEA 3CV3A 4X6LA 5T91A 3EUFA 1YO6A 1F14A 2HCVA 1KB3A 1NDYA 1PV8A 3NQVA 1W3NA 1X6LA 3JVIA 5DASA 2RHRA 3W70A 3HCCA 3N6QA 5KMYA 1TPVA 3DHPA 1C3JA 3PYMA 1BQEA 4NENA 5LDDC 4NX2A 4KXVA 2VJBA 1BWPA 3QBEA 5JHHB 5CDGA 1MPXA 2WPBA 4TS4A 3LDHA 3F6EX 2YVUA 1MVYA 2FW1A 2GGHA 4NYMR 4YXWD 4M9UA 3SR7A 3WDKA 1YRLA 2DKNA 1M2NA 3STVA 4B6RA 1DKPA 2R6GA 2I9KA 1W6RA 1JLMA 4CM1A 4DRXB 2QG9A 1F9EA 1AGYA 2GYUA 4C22A 5CB8A 1XTVA 2PXAA 3RILA 4CUJA 3M1AA 5CM2Z 4LISA 4UFLA 1H8HA 1ES9A 1XVUA 3C70A 4X95A 4CIXA 4AECA 3VM6A 2J4DA 5KCMA 4XTIA 3AWOA 4XVQA 4DZTA 3ILYA 1VMIA 3ICWA 3OA5A 3EKZA 3GNQA 4BO9A 2AQKA 2EPMX 1LGYA 3MUEA 1W5TA 2ORVA 2AFIB 4IL2A 4JTRA 4PLGA 1BOOA 1WDLA 5K3FA 4OCZA 3V32A 3ILSA 2HQRA 2DHRA 4GVLA 1KRCC 5G0UA 1EG7A 4EHJA 4X1OA 2A3EA 4YV7A 1T41A 4ZYWA 4KNWA 1L9WA 3U7JA 4NIRA 3ND9A 3IUIA 4P2VA 4Z7NB 3R3JA 1E6XM 4RX0A 4RE3A 1KY2A 3Q41A 3F0TA 3KVJA 3M9YA 2NQ8A 1GQJA 1MU0A 4XIFA 3PR2B 5F7JA 2EGGA 3TXZA 1PIFA 3TOCA 2EZ4A 3OBEA 2OGTA 2C54A 1I2PA 1M1YE 5DHRA 1YD7A 3U81A 2C2BA 1EFCA 5HWMA 4G25A 5CB0A 1CDGA 1AIPA 2E28A 1ZEJA 3JYQA 3OIGA 3DEHA 2P0EA 2WDPA 1V9LA 4EGFA 3UMYA 2YJNA 4U33A 2I66A 3ODGA 3O94A 4FB7A 2QL6A 1XQLA 1DCMA 1MQ8B 1Q7RA 3DE4X 1ZIXA 5A0TA 2UZAA 3OTHA 3NRJA 2E0IA 3E9CA 2IEGA 4AAYA 5JDIA 1Y89A 4JLVA 1SMKA 1JZ7A 1SUIA 4OI4A 4M9ZA 2FSGA 2I99A 3P0EA 3JVVA 3LBHA 1YA8A 1A72A 3ZW7A 4OXYA 4GNKA 4RMJA 3NYWA 1FFYA 2VAVA 2X1SA 2L17A 3IVUA 3PEVA 1Z37A 2CFTA 1HEYA 1B26A 1JYVA 5EP3A 5C32A 4PB3A 5A1AA 1ESCA 4AZ6A 3ZS4A 2BHLA 1ESZA 3RFAA 1W0JD 2Z43A 2BSLA 3ZU5A 4K1XA 1NIUA 3EASA 4XO7A 5DXYA 3QE4A 1J56A 3KQNA 5BO5A 4L80A 2D8MA 2BP7A 4OK3A 3N4FA 2VPTA 2PDFA 4MWAE 2WUFA 1IY2A 2ONJA 2YIHA 2W5FA 3EGIA 4R81A 3E2PA 3PC6A 1WZIA 2GEBA 4LIPD 4JFUA 