5EMKB

Crystal structure of prmt5:mep50 with compound 9 and sinefungin
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
313
structure length
313
Chain Sequence
EWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 82
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5emkB00
3OL2B 1RI6A 4U7AA 2W18A 2H9MA 3SBPA 3N0DA 4UI9R 5IJ8E 4JSXC 3DXKC 1OLZA 5IC7A 2HKMA 3MMYA 4LG8A 3PXWD 2H6QA 3I2NA 4JD2C 4A09A 3I7KA 3F3GA 5AJAA 3UVNA 3RLMD 4J86A 3OKWA 4ERZA 2P9UC 2XYIA 4A7JA 1U4CA 3JROA 3I7PA 2AGZA 2BBKH 1XKSA 4XEIC 1R5MA 2QC5A 2Z2OA 3KRWB 3E0CA 3JB9L 5A2Qg 2EBSA 1N6EA 2I0TA 3MXXA 4OZUA 2J55H 3P4FA 5CXCA 2H47A 3SLED 4O3TB 4PXWA 3V7DB 4EWRA 1ERJA 4FA9D 4ZOZA 4ERYA 4CI8A 4MK0B 3SFZA 3RSEC 3JZHA 2OVPB 3UR4A 4GQ1A 1SQJA 4CY2A 1XHMA 4J0XA 4CY1A 2HESX 3EG6A 4A11A 3RMZD 4CC9A 3JAMg 4K3JB 4GQ2P 5EAMA 5EALA 3ODTA 2PM6B 3A0FA 4A2MA 5H14A 3JPXA 5K1CC 3MZLA 3F3FA 5HYNB 5H17A 5GXIA 2P9PC 3EI1A 2OVQB 5EMKB 1XIPA 5HE1B 1JOFA 2CNXA 2I3TA 5GMKn 3BG1A 3K27A 2AGWA 2H6NA 1MDAH 1OMWB 4J82A 4O45A 4E54B 2P9NC 5I5IA 2G99A 4BUJC 4J87A 5FXYA 3I7NA 4A08A 4Y5RD 5CXBB 4LGNA 4X61B 5EAPA 4J8GA 1PGUA 3RN1D 4A11B 2HJ4A 3W15A 5C9ZB 2H9PA 2HJBA 3AL9A 4J78A 3SBQA 5AMSA 3EI1B 2YNNA 2CE9A 2AGXA 1Q47A 2J57G 1K8KC 1MG2A 3EWEA 4A0BA 3RFGA 2XL2A 1U2VC 3DM0A 3FRXA 4ZN4A 3SHFA 3GFCA 2CO0C 1FWXA 2CO0A 4J84A 1MG3A 2AGLA 3I7LA 2MTAH 1TBGA 2OK6A 3ORVD 3L4MD 2OVRB 4CI2A 2P9KC 4YVDA 3MZKA 3RFHA 2O9KA 5CYKA 4ESGA 4O3UB 1JJUB 3PSCB 3B7FA 3I89A 4E5ZA 3PE7A 3OKYB 3C5MA 1GG2B 4L9OA 3IIWA 5FKSA 3V5WB 4IA9A 3UKUC 2I3SA 3EI2A 4N14A 5AFU3 4GGDA 3I8EA 4PNKB 5B4WA 2YBAA 2IUVA 5I5MA 4L3HD 4PSXB 2B5MA 3L4OD 3DSMA 3CFVA 3SN6B 4QL1A 4E5ZB 3IKOA 4FWWA 3CFSB 2Z2NA 3DWLC 5EMLB 3VGZA 3FM0A 2YNPA 4QT8A 3BG0A 2P9LC 4H5IA 2PM9B 3JRPA 4XYIA 3RN0D 5K19A 2H9NA 5TEFA 3J81g 4A2LA 4L1QD 2J56H 4CZVA 3J80g 5THAA 4J77A 5FKTA 1N6DA 2P9IC 3PSLA 2H14A 3CIKB 3EI3A 3HFQA 4O1QD 2BCJB 5FA5B 4BL0A 3EI2B 5GXHA 4CY3A 1GOTB 3K26A 4NSXA 1TYQC 3NVQA 3OW8A 3AL8B 2QXVA 