5EMKB

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
313
structure length
313
Chain Sequence
EWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5emkB00
2Z2PA 4Y7RA 4CZXA 4U1EI 4HDJA 4BL0A 4PNKB 2YMUA 5GXHA 2TRCB 5CYKA 4CI2A 3F3GA 4JSVC 3OKWA 1K32A 2BBKH 3AL8A 4J0WA 3SFZA 2IWFA 3RN0D 2YNOA 4NSXA 4O3TB 5HE0B 4XYIA 2H6KA 4X3EA 2YB8B 3RFHA 2AGWA 3UVLA 3JRPA 4JSPC 2XL3A 1U2VC 3EI3B 2H13A 3VGZA 5CXBB 3DSMA 2OVRB 2OIZA 5EMLB 3EWEA 2UZYB 3N0DA 5IJ7E 4I79A 4A08A 3RFGA 1K8KC 2O9KA 1XHMA 4PBYA 5HYNB 3EG6A 3F3PA 2HESX 3SHFA 2H9PA 3SN6B 4H5IA 2H68A 3CFVA 4FA1D 3RLMD 5K1CC 3K26A 3PXSD 5HE1B 1MDAH 2P9SC 2I0TA 3RN1D 5I5MA 3ORVD 3OL2B 4GZ8A 5EMMB 3VH0A 4E5ZA 1SHYB 2AGYA 1JOFA 4H5JA 5FLXg 3JZGA 3SCYA 1B9YA 1P22A 3UVKA 4L3HD 4K3JB 3EI2B 1S4UX 3RSEC 1GOTB 4GM3A 5I5JA 5EM2A 1PBYB 4O3UB 5EARA 4BUJC 4J77A 4JSXC 4GQ2P 1XKSA 1N6FA 3MZLA 4E54A 2J55H 4KFMB 3J80g 1GP2B 4J8GA 1JMXB 2AH0A 2GC7A 5CXCB 1MG2A 3U4YA 2IURA 2HKMA 3IJCA 4FA4D 5AFU3 3SJLD 5THAA 5A2Qg 3PSCB 4JXMA 2CO0C 5EMKB 5KDOB 4EWRA 3MKSB 3MXXA 1JJUB 3IIWA 4CI1A 3SLED 2Q7QA 2OK6A 3BWSA 2GNQA 2H3XA 2MTAH 4J82A 4CZVA 4GMBA 3FGBA 4U7AA 1FWXA 2PM9A 5SXMA 3PSLA 5CYKB 4L9OA 2AH1A 5TEFA 5FKTA 2YBAA 2UZXB 3UVNA 3C75H 3V9FA 3AL8B 4FAVD 4X63B 1L0QA 4ZOZA 1MG3A 3JZHA 1PEVA 3EU7A 3SBRA 4XYHA 1NEXB 4GM9A 5IGQA 2H14A 1NR0A 2IWKA 3FRXA 4XEIC 4PSWB 4ERYA 2XL2A 3HFQA 3UKUC 3SVWD 4X60B 3BG1A 2H47A 3OKYA 2HJBA 3UVMA 5H14A 2P9KC 3PE7A 3I7HA 4OWRA 1TYQC 4A08B 5JWZA 3CFSB 4X61B 2G99A 2XYIA 4UI9R 3IJ1A 4A0BA 4J73A 5GSAA 2EBSA 5TDHB 3V5WB 3VA6A 2H9MA 2QXVA 3I8EA 4ZOXA 3UVOA 1OLZA 4PSXB 4TZ4A 4FHLA 5H17A 4O45A 5IGOA 4E5ZB 4BH6A 4OZUA 2AQ5A 3RRMC 5CXBA 4Y5RD 2PM7B 3FM0A 5TF2A 5FKRA 5TEEA 5EALA 2J56H 5EM2B 3L4OD 5AJAA 5IT9g 4LGNA 4GGDA 1YFQA 5GMKn 3EI1A 3SMRA 3JAMg 4GM8A 4L3GD 2H6QA 1ERJA 4FA9D 2B5LA 4E54B 4A09B 3L4MD 4ERQA 2OVPB 1SQ9A 4JD2C 4ERZA 3ODTA 2AGLA 2PM6B 4GQ1A 2W18A 3E0CA 1TBGA 3NVQA 1A0RB 5EAPA 4CY1A 3AH8B 1N6DA 3I7NA 1OMWB 2G9AA 2Z2NA 3OL2A 3MKQA 3AFCA 1Q47A 5I5IA 4IMMA 4D0KA 1PI6A 1PGUA 2PM9B 5EAMA 4A0AA 3P4FA 1VYHC 3B7FA 4J87A 4J86A 3SBQA 5IC7A 4PBZA 1R5MA 2HXCA 4JT5C 4FAND 2P9LC 4J81A 4J79A 4ES0A 5B4WA 5C9ZB 3DXMC 4YVDA 4JT6C 3IJ0A 4ZOVA 2P9UC 4PC0A 4GGCA 2IUPA 4FA5D 3ZWLB 3UKRC 3OTTA 5FKQA 5IJ8E 2CE8A 3EI4A 3I2NA 1QNIA 4R7AB 2XU7A 3OKYB 3AL9A 2YNNA 4A11A 4CI3A 4J0XA 2P9IC 3IKOA 4L1QD 2P9NC 2AGXA 5GXIA 2IUVA 1JMZB 1N6EA 2OK4A 4A0BB 4QRJA 3I7OA 3I7LA 5K19A 3MZKA 2I0RA 2OVQB 3K27A 4LG8A 4MK0B 3C5MA 2QC5A 4O1QD 5AMSA 3V7DB 4ZN4A 2BCJB 2CNXA 2IUQA 3JPXA 4QT8A 4O9DA 5HQGA 5HE2B 5C2VB 3ULEC 3PVWB 4PXWA 4A2LA 2YNPA 4JSNC 4IA9A 4CY5A 2B4EA 3SXTD 5FA5B 1GXRA 3EI3A 2I3TA 3EI1B 4D6VA 2I0SA 2H9LA 3IIYA 3C99A 3PXTD 4G56B 2GC4A 3JZNA 4FB1D 3UR4A 4FWWA 4ZOYA 3A0FA 3OKTA 3MMYA 1SQJA 2HJ4A 4A7JA 2CE9A 1U4CA 2CN3A 2H6NA 3SWSD 5FXYA 2PBIB 3BG0A 3J81g 2OJYA 4GGAA 3NVNA 2HYEA 4CZYA 3SBPA 4AEZA 4N14A 3GFCA 3N0EA 4LG9A 5H1MA 4QQEA 3W15A 4CY3A 2J57G 3RMZD 3F3FA 3I8CA 2P9PC 3PXWD 5C2WB 2CN2A 3PVUB 4A0AB 2B5NA 2I3SA 3JB9L 4J78A 3KRWB 4Z8LA 4ESGA 3EI2A 5FQDA 4CY2A 4A09A 1XIPA 3C9CA 3JROA 3DWLC 5HE3B 4GQBB 3I7KA 3DM0A 3OW8A 2CO0A 3I89A 3I7PA 4CC9A 2HKRA 2B5MA 3EI4B 1GG2B 4J8BA 5CXCA 2Z2OA 4AOWA 3DXKC 5EMJB 4A11B 2IAAA 3CIKB 4K3ID 4QL1A 1B9XA 3EMHA 3NVXA 4J84A 4CI8A 1RI6A 3GREA 2H9NA 5FKSA 4A2MA 2AGZA 3KRXB