2NVCA 1J12A 4ADTA 1KYIA 4X1YB 3BWBA 3K5IA 1XBXA 4XD3A 3O9VA 3HVKA 1S5VA 4WZAA 2D69A 5DEIA 4ENLA 1PKNA 1YDYA 1RKVA 2YY7A 4D2IA 5AKHA 7AT1A 2NPFA 1P2FA 1KHTA 3ZLBA 2MMCA 5EE9A 5CCXA 1XM3A 2VHCA 3NL5A 4NCHA 5SWUA 1IYXA 3ZHUA 3FSGA 2V0GA 1OH5A 4ZEXA 1GCIA 2PDPA 3SZRA 2X2EA 3F98A 1CUCA 4IO1A 4AXNA 4R4JA 3R10A 4AN1A 1XH1A 4QLAA 3G22A 1CFZA 1LLCA 2AOVA 2GVJA 1CE8A 1OH8A 3V7UA 1PWYE 5DCLA 4D8WA 1G6KA 3UH0A 3UEQA 2HDNB 3DV2A 4Y2SA 1XE3A 3EDCA 4O52A 2H11A 2V30A 3MBFA 1LL6A 2QI9F 2OM2A 4IINA 3VX0A 5ALKA 4B3FX 1ZQ9A 1JRCA 2PV7A 5FEMA 3E49A 5LUBA 1TCMA 4FC7A 1UPPA 3KM8A 3PVSA 2QDDA 1U2YA 4O16A 3GWGA 1FCVA 4IUCS 1QUFA 1GN9A 5K01A 4WIWA 1QC5B 1RC1A 3URMA 3NDPA 2HJPA 5FFMA 1TVKA 3O1HB 4Z99A 1JR2A 1U8AA 2NV2B 1JQLB 1UIMA 4PH6A 2VHQA 1IULA 3WEOA 3SLKA 2JA2A 4Z1MD 2C00A 1YXDA 5CPTA 5HGJA 1Z5PA 4B5LA 5M03A 1RKXA 5T7BA 1JYFA 2WWXA 4QEEA 2J8FA 3NXFA 5AHEA 5SZHB 1GGHA 3JD2A 4N9DA 4D9CA 5AICA 1O9HA 1EE2A 4CMIA 3K05A 2J5RA 3IP7A 3WNOA 1ME8A 1GOMA 1VPDA 3ZWWA 1ADGA 1X7XB 1JPVA 2WVUA 4L4ZA 2OWXA 2LBPA 3A47A 2AC7A 1YNOA 4Y6PA 1A8HA 3ELYA 3QKWA 5TQJA 4V33A 3ARSA 5E1OA 1Z0AA 2YQ5A 1L5SA 1OXVA 1UWLA 4PC2A 2QPSA 5A6BA 3OJCA 3GIPA 1L7VC 2AJCA 5FOSA 5I3IA 4Z2IA 4G9PA 3JVEA 2DW7A 4D79A 3SGUA 4YBRA 2BTQA 3O06A 1G6CA 2QX7A 2Z2XA 4JWTA 2VA9A 1W1IE 5I3DA 4N5DA 3UB4A 1GRQA 3O73A 1VFLA 1K4HA 5DTQA 1LPSA 4UVIA 1R9MA 5FO1A 1C3XA 1YC5A 1RZRA 1IHIA 3I42A 4PTYA 2EW2A 5FPPA 1F2DA 3IKMB 3QOXA 4R9VA 3EDYA 3LGXA 2I9UA 2QD4A 3VU3A 2ODQA 4KLAA 4YQYA 3G1WA 7MDHA 2FHBA 2YB1A 3MJCA 2VEDA 1H3GA 4R84A 2F4VB 3CBWA 3TTEA 1E9VA 3S0JA 1FDUA 4N5IX 3T9CA 3R0XA 3QMWA 3USCS 3U7GA 4PEKA 3FIGA 2J74A 1CVIA 4QHYA 2J48A 5LLSA 3ZWTA 4YL2A 4F3HA 4B3KA 1LX6A 1MFVA 3B38A 3V9AA 