4CY5A 4FA4D 3SBRA 5FKQA 3VH0A 4A09B 4TZ4A 3UVLA 4JT5C 4Z8LA 2PBIB 3JZGA 5KDOB 2I0SA 2TRCB 5IGQA 1YFQA 1JMZB 2CN2A 2IUQA 1SHYB 4XYHA 5CXCB 2B5LA 4J0WA 4J79A 4JSNC 2B4EA 4ZOXA 4CZXA 3PXTD 3V9FA 3SJLD 4CI1A 3PVUB 3IIYA 3IJCA 1A0RB 3SCYA 2G9AA 4FHLA 1PI6A 1B9XA 2I0RA 5HE2B 3JZNA 4A0BB 4CZYA 2XU7A 2YB8B 3SWSD 4GQBB 2H68A 2UZYB 3NVNA 2P9SC 3U4YA 2OK4A 3C9CA 4G56B 2CE8A 5TEEA 1K32A 2IUPA 2YMUA 3EI4A 2H6KA 1P22A 3MKSB 2IWKA 4U1EI 2H13A 4JT6C 4A0AA 2IAAA 1B9YA 5SXMA 4PSWB 5FQDA 3OL2A 2Z2PA 3FGBA 4J8BA 4AOWA 2GNQA 3VA6A 2YNOA 4O9DA 1PBYB 1L0QA 5IJ7E 2IURA 4PBZA 5IGOA 5EARA 3OTTA 3I8CA 4LG9A 3IJ1A 2UZXB 3GREA 5HE3B 4ZOVA 3EMHA 4GGCA 4FA5D 2HYEA 3AH8B 5HE0B 2PM9A 3SXTD 4JXMA 5FKRA 3F3PA 4J73A 1PEVA 2Q7QA 4ES0A 5CYKB 2HKRA 3UVKA 4H5JA 4I79A 5EMMB 2PM7B 3NVXA 5EM2A 4L3GD 4GM3A 2AGYA 5TDHB 3OKYA 3EU7A 3DXMC 1N6FA 1QNIA 4ERQA 3N0EA 1GP2B 2AQ5A 4FAND 1S4UX 5H1MA 2OJYA 5CXBA 4J81A 5FLXg 4HDJA 3MKQA 4PBYA 4GM8A 5HQGA 3SVWD 2B5NA 5EM2B 2OIZA 4BH6A 2H3XA 3KRXB 3AL8A 4QRJA 3UVMA 3SMRA 5JWZA 4X63B 3AFCA 4GGAA 3UKRC 2GC4A 4GM9A 4AEZA 4FA1D 4GZ8A 2IWFA 4FB1D 3BWSA 3IJ0A 5C2WB 4QQEA 3PXSD 4JSVC 1JMXB 4X3EA 4Y7RA 4ZOYA 4E54A 4OWRA 4KFMB 5GSAA 3RRMC 3C75H 4X60B 1GXRA 3PVWB 4D0KA 5C2VB 4CI3A 4R7AB 3EI3B 4JSPC 3ZWLB 5IT9g 2HXCA 4GMBA 3OKTA 2GC7A 2XL3A 4K3ID 2AH0A 4IMMA 2AH1A 5EMJB 1NR0A 3UVOA 1NEXB 5I5JA 4A0AB 1SQ9A 3C99A 4FAVD 3I7HA 2CN3A 2H9LA 3EI4B 4PC0A 4A08B 3ULEC 3I7OA 4D6VA 5TF2A 1VYHC
chains in the Genus database with same CATH superfamily
3OL2B 1RI6A 4IRZA 4JHPC 4U7AA 5E6SA 2W18A 2H9MA 3SBPA 1UOQA 3N0DA 4UI9R 5IJ8E 4JSXC 3DXKC 4BP9A 4UM9A 1OLZA 2VDKA 5IC7A 2HKMA 3MMYA 1UTCA 4LG8A 3PXWD 1C9LA 2H6QA 3I2NA 1T2XA 1K3IA 4JD2C 4A09A 3I7KA 4WK0A 3F3GA 5AJAA 3EQ9A 3UVNA 2EIEA 3RLMD 2EIBA 4J86A 3OKWA 1H2XA 1H2YA 2P9UC 2QR5A 2XYIA 3QI0A 4A7JA 4ERZA 1U4CA 2HU5A 3JROA 3T3PA 3I7PA 2AGZA 2BBKH 1XKSA 4XEIC 1R5MA 2QC5A 3EQ8A 1E5TA 3V4VA 3IVMA 2Z2OA 3KRWB 3E0CA 3JB9L 1GOHA 5A2Qg 2EBSA 1VE7A 1N6EA 2I0TA 2VDOA 