chains in the Genus database with same CATH superfamily
2Z2PA 4Y7RA 4WK2A 4G55A 4CZXA 4U1EI 4HDJA 4BL0A 4PNKB 2YMUA 5GXHA 1O6FA 2TRCB 5CYKA 4CI2A 3F3GA 2XE4A 4JSVC 3OKWA 1K32A 5M5TA 2BBKH 4NAAA 3AL8A 3T3MA 4J0WA 3SFZA 2IWFA 3RN0D 2YNOA 4AMYA 1VE6A 4NSXA 4O3TB 4UM8A 5HE0B 1VZ2A 4XYIA 2H6KA 4X3EA 2YB8B 3RFHA 2AGWA 3UVLA 3JRPA 4JSPC 1H2WA 2XL3A 4QAMA 1U2VC 4AN0A 3EI3B 2H13A 4O2WA 3VGZA 5CXBB 2QZPA 3DSMA 2OVRB 2VZ3A 2OIZA 5EMLB 3EWEA 3NIDA 2UZYB 3N0DA 1C9LA 5IJ7E 4I79A 4NBMA 4A08A 3RFGA 1K8KC 2O9KA 1XHMA 1YR2A 4PBYA 5HYNB 2QR5A 3EG6A 3GD1I 3F3PA 3OF7A 2HESX 3EQ8A 4NC4A 1BPOA 3EQ9A 3SHFA 4DNWA 4Z7NA 2H9PA 3SN6B 4H5IA 2H68A 1UOPA 3CFVA 5HDBA 3RLMD 4FA1D 5K1CC 3K26A 3FCSA 3PXSD 5HE1B 1MDAH 2P9SC 2I0TA 3RN1D 5I5MA 3ORVD 3OL2B 4GZ8A 5EMMB 4UM9A 3VH0A 4E5ZA 1C9IA 1SHYB 2AGYA 1JOFA 4H5JA 5FLXg 3JZGA 3O4GA 3SCYA 1B9YA 1P22A 4MMYA 3UVKA 4L3HD 4K3JB 3EI2B 2WQ8A 1S4UX 3RSEC 1GOTB 4GM3A 5I5JA 5EM2A 1M1XA 1PBYB 4O3UB 5EARA 4BUJC 4J77A 2XZGA 4JSXC 4GQ2P 1XKSA 1N6FA 1QFMA 3FCUA 3MZLA 4E54A 2J55H 1E5TA 4KFMB 3J80g 3V4PA 1GP2B 4J8GA 4WK4A 1JMXB 2AH0A 2GC7A 1U8CA 5CXCB 1MG2A 3U4YA 2IURA 2HKMA 3ZDYA 3IJCA 4FA4D 5AFU3 3SJLD 5THAA 5A2Qg 3PSCB 4JXMA 2CO0C 5EMKB 5KDOB 4EWRA 3MKSB 3MXXA 1JJUB 3IIWA 3ZE0A 1VZ3A 4CI1A 2VDPA 1GOHA 1GOFA 2HU5A 2VZ1A 4JHPC 3SLED 2Q7QA 4BP8A 4RE5A 2OK6A 3BWSA 2GNQA 2H3XA 2MTAH 4J82A 5E6UA 4CZVA 4GMBA 3FGBA 4U7AA 2XDWA 1FWXA 2PM9A 5SXMA 3PSLA 2EIDA 5CYKB 4L9OA 2AH1A 5TEFA 5FKTA 2YBAA 2UZXB 3UVNA 3C75H 3V9FA 3AL8B 4FAVD 4X63B 1L0QA 2BKLA 4ZOZA 1MG3A 3JZHA 1PEVA 3IUJA 3EU7A 3SBRA 4XYHA 2EICA 1NEXB 2EIEA 4GM9A 3O4HA 5IGQA 2H14A 1NR0A 2IWKA 3FRXA 4XEIC 4PSWB 4ERYA 2XL2A 3HFQA 3UKUC 3SVWD 4X60B 3QHYB 1H2YA 3BG1A 2H47A 3OKYA 1I2MB 2HJBA 3DDUA 3UVMA 5H14A 2P9KC 3PE7A 3I7HA 4OWRA 1TYQC 4A08B 5JWZA 3CFSB 4X61B 3IUNA 2G99A 2XYIA 3IUQA 4UI9R 3IJ1A 3IULA 4A0BA 4J73A 4G1EA 5GSAA 2EBSA 5TDHB 3V5WB 3VA6A 2H9MA 2QXVA 1UOOA 2VDQA 4RE6A 3I8EA 4ZOXA 3UVOA 1OLZA 5E6RA 4PSXB 1H2ZA 4TZ4A 4FHLA 5H17A 4O45A 5IGOA 4E5ZB 4BH6A 4OZUA 3IUMA 2VDOA 5M5UA 2AQ5A 3RRMC 1A12A 5CXBA 4Y5RD 2PM7B 3FM0A 3IURA 5E6SA 5TF2A 4DNVA 5FKRA 5TEEA 5EALA 2J56H 1UOQA 5EM2B 3L4OD 5AJAA 5IT9g 4LGNA 3QI0A 5FFGA 4GGDA 1YFQA 5GMKn 4AX4A 3EI1A 3SMRA 3JAMg 4GM8A 2H6QA 4L3GD 1ERJA 4WK0A 2B5LA 4FA9D 1JV2A 4E54B 3K72A 4Z7QA 4A09B 3L4MD 1TYEA 4ERQA 2OVPB 1SQ9A 4JD2C 4ERZA 3ODTA 2AGLA 1E8NA 5M5SA 2PM6B 4GQ1A 2W18A 3E0CA 1TBGA 3NVQA 2HU8A 1A0RB 5EAPA 4CY1A 3AH8B 1N6DA 3I7NA 1OMWB 2G9AA 4Z7OA 2Z2NA 3OL2A 3MKQA 2VDMA 1Q47A 3AFCA 3ZDZA 5I5IA 4IMMA 4D0KA 1PI6A 3O4IA 1PGUA 4MMZA 5FFOA 3V4VA 2PM9B 5EAMA 4A0AA 3P4FA 1VYHC 3B7FA 1L5GA 4J87A 4J86A 3SBQA 1H2XA 5IC7A 2HU7A 4PBZA 1R5MA 3MUOA 3KCIA 2HXCA 4JT5C 4FAND 4BP9A 3K71A 2P9LC 4J81A 4J79A 4ES0A 5B4WA 5C9ZB 3DXMC 4YVDA 4JT6C 1K3IA 3IJ0A 4ZOVA 2VC2A 2P9UC 4PC0A 4GGCA 2IUPA 4L1MA 3ZWLB 4FA5D 3UKRC 2JKXA 3OTTA 5FKQA 5IJ8E 2CE8A 3EI4A 3I2NA 1QNIA 4R7AB 4JHNA 2XU7A 3OKYB 3AL9A 2YNNA 3VI4A 4A11A 4CI3A 4J0XA 2P9IC 3O4JA 3IKOA 4L1QD 4G1MA 1O6GA 2AGXA 2P9NC 5GXIA 2IUVA 1JMZB 4MMXA 2VDLA 1N6EA 3IJEA 2OK4A 4A0BB 4QRJA 3I7OA 3I7LA 3ZE1A 5K19A 3MZKA 2I0RA 2OVQB 3K27A 4LG8A 4MK0B 3C5MA 2QC5A 4O1QD 5AMSA 3V7DB 4ZN4A 2BCJB 2CNXA 2IUQA 3JPXA 3T3PA 4QT8A 4O9DA 5HQGA 5HE2B 5C2VB 3ULEC 3PVWB 4PXWA 2VDNA 4A2LA 2YNPA 4JSNC 4IA9A 4CY5A 2B4EA 3SXTD 5FA5B 1GXRA 4BCCA 3EI3A 1JTDB 2I3TA 