5LKRA 1JEEA 4PGLA 4MMYB 3PQFA 1EGHA 2BFAA 1J6OA 1G9HA 4KR2A 2XFRA 4LVFA 4G97A 1FWIC 3OO0A 2FPRA 3TVYA 5FWXB 3THXB 1SO3A 5CJMA 3GPCA 2X2OA 5EQJB 3LTSA 2FX5A 2F1IA 1HE5A 3E15A 3GDWA 2D2EA 2YZ2A 5HWJA 4Q1EA 3CE6A 2QN3A 1AY0A 1EGVB 3BCSA 4ABYA 1TQ4A 3GCZA 2P2SA 3LN3A 3O31A 3BRWA 2Y2WA 5ECYA 3UOGA 1SW7A 1F51E 3IKTA 2BRUC 2GBGA 4YRKA 1CW2B 4F1KA 3PDIB 3IVGA 2F6RA 5CPFA 3A0UA 2WNNA 3PJGA 3D7MA 4PZ0A 2YDAA 5FV7A 4N47A 4WKCA 3W74A 4L8WB 4BJ3A 1XEAA 4TKMA 2O7QA 3W2KA 1OZQA 2WKPA 5CLFA 3DUWA 2YCKX 1IJKA 1XXXA 3RH0A 4DF1A 5DN6A 2V0TA 5D86A 5A4AA 1C7QA 1WMDA 4IMCA 5D2YA 2DT3A 5JS7A 4MNLA 1GR1A 3QPYA 3ECQA 2GPWA 1VJGA 3KUXA 1BZYA 5JU6A 2H4FA 1P91A 2I6XA 4HYVA 1QE3A 3SCWA 1V43A 4FGSA 3LWDA 5ER9A 2GCEA 3E48A 4EYGA 1A4XA 4W89A 1Z2EA 4DDTA 5CLGA 1PKEA 3U7QA 4MRAA 4BCBA 1TADA 2D54A 3DN5A 3G2KA 1MQPA 3K9WA 4DLLA 4S05A 5D02A 4L9ZA 3TH5A 3CH5A 2X0YA 3VNSA 3A4YA 4LHVA 3AHEA 1WVGA 5B4UA 3LBAA 1T36B 5CG7A 2XNSA 1GZSA 3RK0A 1L4EA 5A3VA 2ASEA 1PS0A 1PZGA 3Q40A 3A70A 4D9JA 4LV6A 4IF4A 1M8GA 3WNVA 1MCZA 2C5AA 3FIUA 3QMTA 3FE2A 3E81A 1TREA 4OKNA 2D2IA 3CVJA 4E5PA 2ZC1A 4W5NA 3OA3A 3R8RA 4P53A 2E4YA 1O6GA 3EXIA 2R5NA 3LCXA 1KO8A 5CT8A 3PXDA 2O8DA 1H1YA 3SCRA 4YI3A 1QNLA 4DNMA 3V0UA 1CQXA 3LS9A 3KHSA 2VMFA 3MMDA 1U7WA 1XSIA 3VNRA 3B3GA 4JASB 4F1WA 2XE7A 3JQ6A 1YR7A 3QWFA 2Z1BA 2Y0CA 4BMSA 2JLQA 1K4GA 1LS1A 1SHLA 2IXBA 1DIDA 1MA3A 3ZS9A 4YIWA 3LPAA 3GVHA 4RU1A 5ULLA 4D98A 3AI3A 2VX7A 2YRFA 4AJ9A 3BQ6A 2OQ2A 3V1MA 3IAQA 3VNDA 3KL3A 4EAMA 4L5AA 1NZJA 4DNHA 1QFSA 4Z53A 3E7FA 4KGJA 4WERA 1L4KA 5A03A 1GZDA 4IFKB 5J2TF 1IZ9A 4LH8A 4KMMA 1XO1A 3PUJA 1R5OA 2PTDA 5EBAA 3PWIA 1W4BA 2MU1A 4KFRA 2GEKA 3NH9A 4I9FA 1DQRA 4TLMB 4U7PB 3HSSA 3DYVA 3TCNA 4RDXA 