3MXXA 4OZUA 3MUOA 2J55H 3P4FA 5CXCA 2H47A 3SLED 4O3TB 4PXWA 3V7DB 4EWRA 1ERJA 5FFOA 5C92A 4FA9D 4ZOZA 1QFMA 4BP8A 4ERYA 4CI8A 4MK0B 3SFZA 3RSEC 1U8CA 3JZHA 3K72A 3T3MA 2OVPB 3UR4A 4GQ1A 1SQJA 4CY2A 1XHMA 1E8NA 4J0XA 4CY1A 2HESX 3EG6A 4A11A 3RMZD 4CC9A 3JAMg 4K3JB 4GQ2P 5EAMA 5EALA 3ODTA 2PM6B 3A0FA 4A2MA 4MMXA 5H14A 3GD1I 3JPXA 5K1CC 3MZLA 3F3FA 5HYNB 5H17A 5GXIA 2P9PC 3EI1A 3MUNA 2OVQB 5EMKB 1XIPA 5HE1B 1JOFA 2EICA 3IUMA 1VE6A 1BPOA 2CNXA 4MMZA 2I3TA 5GMKn 3BG1A 3K27A 3MVDK 2AGWA 2H6NA 1MDAH 1OMWB 3EQ7A 4J82A 4O45A 4E54B 2P9NC 5I5IA 2G99A 4BUJC 4J87A 5FXYA 3I7NA 4A08A 4Y5RD 5CXBB 4LGNA 4X61B 5EAPA 4J8GA 3NIDA 4O02A 1PGUA 3RN1D 4A11B 4Z7NA 2HJ4A 3W15A 5C9ZB 2H9PA 2HJBA 3AL9A 4J78A 3SBQA 2XZGA 3ZE2A 5AMSA 3EI1B 3DDUA 2YNNA 2CE9A 2AGXA 1Q47A 2J57G 1K8KC 1MG2A 3EWEA 2VZ1A 3RFGA 2XL2A 4A0BA 1U2VC 3DM0A 4Z7QA 3FRXA 4ZN4A 3SHFA 4NC4A 1GOFA 3GFCA 2CO0C 1FWXA 2CO0A 3IULA 4BCCA 4D9SA 4J84A 2EIDA 1MG3A 1L5GA 2AGLA 3VI4A 3I7LA 4BCDA 2MTAH 1TBGA 2OK6A 4DNVA 2VC2A 4AMZA 3ORVD 3L4MD 2OVRB 4CI2A 4Z7OA 2P9KC 4YVDA 1TYEA 3MZKA 3RFHA 2O9KA 3FCUA 3NIGA 5CYKA 3ZDYA 4ESGA 4O3UB 3V4PA 4WK4A 1JJUB 3PSCB 3B7FA 1H2ZA 3I89A 3GC3B 4E5ZA 3PE7A 2HU8A 3OKYB 3C5MA 3O4JA 1GG2B 4L9OA 3IIWA 2VDPA 5FKSA 3IUJA 3V5WB 4IA9A 3O4HA 3UKUC 2I3SA 3EI2A 4N14A 5AFU3 4GGDA 5FFGA 3I8EA 4PNKB 4WJKA 5B4WA 2YBAA 4G1EA 3FCSA 2IUVA 5I5MA 1JTDB 4L3HD 4PSXB 5E6RA 2B5MA 3L4OD 3DSMA 3CFVA 4NENA 3SN6B 4QL1A 4E5ZB 3IKOA 4FWWA 3CFSB 2Z2NA 3DWLC 5EMLB 1GOGA 3VGZA 3K6SA 3FM0A 2YNPA 4QT8A 3BG0A 4QAMA 2P9LC 4H5IA 1UOOA 2PM9B 3JRPA 2BKLA 4XYIA 3RN0D 5K19A 2H9NA 5TEFA 3J81g 4A2LA 2J56H 4G1MA 4L1QD 4AN1A 4CZVA 4AX4A 3J80g 5THAA 1M1XA 4J77A 5FKTA 1N6DA 2P9IC 3PSLA 2H14A 3CIKB 3EI3A 3HFQA 4O1QD 2BCJB 4MMYA 5FA5B 4BL0A 3EI2B 3ZDZA 5GXHA 4CY3A 1GOTB 2VDMA 2HU7A 3K26A 4NSXA 1TYQC 1H2WA 3NVQA 3OW8A 3AL8B 2QXVA 4CY5A 4FA4D 4JHNA 5M5VA 3O4IA 3K71A 3SBRA 5FKQA 3VH0A 4A09B 4TZ4A 3UVLA 3IURA 4JT5C 4Z8LA 2PBIB 3JZGA 5KDOB 2I0SA 2TRCB 5IGQA 2XDWA 1YFQA 