3EI1B 4D6VA 3IVMA 2I0SA 1GOGA 2H9LA 3IIYA 3C99A 1UTCA 4BCBA 3PXTD 4G56B 2GC4A 3JZNA 4FB1D 3UR4A 4FWWA 3NIFA 4ZOYA 3A0FA 4WJKA 4BCDA 3OKTA 3MMYA 1SQJA 2HJ4A 4A7JA 2CE9A 1U4CA 2CN3A 2H6NA 3SWSD 3K6SA 3GC3B 5FXYA 2PBIB 3VI3A 4D9SA 3MUNA 3BG0A 2EIBA 3J81g 2OJYA 4GGAA 3NVNA 2HYEA 4CZYA 3SBPA 4AEZA 4N14A 3GFCA 3N0EA 4LG9A 5H1MA 4QQEA 3W15A 4CY3A 2J57G 3RMZD 3F3FA 3I8CA 2VDKA 1T2XA 1QFSA 2P9PC 3PXWD 5C2WB 2CN2A 3PVUB 4A0AB 4AN1A 1VE7A 2B5NA 2I3SA 3JB9L 4J78A 3KRWB 4Z8LA 4ESGA 3EI2A 4DNUA 5FQDA 4CY2A 4NENA 4A09A 1XIPA 3ZDXA 1E8MA 3C9CA 3ZE2A 3JROA 3DWLC 4IRZA 5HE3B 4GQBB 3I7KA 3DM0A 2VDRA 3OW8A 5M5VA 2CO0A 3I89A 3I7PA 4CC9A 2HKRA 5C86A 2B5MA 3EI4B 1GG2B 4J8BA 5CXCA 5C92A 2Z2OA 4AOWA 3DXKC 5EMJB 4A11B 3MVDK 2IAAA 4AMZA 3CIKB 4O02A 5M5RA 5M61A 3EQ7A 4K3ID 4QL1A 1B9XA 3NIGA 3EMHA 3NVXA 4J84A 4CI8A 1RI6A 3GREA 2H9NA 5FKSA 4A2MA 2AGZA 3KRXB
chains in the Genus database with same CATH topology
2Z2PA 4Y7RA 4CZXA 4U1EI 4HDJA 4BL0A 4PNKB 2YMUA 5GXHA 2TRCB 5CYKA 4CI2A 3F3GA 4JSVC 3OKWA 1K32A 2BBKH 3AL8A 4J0WA 3SFZA 2IWFA 3RN0D 2YNOA 4NSXA 4O3TB 5HE0B 4XYIA 2H6KA 4X3EA 2YB8B 3RFHA 2AGWA 3UVLA 3JRPA 4JSPC 2XL3A 1U2VC 3EI3B 2H13A 3VGZA 5CXBB 3DSMA 2OVRB 2OIZA 5EMLB 3EWEA 2UZYB 3N0DA 5IJ7E 4I79A 4A08A 3RFGA 1K8KC 2O9KA 1XHMA 4PBYA 5HYNB 3EG6A 3F3PA 2HESX 3SHFA 2H9PA 3SN6B 4H5IA 2H68A 3CFVA 4FA1D 3RLMD 5K1CC 3K26A 3PXSD 5HE1B 1MDAH 2P9SC 2I0TA 3RN1D 5I5MA 3ORVD 3OL2B 4GZ8A 5EMMB 3VH0A 4E5ZA 1SHYB 2AGYA 1JOFA 4H5JA 5FLXg 3JZGA 3SCYA 1B9YA 1P22A 3UVKA 4L3HD 4K3JB 3EI2B 1S4UX 3RSEC 1GOTB 4GM3A 5I5JA 5EM2A 1PBYB 4O3UB 5EARA 4BUJC 4J77A 4JSXC 4GQ2P 1XKSA 1N6FA 3MZLA 4E54A 2J55H 4KFMB 3J80g 1GP2B 4J8GA 1JMXB 2AH0A 2GC7A 5CXCB 1MG2A 3U4YA 2IURA 2HKMA 3IJCA 4FA4D 5AFU3 3SJLD 5THAA 5A2Qg 3PSCB 4JXMA 2CO0C 5EMKB 5KDOB 4EWRA 3MKSB 3MXXA 1JJUB 3IIWA 4CI1A 3SLED 2Q7QA 2OK6A 3BWSA 2GNQA 2H3XA 2MTAH 4J82A 4CZVA 4GMBA 3FGBA 4U7AA 1FWXA 2PM9A 5SXMA 3PSLA 5CYKB 4L9OA 2AH1A 5TEFA 5FKTA 2YBAA 2UZXB 3UVNA 3C75H 3V9FA 3AL8B 4FAVD 4X63B 1L0QA 4ZOZA 1MG3A 3JZHA 1PEVA 3EU7A 3SBRA 4XYHA 1NEXB 4GM9A 5IGQA 2H14A 1NR0A 2IWKA 3FRXA 4XEIC 4PSWB 4ERYA 2XL2A 3HFQA 3UKUC 3SVWD 4X60B 3BG1A 2H47A 3OKYA 2HJBA 3UVMA 5H14A 2P9KC 3PE7A 3I7HA 4OWRA 1TYQC 4A08B 5JWZA 3CFSB 4X61B 2G99A 2XYIA 4UI9R 3IJ1A 4A0BA 4J73A 5GSAA 2EBSA 5TDHB 3V5WB 3VA6A 2H9MA 2QXVA 3I8EA 4ZOXA 3UVOA 1OLZA 4PSXB 4TZ4A 4FHLA 5H17A 4O45A 5IGOA 4E5ZB 4BH6A 4OZUA 2AQ5A 3RRMC 5CXBA 4Y5RD 2PM7B 3FM0A 5TF2A 5FKRA 5TEEA 5EALA 2J56H 5EM2B 3L4OD 5AJAA 5IT9g 4LGNA 4GGDA 1YFQA 5GMKn 3EI1A 3SMRA 3JAMg 4GM8A 4L3GD 2H6QA 1ERJA 4FA9D 2B5LA 4E54B 4A09B 3L4MD 4ERQA 2OVPB 1SQ9A 4JD2C 4ERZA 3ODTA 2AGLA 2PM6B 4GQ1A 2W18A 3E0CA 1TBGA 3NVQA 1A0RB 5EAPA 4CY1A 3AH8B 1N6DA 3I7NA 1OMWB 2G9AA 2Z2NA 3OL2A 3MKQA 3AFCA 1Q47A 5I5IA 4IMMA 4D0KA 1PI6A 1PGUA 2PM9B 5EAMA 4A0AA 3P4FA 1VYHC 3B7FA 4J87A 4J86A 3SBQA 5IC7A 4PBZA 1R5MA 2HXCA 4JT5C 4FAND 2P9LC 4J81A 4J79A 4ES0A 5B4WA 5C9ZB 3DXMC 4YVDA 4JT6C 3IJ0A 4ZOVA 2P9UC 4PC0A 4GGCA 2IUPA 4FA5D 3ZWLB 3UKRC 3OTTA 5FKQA 5IJ8E 2CE8A 3EI4A 3I2NA 1QNIA 4R7AB 2XU7A 3OKYB 3AL9A 2YNNA 4A11A 4CI3A 4J0XA 2P9IC 3IKOA 4L1QD 2P9NC 2AGXA 5GXIA 2IUVA 1JMZB 1N6EA 2OK4A 4A0BB 4QRJA 3I7OA 3I7LA 5K19A 3MZKA 2I0RA 2OVQB 3K27A 4LG8A 4MK0B 3C5MA 2QC5A 4O1QD 5AMSA 3V7DB 4ZN4A 2BCJB 2CNXA 2IUQA 3JPXA 4QT8A 4O9DA 5HQGA 5HE2B 5C2VB 