1VJ5A 1K4KA 2O2DA 4RJEA 2P9GA 1YQUA 3RVSA 3KOOA 5LNK6 4OBEA 4UZEA 3F4KA 1U7XA 4CXMA 3NHZA 3TFWA 4KACA 4ZMGA 3RVBA 4F3KA 4E5DA 1GLVA 2R8BA 1M3SA 5ALSA 3BH7A 4GGPA 5FAGA 4IG4A 4DQDA 4I5RA 5CITA 3ZIUA 3G68A 1M6JA 2BCJQ 4E1AA 4M76B 4PN3A 1GVHA 5G1PA 4HZ7A 2O54A 4KT2A 3HZHA 1UMDA 2ES4A 1GEGA 5AW6A 2XINA 1TRHA 3NCOA 3SSJA 3ODPA 1NKVA 2D1YA 1QP4A 4DO5A 2J47A 4BHYA 3UMMA 1OXMA 2R82A 3RNLA 1UQTA 2WC7A 4N3NA 4TX9A 4ZZ1A 3NIBA 5H0IA 3IXMA 3THCA 2ZJYA 5JY6A 4L0DA 5DN9A 1M2OA 3H4WA 5J5DA 3C4JA 2D5AA 1GSAA 1OC5A 5G41A 5LA6B 3GRFA 5K6TA 2WJWA 4HDQB 4AEEA 1EXMA 1N5KA 2JFHA 1FYVA 2GERA 5C5CA 3DKVA 3D3FA 4ZMRA 3G89A 3PG9A 1UZHA 4WLFA 4AF6A 4NARA 4L8FA 3NGJA 2HDWA 1DKQA 1BWKA 4FFLA 2R7KA 4S1VA 1ZIDA 2J7PD 4OXKA 2DQXA 2VQ3A 2QCHA 3P2KA 4R3NA 4MPDA 3Q1KA 5KTMA 3SY8A 4MSUA 1A69A 1KM0A 5CEFA 5JPIA 3OYXA 4MNMA 1DQZA 2QTCA 3AFMA 4FUQA 4L64A 2FIQA 2IXGA 5D09A 3B5IA 1JSCA 4TLBA 4GI1A 2J7DA 4N9EA 1DINA 3GHSA 1M6VA 5LQUA 3ZBUA 3M41A 3P9NA 3B1YA 5F2OA 2WRZA 1N77A 2ZIDA 3LC7O 2QP9X 1VBFA 4R2IA 3Q8MA 1XQYA 2ZANA 1DC6A 2GF9A 5J2UA 5CH5A 4G81A 2AC4A 2PD6A 4B84A 2GQAA 1N6RA 4E6PA 2GHIA 5TJHA 1PBGA 3AFBA 5B58C 1M2FA 3FRIA 3VOIA 3VNBA 3G1DA 2GYYA 1IZZA 2FDMA 1L6RA 1J10A 4AZ0A 1CNVA 4DBWA 3OYZA 4JQ4A 5E3JA 1IHDA 1X1DA 3IT2A 3U61B 3SHTA 1YJXA 1J0JA 4R8RA 4C6DA 3OPYB 1USIA 4FZ3A 4AZ0B 5I7FA 3T7KA 4ARVA 3SEPA 1KM3A 3B51X 5KQLA 4KPYA 2CLMB 2V0NA 3FPJA 2MMGA 4L74A 3N0XA 3FLUA 3TEJA 2EJWA 3ALFA 4FGUA 1DPMA 3NT5A 1LI5A 1P72A 3O2QB 3GLGB 2G7MC 4Y1FA 4NU0A 4U7HA 1NT4A 1EB3A 2B3DA 4JN6A 3S1AB 4V2IA 1VGAA 2OXIA 4Z7OB 1THZA 3ONEA 3PGMA 1P1FA 2XG9A 3HL4A 3Q65A 3ZWMA 4CLEA 1H5YA 3M0MA 4MDHA 1Z4OA 3Q7RA 1ZJZA 4FJ2A 1Y4DE 5JVDF 2FQIA 3CWHA 5TMEA 2PMCA 4RACA 