1JMZB 2CN2A 2IUQA 1SHYB 4XYHA 5CXCB 3OF7A 2B5LA 4J0WA 4J79A 4JSNC 2B4EA 4ZOXA 4CZXA 3PXTD 3V9FA 3SJLD 3ZDXA 4CI1A 3PVUB 3IIYA 1E8MA 3IJCA 1A0RB 3SCYA 4AN0A 2G9AA 4BCBA 4FHLA 1PI6A 1B9XA 2I0RA 5HE2B 5M5RA 3JZNA 3IJEA 4A0BB 4CZYA 2XU7A 2YB8B 3SWSD 4GQBB 2H68A 3O4GA 2VDNA 2UZYB 3NVNA 2P9SC 3U4YA 2OK4A 3C9CA 4G56B 2CE8A 5TEEA 1K32A 2IUPA 2YMUA 4G55A 3EI4A 2H6KA 1P22A 2VZ3A 3MKSB 2IWKA 4U1EI 5E6UA 2H13A 4JT6C 4A0AA 2IAAA 1B9YA 5SXMA 4O2WA 4PSWB 3NIFA 4RE6A 5FQDA 3OL2A 2Z2PA 3FGBA 4J8BA 4AOWA 2GNQA 3VA6A 4UM8A 2YNOA 1A12A 4O9DA 2QZPA 4DNUA 3QHYB 1PBYB 1L0QA 5IJ7E 2IURA 2XE4A 1I2MB 1VZ2A 4PBZA 5IGOA 5EARA 3OTTA 3ZE0A 3I8CA 4LG9A 3IJ1A 2UZXB 3GREA 5HE3B 4ZOVA 3EMHA 2JKXA 1VZ3A 4GGCA 3KCIA 4FA5D 2HYEA 3AH8B 5HE0B 2PM9A 3SXTD 1QFSA 4JXMA 5FKRA 3IUNA 3F3PA 4J73A 1PEVA 2Q7QA 4ES0A 5CYKB 4AMYA 2HKRA 3UVKA 4H5JA 4I79A 5EMMB 2PM7B 2VDQA 3NVXA 5EM2A 4L3GD 4GM3A 2AGYA 4WK2A 5TDHB 3OKYA 3EU7A 3DXMC 1C9IA 1N6FA 5M5UA 1QNIA 4DNWA 4ERQA 3N0EA 3VI3A 1GP2B 2AQ5A 4FAND 3IUQA 1S4UX 5H1MA 2OJYA 1JV2A 5CXBA 4J81A 5FLXg 4HDJA 3MKQA 4PBYA 4GM8A 5HQGA 3SVWD 2B5NA 5EM2B 2OIZA 4BH6A 2H3XA 2WQ8A 3KRXB 3AL8A 4QRJA 3UVMA 3SMRA 5JWZA 4X63B 3AFCA 4GGAA 3UKRC 2GC4A 4GM9A 4AEZA 4FA1D 4GZ8A 2IWFA 4FB1D 3BWSA 3IJ0A 5C2WB 4NBMA 5M5TA 4QQEA 3PXSD 4JSVC 1JMXB 1O6GA 4X3EA 4Y7RA 4ZOYA 4E54A 4OWRA 4KFMB 5GSAA 3RRMC 3C75H 4NAAA 4X60B 1GXRA 3PVWB 4D0KA 5C2VB 4CI3A 4R7AB 3EI3B 4RE5A 4JSPC 2VDRA 3ZWLB 5IT9g 5M5SA 2HXCA 4GMBA 3OKTA 2GC7A 2XL3A 4K3ID 2AH0A 4IMMA 2AH1A 5EMJB 2VDLA 5M61A 1NR0A 3ZE1A 3UVOA 1UOPA 5HDBA 1NEXB 5I5JA 4A0AB 1SQ9A 3C99A 1YR2A 4L1MA 4FAVD 3I7HA 2CN3A 5C86A 2H9LA 3EI4B 4PC0A 4A08B 3ULEC 3I7OA 4D6VA 5TF2A 1O6FA 1VYHC
chains in the Genus database with same CATH topology