3ULEC 3PVWB 4PXWA 4A2LA 2YNPA 4JSNC 4IA9A 4CY5A 2B4EA 3SXTD 5FA5B 1GXRA 3EI3A 2I3TA 3EI1B 4D6VA 2I0SA 2H9LA 3IIYA 3C99A 3PXTD 4G56B 2GC4A 3JZNA 4FB1D 3UR4A 4FWWA 4ZOYA 3A0FA 3OKTA 3MMYA 1SQJA 2HJ4A 4A7JA 2CE9A 1U4CA 2CN3A 2H6NA 3SWSD 5FXYA 2PBIB 3BG0A 3J81g 2OJYA 4GGAA 3NVNA 2HYEA 4CZYA 3SBPA 4AEZA 4N14A 3GFCA 3N0EA 4LG9A 5H1MA 4QQEA 3W15A 4CY3A 2J57G 3RMZD 3F3FA 3I8CA 2P9PC 3PXWD 5C2WB 2CN2A 3PVUB 4A0AB 2B5NA 2I3SA 3JB9L 4J78A 3KRWB 4Z8LA 4ESGA 3EI2A 5FQDA 4CY2A 4A09A 1XIPA 3C9CA 3JROA 3DWLC 5HE3B 4GQBB 3I7KA 3DM0A 3OW8A 2CO0A 3I89A 3I7PA 4CC9A 2HKRA 2B5MA 3EI4B 1GG2B 4J8BA 5CXCA 2Z2OA 4AOWA 3DXKC 5EMJB 4A11B 2IAAA 3CIKB 4K3ID 4QL1A 1B9XA 3EMHA 3NVXA 4J84A 4CI8A 1RI6A 3GREA 2H9NA 5FKSA 4A2MA 2AGZA 3KRXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z2P A;  4Y7R A;  4CZX A;  4U1E I;  4HDJ A;  4BL0 A;  4PNK B;  2YMU A;  5GXH A;  2TRC B;  5CYK A;  4CI2 A;  3F3G A;  4JSV C;  3OKW A;  1K32 A;  2BBK H;  3AL8 A;  4J0W A;  3SFZ A;  2IWF A;  3RN0 D;  2YNO A;  4NSX A;  4O3T B;  5HE0 B;  4XYI A;  2H6K A;  4X3E A;  2YB8 B;  3RFH A;  2AGW A;  3UVL A;  3JRP A;  4JSP C;  2XL3 A;  1U2V C;  3EI3 B;  2H13 A;  3VGZ A;  5CXB B;  3DSM A;  2OVR B;  2OIZ A;  5EML B;  3EWE A;  2UZY B;  3N0D A;  5IJ7 E;  4I79 A;  4A08 A;  3RFG A;  1K8K C;  2O9K A;  1XHM A;  4PBY A;  5HYN B;  3EG6 A;  3F3P A;  2HES X;  3SHF A;  2H9P A;  3SN6 B;  4H5I A;  2H68 A;  3CFV A;  4FA1 D;  3RLM D;  5K1C C;  3K26 A;  3PXS D;  5HE1 B;  1MDA H;  2P9S C;  2I0T A;  3RN1 D;  5I5M A;  3ORV D;  3OL2 B;  4GZ8 A;  5EMM B;  3VH0 A;  4E5Z A;  1SHY B;  2AGY A;  1JOF A;  4H5J A;  5FLX g;  3JZG A;  3SCY A;  1B9Y A;  1P22 A;  3UVK A;  4L3H D;  4K3J B;  3EI2 B;  1S4U X;  3RSE C;  1GOT B;  4GM3 A;  5I5J A;  5EM2 A;  1PBY B;  4O3U B;  5EAR A;  4BUJ C;  4J77 A;  4JSX C;  4GQ2 P;  1XKS A;  1N6F A;  3MZL A;  4E54 A;  2J55 H;  4KFM B;  3J80 g;  1GP2 B;  4J8G A;  1JMX B;  2AH0 A;  2GC7 A;  5CXC B;  1MG2 A;  3U4Y A;  2IUR A;  2HKM A;  3IJC A;  4FA4 D;  5AFU 3;  3SJL D;  5THA A;  5A2Q g;  3PSC B;  4JXM A;  2CO0 C;  5EMK B;  5KDO B;  4EWR A;  3MKS B;  3MXX A;  1JJU B;  3IIW A;  4CI1 A;  3SLE D;  2Q7Q A;  2OK6 A;  3BWS A;  2GNQ A;  2H3X A;  2MTA H;  4J82 A;  4CZV A;  4GMB A;  3FGB A;  4U7A A;  1FWX A;  2PM9 A;  5SXM A;  3PSL A;  5CYK B;  4L9O A;  2AH1 A;  5TEF A;  5FKT A;  2YBA A;  2UZX B;  3UVN A;  3C75 H;  3V9F A;  3AL8 B;  4FAV D;  4X63 B;  1L0Q A;  4ZOZ A;  1MG3 A;  3JZH A;  1PEV A;  3EU7 A;  3SBR A;  4XYH A;  1NEX B;  4GM9 A;  5IGQ A;  2H14 A;  1NR0 A;  2IWK A;  3FRX A;  4XEI C;  4PSW B;  4ERY A;  2XL2 A;  3HFQ A;  3UKU C;  3SVW D;  4X60 B;  3BG1 A;  2H47 A;  3OKY A;  2HJB A;  3UVM A;  5H14 A;  2P9K C;  3PE7 A;  3I7H A;  4OWR A;  1TYQ C;  4A08 B;  5JWZ A;  3CFS B;  4X61 B;  2G99 A;  2XYI A;  4UI9 R;  3IJ1 A;  4A0B A;  4J73 A;  5GSA A;  2EBS A;  5TDH B;  3V5W B;  3VA6 A;  2H9M A;  2QXV A;  3I8E A;  4ZOX A;  3UVO A;  1OLZ A;  4PSX B;  4TZ4 A;  4FHL A;  5H17 A;  4O45 A;  5IGO A;  4E5Z B;  4BH6 A;  4OZU A;  2AQ5 A;  3RRM C;  5CXB A;  4Y5R D;  2PM7 B;  3FM0 A;  5TF2 A;  5FKR A;  5TEE A;  5EAL A;  2J56 H;  5EM2 B;  3L4O D;  5AJA A;  5IT9 g;  4LGN A;  4GGD A;  1YFQ A;  5GMK n;  3EI1 A;  3SMR A;  3JAM g;  4GM8 A;  4L3G D;  2H6Q A;  1ERJ A;  4FA9 D;  2B5L A;  4E54 B;  4A09 B;  3L4M D;  4ERQ A;  2OVP