4FNTA 1QQAA 1X80B 1X98A 1XDZA 2Q4RA 1POJA 2CMHA 4IV5A 4DSOA 3M6WA 2G25A 5BV0A 5C8BB 3N2CA 3LE8A 1QV7A 4IH9A 4PN2A 2PI6A 1S7CA 3BLEA 1L6WA 3QWAA 4LVUA 1PR6A 3KQHA 1FW8A 2PZNA 1FWNA 3U37A 1CULC 4EKGA 4JR0A 4ROSA 1RCTE 3R5KA 1LPAB 5JFOA 4Q22A 4B35A 3CK5A 4HFMA 1JZ3A 5DBGA 3OTWA 3G18A 4FB5A 3EB4A 1S3TC 1W1WA 3WWPA 3FOKA 1O6BA 4KCVA 1JHXA 2DUWA 3AMGA 1YS1X 1T4DA 5B2ZA 4N4QA 2HPIA 3I1IA 3QBTA 3STYA 4Q3KA 2GLKA 1KNXA 2AEJA 1W2HA 1X8CA 3H5WA 2WWVD 1KSGA 3U7RA 4F6RA 3LLSA 2BKXA 3AYZB 3M5VA 4QPPA 1N2ZA 3DTTA 1BQ4A 2QMEA 2F90A 4KOEC 1Z8HA 5CGQB 1PZFA 1KFKA 1K9FA 4NJIA 1XDBA 2HBRA 1GL6A 4J03A 3PWZA 2G6TA 3RAEC 3LHZA 5G4HC 1OCBA 4PVCA 3DCPA 3I7QA 3UV7A 3VAZA 2E3ZA 2ZRWA 5I3FA 1SELA 3TEFA 2Q3OA 1VPXA 3C4VA 1VGRA 2X16A 1W30A 2MSDB 1KBBA 2CHQA 2HA6A 2VQ6A 4BO0A 2HLPA 2DBVO 3TQFA 4NDNE 2EYUA 4OX9Y 4RPQA 1EQPA 3ENWA 1Q6OA 3OBKA 4FOJA 3W2GA 4BQNA 1TNDA 1E0TA 4A22A 5IKXA 2V7WA 3CEHA 2DPLA 1KDZA 4YVFA 2WWCA 221PA 3AJ8A 4ENTA 2IS1A 2EDCA 1I2DA 4IXDA 4RX1A 3SR4A 1E6EA 4YP7A 2IOHA 1DAHA 1ZMRA 2GAJA 1R0BA 2EJTA 3WSVA 4C0JA 3ER8A 3AETB 1MIOB 3CINA 3T1QA 4QUIA 3LPNA 1Y6ZA 4U28A 3NVKI 3PYXA 4TOIA 4I1SA 3QEJA 3V2IA 1PRYA 1PL0A 3GGCA 3KYCB 5CNIA 2VZUA 1T5TA 1PIGA 1Z0SA 5DMHA 4PUMA 2GGGA 3WNNA 4XUCA 3DEYX 3I5UA 2H7XA 2IHNA 3B9PA 3BZJA 3ETEA 3UPWA 3R7DA 4LDZA 4M7TA 4IGNA 3M83A 4MH0R 1P4SA 1TW2A 2ZIUB 4JY9A 1I9CA 3V1NA 3UYIA 4I4NA 2JJQA 3D0RA 1DIHA 4MYAA 4X63A 1QI0A 3IP9A 2XWQA 4QAJA 1OX4A 1YASA 2R7LA 5CPOA 2EOAA 1CXZA 1F6YA 4H3HB 3LOTA 1GTJ1 5DE3A 3ITCA 1RAEA 1WA5A 2FSPA 2CV1A 2N46A 1E99A 4ZFCA 4KQKA 4M8LA 2HRCA 3REGA 2VL7A 3LV6A 1XD2A 5F1PA 4R7WA 1KJQA 4UATA 3KX6A 2QZ4A 4REMA 1GRNA 4HTBA 4ZQHA 4HA0A 3TE9A 2PYZA 1E89A 4OQFA 4DSTA 4U6SA 