3OL2B 1RI6A 4U7AA 2W18A 2H9MA 3SBPA 3N0DA 4UI9R 5IJ8E 4JSXC 3DXKC 1OLZA 5IC7A 2HKMA 3MMYA 4LG8A 3PXWD 2H6QA 3I2NA 4JD2C 4A09A 3I7KA 3F3GA 5AJAA 3UVNA 3RLMD 4J86A 3OKWA 4ERZA 2P9UC 2XYIA 4A7JA 1U4CA 3JROA 3I7PA 2AGZA 2BBKH 1XKSA 4XEIC 1R5MA 2QC5A 2Z2OA 3KRWB 3E0CA 3JB9L 5A2Qg 2EBSA 1N6EA 2I0TA 3MXXA 4OZUA 2J55H 3P4FA 5CXCA 2H47A 3SLED 4O3TB 4PXWA 3V7DB 4EWRA 1ERJA 4FA9D 4ZOZA 4ERYA 4CI8A 4MK0B 3SFZA 3RSEC 3JZHA 2OVPB 3UR4A 4GQ1A 1SQJA 4CY2A 1XHMA 4J0XA 4CY1A 2HESX 3EG6A 4A11A 3RMZD 4CC9A 3JAMg 4K3JB 4GQ2P 5EAMA 5EALA 3ODTA 2PM6B 3A0FA 4A2MA 5H14A 3JPXA 5K1CC 3MZLA 3F3FA 5HYNB 5H17A 5GXIA 2P9PC 3EI1A 2OVQB 5EMKB 1XIPA 5HE1B 1JOFA 2CNXA 2I3TA 5GMKn 3BG1A 3K27A 2AGWA 2H6NA 1MDAH 1OMWB 4J82A 4O45A 4E54B 2P9NC 5I5IA 2G99A 4BUJC 4J87A 5FXYA 3I7NA 4A08A 4Y5RD 5CXBB 4LGNA 4X61B 5EAPA 4J8GA 1PGUA 3RN1D 4A11B 2HJ4A 3W15A 5C9ZB 2H9PA 2HJBA 3AL9A 4J78A 3SBQA 5AMSA 3EI1B 2YNNA 2CE9A 2AGXA 1Q47A 2J57G 1K8KC 1MG2A 3EWEA 4A0BA 3RFGA 2XL2A 1U2VC 3DM0A 3FRXA 4ZN4A 3SHFA 3GFCA 2CO0C 1FWXA 2CO0A 4J84A 1MG3A 2AGLA 3I7LA 2MTAH 1TBGA 2OK6A 3ORVD 3L4MD 2OVRB 4CI2A 2P9KC 4YVDA 3MZKA 3RFHA 2O9KA 5CYKA 4ESGA 4O3UB 1JJUB 3PSCB 3B7FA 3I89A 4E5ZA 3PE7A 3OKYB 3C5MA 1GG2B 4L9OA 3IIWA 5FKSA 3V5WB 4IA9A 3UKUC 2I3SA 3EI2A 4N14A 5AFU3 4GGDA 3I8EA 4PNKB 5B4WA 2YBAA 2IUVA 5I5MA 4L3HD 4PSXB 2B5MA 3L4OD 3DSMA 3CFVA 3SN6B 4QL1A 4E5ZB 3IKOA 4FWWA 3CFSB 2Z2NA 3DWLC 5EMLB 3VGZA 3FM0A 2YNPA 4QT8A 3BG0A 2P9LC 4H5IA 2PM9B 3JRPA 4XYIA 3RN0D 5K19A 2H9NA 5TEFA 3J81g 4A2LA 4L1QD 2J56H 4CZVA 3J80g 5THAA 4J77A 5FKTA 1N6DA 2P9IC 3PSLA 2H14A 3CIKB 3EI3A 3HFQA 4O1QD 2BCJB 5FA5B 4BL0A 3EI2B 5GXHA 4CY3A 1GOTB 3K26A 4NSXA 1TYQC 3NVQA 3OW8A 3AL8B 2QXVA 4CY5A 4FA4D 3SBRA 5FKQA 3VH0A 4A09B 4TZ4A 3UVLA 4JT5C 4Z8LA 2PBIB 3JZGA 5KDOB 2I0SA 2TRCB 5IGQA 1YFQA 1JMZB 2CN2A 2IUQA 1SHYB 4XYHA 5CXCB 2B5LA 4J0WA 4J79A 4JSNC 2B4EA 4ZOXA 4CZXA 3PXTD 3V9FA 3SJLD 4CI1A 3PVUB 3IIYA 3IJCA 1A0RB 3SCYA 2G9AA 4FHLA 1PI6A 1B9XA 2I0RA 5HE2B 3JZNA 4A0BB 4CZYA 2XU7A 2YB8B 3SWSD 4GQBB 2H68A 2UZYB 3NVNA 2P9SC 3U4YA 2OK4A 3C9CA 4G56B 2CE8A 5TEEA 1K32A 2IUPA 2YMUA 3EI4A 2H6KA 1P22A 3MKSB 2IWKA 4U1EI 2H13A 4JT6C 4A0AA 2IAAA 1B9YA 5SXMA 4PSWB 5FQDA 3OL2A 2Z2PA 3FGBA 4J8BA 4AOWA 2GNQA 3VA6A 2YNOA 