B;  1SQ9 A;  4JD2 C;  4ERZ A;  3ODT A;  2AGL A;  2PM6 B;  4GQ1 A;  2W18 A;  3E0C A;  1TBG A;  3NVQ A;  1A0R B;  5EAP A;  4CY1 A;  3AH8 B;  1N6D A;  3I7N A;  1OMW B;  2G9A A;  2Z2N A;  3OL2 A;  3MKQ A;  3AFC A;  1Q47 A;  5I5I A;  4IMM A;  4D0K A;  1PI6 A;  1PGU A;  2PM9 B;  5EAM A;  4A0A A;  3P4F A;  1VYH C;  3B7F A;  4J87 A;  4J86 A;  3SBQ A;  5IC7 A;  4PBZ A;  1R5M A;  2HXC A;  4JT5 C;  4FAN D;  2P9L C;  4J81 A;  4J79 A;  4ES0 A;  5B4W A;  5C9Z B;  3DXM C;  4YVD A;  4JT6 C;  3IJ0 A;  4ZOV A;  2P9U C;  4PC0 A;  4GGC A;  2IUP A;  4FA5 D;  3ZWL B;  3UKR C;  3OTT A;  5FKQ A;  5IJ8 E;  2CE8 A;  3EI4 A;  3I2N A;  1QNI A;  4R7A B;  2XU7 A;  3OKY B;  3AL9 A;  2YNN A;  4A11 A;  4CI3 A;  4J0X A;  2P9I C;  3IKO A;  4L1Q D;  2P9N C;  2AGX A;  5GXI A;  2IUV A;  1JMZ B;  1N6E A;  2OK4 A;  4A0B B;  4QRJ A;  3I7O A;  3I7L A;  5K19 A;  3MZK A;  2I0R A;  2OVQ B;  3K27 A;  4LG8 A;  4MK0 B;  3C5M A;  2QC5 A;  4O1Q D;  5AMS A;  3V7D B;  4ZN4 A;  2BCJ B;  2CNX A;  2IUQ A;  3JPX A;  4QT8 A;  4O9D A;  5HQG A;  5HE2 B;  5C2V B;  3ULE C;  3PVW B;  4PXW A;  4A2L A;  2YNP A;  4JSN C;  4IA9 A;  4CY5 A;  2B4E A;  3SXT D;  5FA5 B;  1GXR A;  3EI3 A;  2I3T A;  3EI1 B;  4D6V A;  2I0S A;  2H9L A;  3IIY A;  3C99 A;  3PXT D;  4G56 B;  2GC4 A;  3JZN A;  4FB1 D;  3UR4 A;  4FWW A;  4ZOY A;  3A0F A;  3OKT A;  3MMY A;  1SQJ A;  2HJ4 A;  4A7J A;  2CE9 A;  1U4C A;  2CN3 A;  2H6N A;  3SWS D;  5FXY A;  2PBI B;  3BG0 A;  3J81 g;  2OJY A;  4GGA A;  3NVN A;  2HYE A;  4CZY A;  3SBP A;  4AEZ A;  4N14 A;  3GFC A;  3N0E A;  4LG9 A;  5H1M A;  4QQE A;  3W15 A;  4CY3 A;  2J57 G;  3RMZ D;  3F3F A;  3I8C A;  2P9P C;  3PXW D;  5C2W B;  2CN2 A;  3PVU B;  4A0A B;  2B5N A;  2I3S A;  3JB9 L;  4J78 A;  3KRW B;  4Z8L A;  4ESG A;  3EI2 A;  5FQD A;  4CY2 A;  4A09 A;  1XIP A;  3C9C A;  3JRO A;  3DWL C;  5HE3 B;  4GQB B;  3I7K A;  3DM0 A;  3OW8 A;  2CO0 A;  3I89 A;  3I7P A;  4CC9 A;  2HKR A;  2B5M A;  3EI4 B;  1GG2 B;  4J8B A;  5CXC A;  2Z2O A;  4AOW A;  3DXK C;  5EMJ B;  4A11 B;  2IAA A;  3CIK B;  4K3I D;  4QL1 A;  1B9X A;  3EMH A;  3NVX A;  4J84 A;  4CI8 A;  1RI6 A;  3GRE A;  2H9N A;  5FKS A;  4A2M A;  2AGZ A;  3KRX B; 
#chains in the Genus database with same CATH topology
 2Z2P A;  4Y7R A;  4WK2 A;  4G55 A;  4CZX A;  4U1E I;  4HDJ A;  4BL0 A;  4PNK B;  2YMU A;  5GXH A;  1O6F A;  2TRC B;  5CYK A;  4CI2 A;  3F3G A;  2XE4 A;  4JSV C;  3OKW A;  1K32 A;  5M5T A;  2BBK H;  4NAA A;  3AL8 A;  3T3M A;  4J0W A;  3SFZ A;  2IWF A;  3RN0 D;  2YNO A;  4AMY A;  1VE6 A;  4NSX A;  4O3T B;  4UM8 A;  5HE0 B;  1VZ2 A;  4XYI A;  2H6K A;  4X3E A;  2YB8 B;  3RFH A;  2AGW A;  3UVL A;  3JRP A;  4JSP C;  1H2W A;  2XL3 A;  4QAM A;  1U2V C;  4AN0 A;  3EI3 B;  2H13 A;  4O2W A;  3VGZ A;  5CXB B;  2QZP A;  3DSM A;  2OVR B;  2VZ3 A;  2OIZ A;  5EML B;  3EWE A;  3NID A;  2UZY B;  3N0D A;  1C9L A;  5IJ7 E;  4I79 A;  4NBM A;  4A08 A;  3RFG A;  1K8K C;  2O9K A;  1XHM A;  1YR2 A;  4PBY A;  5HYN B;  2QR5 A;  3EG6 A;  3GD1 I;  3F3P A;  3OF7 A;  2HES X;  3EQ8 A;  4NC4 A;  1BPO A;  3EQ9 A;  3SHF A;  4DNW A;  4Z7N A;  2H9P A;  3SN6 B;  4H5I A;  2H68 A;  1UOP A;  3CFV A;  5HDB A;  3RLM D;  4FA1 D;  5K1C C;  3K26 A;  3FCS A;  3PXS D;  5HE1 B;  1MDA H;  2P9S C;  2I0T A;  3RN1 D;  5I5M A;  3ORV D;  3OL2 B;  4GZ8 A;  5EMM B;  4UM9 A;  3VH0 