4Q4JA 5BXYA 3ZXSA 1DWJM 5CH8A 3WQVA 4YXWA 1Z75A 4F4HA 2D6FA 2AJDA 2IXEA 1USKA 5DFAA 2X9LA 3HGRA 2Z09A 4X24A 4LJRA 2RGBA 4PC3A 3VIHA 1YZ3A 1FRVA 1YJ8A 5AKGA 2GM5A 5CLTA 4F2WA 4KN8A 1FLDA 4CUCA 1YB1A 1G4AE 2GJXB 3DAQA 5A0FA 2BY0A 2FPSA 3CO0S 1OKKD 5FX2A 2C3ZA 5COQA 1AQLA 2OQHA 2BFFB 1KE2A 3MUAA 5CXQA 1ZN8A 2QJTA 4XD6A 1R3VA 1KDYA 1J5XA 2HMAA 5M2FX 1VJIA 1AFSA 1R8SA 1EUAA 4BBZA 3VOGA 3GGSA 5JC8A 2O9RA 4K39A 4LSWA 1A7KA 3MI3A 1J8YF 3JR7A 1GVSA 1U1EA 4HHEA 1RIIA 1QP8A 5FF7A 4D6DA 2DIEA 1Q6ZA 4JJ4A 1EIBA 1EG2A 3ZEIA 2BBTA 4KXYA 1SCJA 5E6UB 3FJLA 3THDA 3ISJA 4AF0A 3PUHA 2FCAA 4B5WA 4CQBA 3KT6A 1NG9A 1WKDA 3N3MA 3S5JA 3ZLJA 3H23A 1JTEA 1JF6A 4W1SA 3W7VA 2IWHA 3FVTA 5AHRA 3DBHA 1Q2XA 4GR9A 3UWVA 2PH5A 2OZVA 3W82A 1BYIA 4IRXA 5BMXA 4FYPA 1JXKA 1DQWA 4PR4A 3AS3A 1P18A 1WZLA 1ZAIA 3GNDA 5DBOA 1HETA 2IHKA 4QXAA 5AM5A 3RYCA 3W86A 1T9HA 1JI1A 1CBUA 5IHXA 2VYCA 2GFQA 4AMCA 3U0BA 1Y9ZA 1VL2A 3ULKA 3G5EA 1VSVA 2QQGA 2WR8A 2GCIA 3P71T 2XWPA 4UE3S 3AI2A 4WUTA 1X3SA 1TE1A 2V3DA 3BE6A 1N0WA 1XQKA 2OSYA 1LW7A 2ZK7A 2F8QA 3DAPA 3SEAA 3ZVMA 1GYNA 1T1RA 3FEMA 2HHJA 3EGXA 2WPDA 4LTDA 3AINA 3UW6A 2FUEA 3ANLA 3O8QA 2FGZA 2CMKA 2G1KA 3DOEA 3V4SA 1KDVA 3FOEC 3TQSA 3GXDA 1X7YA 1WW2A 3KSAC 4MPQA 2IA5A 2VK1A 1ILWA 1KA9F 4M6VA 5TVKA 3G8RA 3UD6A 2XGOA 3PF9A 3T3PB 4MLDA 5MKGA 1G21E 3B6KA 3FKJA 1E9YB 3U4QA 5DHUA 3WYFA 5KB3A 2UVPA 2G09A 1TT5A 2I5IA 3ZV3A 4OGGA 3UWMA 5CSSA 2JDIA 3DMTC 4J76A 5C0QA 5D5PA 2PDQA 3ST7A 4IHJF 5JPDA 1LUCA 1H5NA 1C7SA 4I7WA 3QOFA 4DKXA 5FNVB 4IIDA 4IXXA 5ELXA 2IYEA 4AJNA 1CXEA 4H7JA 4MKXA 4A2PA 5JSQA 4ZB0A 5AVZA 4XUYA 2RD2A 1ZVJA 2F43A 4U7FA 1B31A 3B0YA 3U09A 1OYCA 1XMSA 3AVYA 3MCOA 2PWFA 4B34A 2ZRAA 5IBPA 2QYHA 4JBXA 4NZ3