4O9DA 1PBYB 1L0QA 5IJ7E 2IURA 4PBZA 5IGOA 5EARA 3OTTA 3I8CA 4LG9A 3IJ1A 2UZXB 3GREA 5HE3B 4ZOVA 3EMHA 4GGCA 4FA5D 2HYEA 3AH8B 5HE0B 2PM9A 3SXTD 4JXMA 5FKRA 3F3PA 4J73A 1PEVA 2Q7QA 4ES0A 5CYKB 2HKRA 3UVKA 4H5JA 4I79A 5EMMB 2PM7B 3NVXA 5EM2A 4L3GD 4GM3A 2AGYA 5TDHB 3OKYA 3EU7A 3DXMC 1N6FA 1QNIA 4ERQA 3N0EA 1GP2B 2AQ5A 4FAND 1S4UX 5H1MA 2OJYA 5CXBA 4J81A 5FLXg 4HDJA 3MKQA 4PBYA 4GM8A 5HQGA 3SVWD 2B5NA 5EM2B 2OIZA 4BH6A 2H3XA 3KRXB 3AL8A 4QRJA 3UVMA 3SMRA 5JWZA 4X63B 3AFCA 4GGAA 3UKRC 2GC4A 4GM9A 4AEZA 4FA1D 4GZ8A 2IWFA 4FB1D 3BWSA 3IJ0A 5C2WB 4QQEA 3PXSD 4JSVC 1JMXB 4X3EA 4Y7RA 4ZOYA 4E54A 4OWRA 4KFMB 5GSAA 3RRMC 3C75H 4X60B 1GXRA 3PVWB 4D0KA 5C2VB 4CI3A 4R7AB 3EI3B 4JSPC 3ZWLB 5IT9g 2HXCA 4GMBA 3OKTA 2GC7A 2XL3A 4K3ID 2AH0A 4IMMA 2AH1A 5EMJB 1NR0A 3UVOA 1NEXB 5I5JA 4A0AB 1SQ9A 3C99A 4FAVD 3I7HA 2CN3A 2H9LA 3EI4B 4PC0A 4A08B 3ULEC 3I7OA 4D6VA 5TF2A 1VYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL2 B;  1RI6 A;  4U7A A;  2W18 A;  2H9M A;  3SBP A;  3N0D A;  4UI9 R;  5IJ8 E;  4JSX C;  3DXK C;  1OLZ A;  5IC7 A;  2HKM A;  3MMY A;  4LG8 A;  3PXW D;  2H6Q A;  3I2N A;  4JD2 C;  4A09 A;  3I7K A;  3F3G A;  5AJA A;  3UVN A;  3RLM D;  4J86 A;  3OKW A;  4ERZ A;  2P9U C;  2XYI A;  4A7J A;  1U4C A;  3JRO A;  3I7P A;  2AGZ A;  2BBK H;  1XKS A;  4XEI C;  1R5M A;  2QC5 A;  2Z2O A;  3KRW B;  3E0C A;  3JB9 L;  5A2Q g;  2EBS A;  1N6E A;  2I0T A;  3MXX A;  4OZU A;  2J55 H;  3P4F A;  5CXC A;  2H47 A;  3SLE D;  4O3T B;  4PXW A;  3V7D B;  4EWR A;  1ERJ A;  4FA9 D;  4ZOZ A;  4ERY A;  4CI8 A;  4MK0 B;  3SFZ A;  3RSE C;  3JZH A;  2OVP B;  3UR4 A;  4GQ1 A;  1SQJ A;  4CY2 A;  1XHM A;  4J0X A;  4CY1 A;  2HES X;  3EG6 A;  4A11 A;  3RMZ D;  4CC9 A;  3JAM g;  4K3J B;  4GQ2 P;  5EAM A;  5EAL A;  3ODT A;  2PM6 B;  3A0F A;  4A2M A;  5H14 A;  3JPX A;  5K1C C;  3MZL A;  3F3F A;  5HYN B;  5H17 A;  5GXI A;  2P9P C;  3EI1 A;  2OVQ B;  5EMK B;  1XIP A;  5HE1 B;  1JOF A;  2CNX A;  2I3T A;  5GMK n;  3BG1 A;  3K27 