A;  4E5Z A;  1C9I A;  1SHY B;  2AGY A;  1JOF A;  4H5J A;  5FLX g;  3JZG A;  3O4G A;  3SCY A;  1B9Y A;  1P22 A;  4MMY A;  3UVK A;  4L3H D;  4K3J B;  3EI2 B;  2WQ8 A;  1S4U X;  3RSE C;  1GOT B;  4GM3 A;  5I5J A;  5EM2 A;  1M1X A;  1PBY B;  4O3U B;  5EAR A;  4BUJ C;  4J77 A;  2XZG A;  4JSX C;  4GQ2 P;  1XKS A;  1N6F A;  1QFM A;  3FCU A;  3MZL A;  4E54 A;  2J55 H;  1E5T A;  4KFM B;  3J80 g;  3V4P A;  1GP2 B;  4J8G A;  4WK4 A;  1JMX B;  2AH0 A;  2GC7 A;  1U8C A;  5CXC B;  1MG2 A;  3U4Y A;  2IUR A;  2HKM A;  3ZDY A;  3IJC A;  4FA4 D;  5AFU 3;  3SJL D;  5THA A;  5A2Q g;  3PSC B;  4JXM A;  2CO0 C;  5EMK B;  5KDO B;  4EWR A;  3MKS B;  3MXX A;  1JJU B;  3IIW A;  3ZE0 A;  1VZ3 A;  4CI1 A;  2VDP A;  1GOH A;  1GOF A;  2HU5 A;  2VZ1 A;  4JHP C;  3SLE D;  2Q7Q A;  4BP8 A;  4RE5 A;  2OK6 A;  3BWS A;  2GNQ A;  2H3X A;  2MTA H;  4J82 A;  5E6U A;  4CZV A;  4GMB A;  3FGB A;  4U7A A;  2XDW A;  1FWX A;  2PM9 A;  5SXM A;  3PSL A;  2EID A;  5CYK B;  4L9O A;  2AH1 A;  5TEF A;  5FKT A;  2YBA A;  2UZX B;  3UVN A;  3C75 H;  3V9F A;  3AL8 B;  4FAV D;  4X63 B;  1L0Q A;  2BKL A;  4ZOZ A;  1MG3 A;  3JZH A;  1PEV A;  3IUJ A;  3EU7 A;  3SBR A;  4XYH A;  2EIC A;  1NEX B;  2EIE A;  4GM9 A;  3O4H A;  5IGQ A;  2H14 A;  1NR0 A;  2IWK A;  3FRX A;  4XEI C;  4PSW B;  4ERY A;  2XL2 A;  3HFQ A;  3UKU C;  3SVW D;  4X60 B;  3QHY B;  1H2Y A;  3BG1 A;  2H47 A;  3OKY A;  1I2M B;  2HJB A;  3DDU A;  3UVM A;  5H14 A;  2P9K C;  3PE7 A;  3I7H A;  4OWR A;  1TYQ C;  4A08 B;  5JWZ A;  3CFS B;  4X61 B;  3IUN A;  2G99 A;  2XYI A;  3IUQ A;  4UI9 R;  3IJ1 A;  3IUL A;  4A0B A;  4J73 A;  4G1E A;  5GSA A;  2EBS A;  5TDH B;  3V5W B;  3VA6 A;  2H9M A;  2QXV A;  1UOO A;  2VDQ A;  4RE6 A;  3I8E A;  4ZOX A;  3UVO A;  1OLZ A;  5E6R A;  4PSX B;  1H2Z A;  4TZ4 A;  4FHL A;  5H17 A;  4O45 A;  5IGO A;  4E5Z B;  4BH6 A;  4OZU A;  3IUM A;  2VDO A;  5M5U A;  2AQ5 A;  3RRM C;  1A12 A;  5CXB A;  4Y5R D;  2PM7 B;  3FM0 A;  3IUR A;  5E6S A;  5TF2 A;  4DNV A;  5FKR A;  5TEE A;  5EAL A;  2J56 H;  1UOQ A;  5EM2 B;  3L4O D;  5AJA A;  5IT9 g;  4LGN A;  3QI0 A;  5FFG A;  4GGD A;  1YFQ A;  5GMK n;  4AX4 A;  3EI1 A;  3SMR A;  3JAM g;  4GM8 A;  2H6Q A;  4L3G D;  1ERJ A;  4WK0 A;  2B5L A;  4FA9 D;  1JV2 A;  4E54 B;  3K72 A;  4Z7Q A;  4A09 B;  3L4M D;  1TYE A;  4ERQ A;  2OVP B;  1SQ9 A;  4JD2 C;  4ERZ A;  3ODT A;  2AGL A;  1E8N A;  5M5S A;  2PM6 B;  4GQ1 A;  2W18 A;  3E0C A;  1TBG A;  3NVQ A;  2HU8 A;  1A0R B;  5EAP A;  4CY1 A;  3AH8 B;  1N6D A;  3I7N A;  1OMW B;  2G9A A;  4Z7O A;  2Z2N A;  3OL2 A;  3MKQ A;  2VDM A;  1Q47 A;  3AFC A;  3ZDZ A;  5I5I A;  4IMM A;  4D0K A;  1PI6 A;  3O4I A;  1PGU A;  4MMZ A;  5FFO A;  3V4V A;  2PM9 B;  5EAM A;  4A0A A;  3P4F A;  1VYH C;  3B7F A;  1L5G A;  4J87 A;  4J86 A;  3SBQ A;  1H2X A;  5IC7 A;  2HU7 A;  4PBZ A;  1R5M A;  3MUO A;  3KCI A;  2HXC A;  4JT5 C;  4FAN D;  4BP9 A;  3K71 A;  2P9L C;  4J81 A;  4J79 A;  4ES0 A;  5B4W A;  5C9Z B;  3DXM C;  4YVD A;  4JT6 C;  1K3I A;  3IJ0 A;  4ZOV A;  2VC2 A;  2P9U C;  4PC0 A;  4GGC A;  2IUP A;  4L1M A;  3ZWL B;  4FA5 D;  3UKR C;  2JKX A;  3OTT A;  5FKQ A;  5IJ8 E;  2CE8 A;  3EI4 A;  3I2N A;  1QNI A;  4R7A B;  4JHN A;  2XU7 A;  3OKY B;  3AL9 A;  2YNN A;  3VI4 A;  4A11 A;  4CI3 A;  4J0X A;  2P9I C;  3O4J A;  3IKO A;  4L1Q D;  4G1M A;  1O6G A;  