A;  2AGW A;  2H6N A;  1MDA H;  1OMW B;  4J82 A;  4O45 A;  4E54 B;  2P9N C;  5I5I A;  2G99 A;  4BUJ C;  4J87 A;  5FXY A;  3I7N A;  4A08 A;  4Y5R D;  5CXB B;  4LGN A;  4X61 B;  5EAP A;  4J8G A;  1PGU A;  3RN1 D;  4A11 B;  2HJ4 A;  3W15 A;  5C9Z B;  2H9P A;  2HJB A;  3AL9 A;  4J78 A;  3SBQ A;  5AMS A;  3EI1 B;  2YNN A;  2CE9 A;  2AGX A;  1Q47 A;  2J57 G;  1K8K C;  1MG2 A;  3EWE A;  4A0B A;  3RFG A;  2XL2 A;  1U2V C;  3DM0 A;  3FRX A;  4ZN4 A;  3SHF A;  3GFC A;  2CO0 C;  1FWX A;  2CO0 A;  4J84 A;  1MG3 A;  2AGL A;  3I7L A;  2MTA H;  1TBG A;  2OK6 A;  3ORV D;  3L4M D;  2OVR B;  4CI2 A;  2P9K C;  4YVD A;  3MZK A;  3RFH A;  2O9K A;  5CYK A;  4ESG A;  4O3U B;  1JJU B;  3PSC B;  3B7F A;  3I89 A;  4E5Z A;  3PE7 A;  3OKY B;  3C5M A;  1GG2 B;  4L9O A;  3IIW A;  5FKS A;  3V5W B;  4IA9 A;  3UKU C;  2I3S A;  3EI2 A;  4N14 A;  5AFU 3;  4GGD A;  3I8E A;  4PNK B;  5B4W A;  2YBA A;  2IUV A;  5I5M A;  4L3H D;  4PSX B;  2B5M A;  3L4O D;  3DSM A;  3CFV A;  3SN6 B;  4QL1 A;  4E5Z B;  3IKO A;  4FWW A;  3CFS B;  2Z2N A;  3DWL C;  5EML B;  3VGZ A;  3FM0 A;  2YNP A;  4QT8 A;  3BG0 A;  2P9L C;  4H5I A;  2PM9 B;  3JRP A;  4XYI A;  3RN0 D;  5K19 A;  2H9N A;  5TEF A;  3J81 g;  4A2L A;  4L1Q D;  2J56 H;  4CZV A;  3J80 g;  5THA A;  4J77 A;  5FKT A;  1N6D A;  2P9I C;  3PSL A;  2H14 A;  3CIK B;  3EI3 A;  3HFQ A;  4O1Q D;  2BCJ B;  5FA5 B;  4BL0 A;  3EI2 B;  5GXH A;  4CY3 A;  1GOT B;  3K26 A;  4NSX A;  1TYQ C;  3NVQ A;  3OW8 A;  3AL8 B;  2QXV A;  4CY5 A;  4FA4 D;  3SBR A;  5FKQ A;  3VH0 A;  4A09 B;  4TZ4 A;  3UVL A;  4JT5 C;  4Z8L A;  2PBI B;  3JZG A;  5KDO B;  2I0S A;  2TRC B;  5IGQ A;  1YFQ A;  1JMZ B;  2CN2 A;  2IUQ A;  1SHY B;  4XYH A;  5CXC B;  2B5L A;  4J0W A;  4J79 A;  4JSN C;  2B4E A;  4ZOX A;  4CZX A;  3PXT D;  3V9F A;  3SJL D;  4CI1 A;  3PVU B;  3IIY A;  3IJC A;  1A0R B;  3SCY A;  2G9A A;  4FHL A;  1PI6 A;  1B9X A;  2I0R A;  5HE2 B;  3JZN A;  4A0B B;  4CZY A;  2XU7 A;  2YB8 B;  3SWS D;  4GQB B;  