2AGX A;  2P9N C;  5GXI A;  2IUV A;  1JMZ B;  4MMX A;  2VDL A;  1N6E A;  3IJE A;  2OK4 A;  4A0B B;  4QRJ A;  3I7O A;  3I7L A;  3ZE1 A;  5K19 A;  3MZK A;  2I0R A;  2OVQ B;  3K27 A;  4LG8 A;  4MK0 B;  3C5M A;  2QC5 A;  4O1Q D;  5AMS A;  3V7D B;  4ZN4 A;  2BCJ B;  2CNX A;  2IUQ A;  3JPX A;  3T3P A;  4QT8 A;  4O9D A;  5HQG A;  5HE2 B;  5C2V B;  3ULE C;  3PVW B;  4PXW A;  2VDN A;  4A2L A;  2YNP A;  4JSN C;  4IA9 A;  4CY5 A;  2B4E A;  3SXT D;  5FA5 B;  1GXR A;  4BCC A;  3EI3 A;  1JTD B;  2I3T A;  3EI1 B;  4D6V A;  3IVM A;  2I0S A;  1GOG A;  2H9L A;  3IIY A;  3C99 A;  1UTC A;  4BCB A;  3PXT D;  4G56 B;  2GC4 A;  3JZN A;  4FB1 D;  3UR4 A;  4FWW A;  3NIF A;  4ZOY A;  3A0F A;  4WJK A;  4BCD A;  3OKT A;  3MMY A;  1SQJ A;  2HJ4 A;  4A7J A;  2CE9 A;  1U4C A;  2CN3 A;  2H6N A;  3SWS D;  3K6S A;  3GC3 B;  5FXY A;  2PBI B;  3VI3 A;  4D9S A;  3MUN A;  3BG0 A;  2EIB A;  3J81 g;  2OJY A;  4GGA A;  3NVN A;  2HYE A;  4CZY A;  3SBP A;  4AEZ A;  4N14 A;  3GFC A;  3N0E A;  4LG9 A;  5H1M A;  4QQE A;  3W15 A;  4CY3 A;  2J57 G;  3RMZ D;  3F3F A;  3I8C A;  2VDK A;  1T2X A;  1QFS A;  2P9P C;  3PXW D;  5C2W B;  2CN2 A;  3PVU B;  4A0A B;  4AN1 A;  1VE7 A;  2B5N A;  2I3S A;  3JB9 L;  4J78 A;  3KRW B;  4Z8L A;  4ESG A;  3EI2 A;  4DNU A;  5FQD A;  4CY2 A;  4NEN A;  4A09 A;  1XIP A;  3ZDX A;  1E8M A;  3C9C A;  3ZE2 A;  3JRO A;  3DWL C;  4IRZ A;  5HE3 B;  4GQB B;  3I7K A;  3DM0 A;  2VDR A;  3OW8 A;  5M5V A;  2CO0 A;  3I89 A;  3I7P A;  4CC9 A;  2HKR A;  5C86 A;  2B5M A;  3EI4 B;  1GG2 B;  4J8B A;  5CXC A;  5C92 A;  2Z2O A;  4AOW A;  3DXK C;  5EMJ B;  4A11 B;  3MVD K;  2IAA A;  4AMZ A;  3CIK B;  4O02 A;  5M5R A;  5M61 A;  3EQ7 A;  4K3I D;  4QL1 A;  1B9X A;  3NIG A;  3EMH A;  3NVX A;  4J84 A;  4CI8 A;  1RI6 A;  3GRE A;  2H9N A;  5FKS A;  4A2M A;  2AGZ A;  3KRX B; 
#chains in the Genus database with same CATH homology
 2Z2P A;  4Y7R A;  4CZX A;  4U1E I;  4HDJ A;  4BL0 A;  4PNK B;  2YMU A;  5GXH A;  2TRC B;  5CYK A;  4CI2 A;  3F3G A;  4JSV C;  3OKW A;  1K32 A;  2BBK H;  3AL8 A;  4J0W A;  3SFZ A;  2IWF A;  3RN0 D;  2YNO A;  4NSX A;  4O3T B;  5HE0 B;  4XYI A;  2H6K A;  4X3E A;  2YB8 B;  3RFH A;  2AGW A;  3UVL A;  3JRP A;  4JSP C;  2XL3 A;  1U2V C;  3EI3 B;  2H13 A;  3VGZ A;  5CXB B;  3DSM A;  2OVR B;  2OIZ A;  5EML B;  3EWE A;  2UZY B;  3N0D A;  5IJ7 E;  4I79 A;  4A08 A;  3RFG A;  1K8K C;  2O9K A;  1XHM A;  4PBY A;  5HYN B;  3EG6 A;  3F3P A;  2HES X;  3SHF A;  2H9P A;  3SN6 B;  4H5I A;  2H68 A;  3CFV A;  4FA1 D;  3RLM D;  5K1C C;  3K26 A;  3PXS D;  5HE1 B;  1MDA H;  2P9S C;  2I0T A;  3RN1 D;  5I5M A;  3ORV D;  3OL2 B;  4GZ8 A;  5EMM B;  3VH0 A;  4E5Z A;  1SHY B;  2AGY A;  1JOF A;  4H5J A;  5FLX g;  3JZG A;  3SCY A;  1B9Y A;  1P22 A;  3UVK A;  4L3H D;  4K3J B;  3EI2 B;  1S4U X;  3RSE C;  1GOT B;  4GM3 A;  5I5J A;  5EM2 A;  1PBY B;  4O3U B;  5EAR A;  4BUJ C;  4J77 A;  4JSX C;  4GQ2 P;  1XKS A;  1N6F A;  3MZL A;  4E54 A;  2J55 H;  4KFM B;  3J80 g;  1GP2 B;  4J8G A;  1JMX B;  2AH0 A;  2GC7 A;  5CXC B;  1MG2 A;  3U4Y A;  2IUR A;  2HKM A;  3IJC A;  4FA4 D;  5AFU 3;  3SJL D;  5THA A;  5A2Q g;  3PSC B;  4JXM A;  2CO0 C;  5EMK B;  5KDO B;  4EWR A;  3MKS B;  3MXX A;  1JJU B;  3IIW A;  4CI1 A;  3SLE D;  2Q7Q A;  2OK6 A;  3BWS A;  2GNQ A;  2H3X A;  2MTA H;  4J82 A;  4CZV A;  4GMB A;  3FGB A;  4U7A A;  1FWX A;  2PM9 A;  5SXM A;  3PSL A;  5CYK B;  4L9O A;  2AH1 A;  5TEF A;  5FKT A;  2YBA A;  2UZX B;  3UVN A;  3C75 H;  3V9F A;  3AL8 B;  4FAV D;  4X63 B;  1L0Q A;  4ZOZ A;  1MG3 A;  3JZH A;  1PEV A;  3EU7 A;  3SBR A;  4XYH A;  1NEX B;  4GM9 A;  5IGQ A;  2H14 A;  1NR0 A;  2IWK A;  3FRX A;  4XEI C;  4PSW B;  4ERY A;  2XL2 A;  3HFQ A;  3UKU C;  3SVW D;  4X60 B;  3BG1 A;  2H47 A;  3OKY A;  2HJB A;  3UVM A;  5H14 A;  2P9K C;  3PE7 A;  3I7H A;  4OWR A;  1TYQ C;  4A08 B;  5JWZ A;  3CFS B;  4X61 B;  2G99 A;  2XYI A;  4UI9 R;  3IJ1 A;  4A0B A;  4J73 A;  5GSA A;  2EBS A;  5TDH B;  3V5W B;  3VA6 A;  2H9M A;  2QXV A;  3I8E A;  4ZOX A;  3UVO A;  1OLZ A;  4PSX B;  4TZ4 A;  4FHL A;  5H17 A;  4O45 A;  5IGO A;  4E5Z B;  4BH6 A;  4OZU A;  2AQ5 A;  3RRM C;  5CXB A;  4Y5R D;  2PM7 B;  3FM0 A;  5TF2 A;  5FKR A;  5TEE A;  5EAL A;  2J56 H;  5EM2 B;  3L4O D;  5AJA A;  5IT9 g;  4LGN A;  4GGD A;  1YFQ A;  5GMK n;  3EI1 A;  3SMR A;  3JAM g;  4GM8 A;  4L3G D;  2H6Q A;  1ERJ A;  4FA9 D;  2B5L A;  4E54 B;  4A09 B;  3L4M D;  4ERQ A;  2OVP B;  1SQ9 A;  4JD2 C;  4ERZ A;  3ODT A;  2AGL A;  2PM6 B;  4GQ1 A;  2W18 A;  3E0C A;  1TBG A;  3NVQ A;  1A0R B;  5EAP A;  4CY1 A;  3AH8 B;  1N6D A;  3I7N A;  1OMW B;  2G9A A;  2Z2N A;  3OL2 A;  3MKQ A;  3AFC A;  1Q47 A;  5I5I A;  4IMM A;  4D0K A;  1PI6 A;  1PGU A;  2PM9 B;  5EAM A;  4A0A A;  3P4F A;  1VYH C;  3B7F A;  4J87 A;  4J86 A;  3SBQ A;  5IC7 A;  4PBZ A;  1R5M A;  2HXC A;  4JT5 C;  4FAN D;  2P9L C;  4J81 A;  4J79 A;  4ES0 A;  5B4W A;  5C9Z B;  3DXM C;  4YVD A;  4JT6 C;  3IJ0 A;  4ZOV A;  2P9U C;  4PC0 A;  4GGC A;  2IUP A;  4FA5 D;  3ZWL B;  3UKR C;  3OTT A;  5FKQ A;  5IJ8 E;  2CE8 A;  3EI4 A;  3I2N A;  1QNI A;  4R7A B;  2XU7 A;  3OKY B;  3AL9 A;  2YNN A;  4A11 A;  4CI3 A;  4J0X A;  2P9I C;  3IKO A;  4L1Q D;  2P9N C;  2AGX A;  5GXI A;  2IUV A;  1JMZ B;  1N6E A;  2OK4 A;  4A0B B;  4QRJ A;  3I7O A;  3I7L A;  5K19 A;  3MZK A;  2I0R A;  2OVQ B;  3K27 A;  4LG8 A;  4MK0 B;  3C5M A;  2QC5 A;  4O1Q D;  5AMS A;  3V7D B;  4ZN4 A;  2BCJ B;  2CNX A;  2IUQ A;  3JPX A;  4QT8 A;  4O9D A;  5HQG A;  5HE2 B;  5C2V B;  3ULE C;  3PVW B;  4PXW A;  4A2L A;  2YNP A;  4JSN C;  4IA9 A;  4CY5 A;  2B4E A;  3SXT D;  5FA5 B;  1GXR A;  3EI3 A;  2I3T A;  3EI1 B;  4D6V A;  2I0S A;  2H9L A;  3IIY A;  3C99 A;  3PXT D;  4G56 B;  2GC4 A;  3JZN A;  4FB1 D;  3UR4 A;  4FWW A;  4ZOY A;  3A0F A;  3OKT A;  3MMY A;  1SQJ A;  2HJ4 A;  4A7J A;  2CE9 A;  1U4C A;  2CN3 A;  2H6N A;  3SWS D;  5FXY A;  2PBI B;  3BG0 A;  3J81 g;  2OJY A;  4GGA A;  3NVN A;  2HYE A;  4CZY A;  3SBP A;  4AEZ A;  4N14 A;  3GFC A;  3N0E A;  4LG9 A;  5H1M A;  4QQE A;  3W15 A;  4CY3 A;  2J57 G;  3RMZ D;  3F3F A;  3I8C A;  2P9P C;  3PXW D;  5C2W B;  2CN2 A;  3PVU B;  4A0A B;  2B5N A;  2I3S A;  3JB9 L;  4J78 A;  3KRW B;  4Z8L A;  4ESG A;  3EI2 A;  5FQD A;  4CY2 A;  4A09 A;  1XIP A;  3C9C A;  3JRO A;  3DWL C;  5HE3 B;  4GQB B;  3I7K A;  3DM0 A;  3OW8 A;  2CO0 A;  3I89 A;  3I7P A;  4CC9 A;  2HKR A;  2B5M A;  3EI4 B;  1GG2 B;  4J8B A;  5CXC A;  2Z2O A;  4AOW A;  3DXK C;  5EMJ B;  4A11 B;  2IAA A;  3CIK B;  4K3I D;  4QL1 A;  1B9X A;  3EMH A;  3NVX A;  4J84 A;  4CI8 A;  1RI6 A;  3GRE A;  2H9N A;  5FKS A;  4A2M A;  2AGZ A;  3KRX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...