2H68 A;  2UZY B;  3NVN A;  2P9S C;  3U4Y A;  2OK4 A;  3C9C A;  4G56 B;  2CE8 A;  5TEE A;  1K32 A;  2IUP A;  2YMU A;  3EI4 A;  2H6K A;  1P22 A;  3MKS B;  2IWK A;  4U1E I;  2H13 A;  4JT6 C;  4A0A A;  2IAA A;  1B9Y A;  5SXM A;  4PSW B;  5FQD A;  3OL2 A;  2Z2P A;  3FGB A;  4J8B A;  4AOW A;  2GNQ A;  3VA6 A;  2YNO A;  4O9D A;  1PBY B;  1L0Q A;  5IJ7 E;  2IUR A;  4PBZ A;  5IGO A;  5EAR A;  3OTT A;  3I8C A;  4LG9 A;  3IJ1 A;  2UZX B;  3GRE A;  5HE3 B;  4ZOV A;  3EMH A;  4GGC A;  4FA5 D;  2HYE A;  3AH8 B;  5HE0 B;  2PM9 A;  3SXT D;  4JXM A;  5FKR A;  3F3P A;  4J73 A;  1PEV A;  2Q7Q A;  4ES0 A;  5CYK B;  2HKR A;  3UVK A;  4H5J A;  4I79 A;  5EMM B;  2PM7 B;  3NVX A;  5EM2 A;  4L3G D;  4GM3 A;  2AGY A;  5TDH B;  3OKY A;  3EU7 A;  3DXM C;  1N6F A;  1QNI A;  4ERQ A;  3N0E A;  1GP2 B;  2AQ5 A;  4FAN D;  1S4U X;  5H1M A;  2OJY A;  5CXB A;  4J81 A;  5FLX g;  4HDJ A;  3MKQ A;  4PBY A;  4GM8 A;  5HQG A;  3SVW D;  2B5N A;  5EM2 B;  2OIZ A;  4BH6 A;  2H3X A;  3KRX B;  3AL8 A;  4QRJ A;  3UVM A;  3SMR A;  5JWZ A;  4X63 B;  3AFC A;  4GGA A;  3UKR C;  2GC4 A;  4GM9 A;  4AEZ A;  4FA1 D;  4GZ8 A;  2IWF A;  4FB1 D;  3BWS A;  3IJ0 A;  5C2W B;  4QQE A;  3PXS D;  4JSV C;  1JMX B;  4X3E A;  4Y7R A;  4ZOY A;  4E54 A;  4OWR A;  4KFM B;  5GSA A;  3RRM C;  3C75 H;  4X60 B;  1GXR A;  3PVW B;  4D0K A;  5C2V B;  4CI3 A;  4R7A B;  3EI3 B;  4JSP C;  3ZWL B;  5IT9 g;  2HXC A;  4GMB A;  3OKT A;  2GC7 A;  2XL3 A;  4K3I D;  2AH0 A;  4IMM A;  2AH1 A;  5EMJ B;  1NR0 A;  3UVO A;  1NEX B;  5I5J A;  4A0A B;  1SQ9 A;  3C99 A;  4FAV D;  3I7H A;  2CN3 A;  2H9L A;  3EI4 B;  4PC0 A;  4A08 B;  3ULE C;  3I7O A;  4D6V A;  5TF2 A;  1VYH C; 
#chains in the Genus database with same CATH topology
 3OL2 B;  1RI6 A;  4IRZ A;  4JHP C;  4U7A A;  5E6S A;  2W18 A;  2H9M A;  3SBP A;  1UOQ A;  3N0D A;  4UI9 R;  5IJ8 E;  4JSX C;  3DXK C;  4BP9 A;  4UM9 A;  1OLZ A;  2VDK A;  5IC7 A;  2HKM A;  3MMY A;  1UTC A;  4LG8 A;  3PXW D;  1C9L A;  2H6Q A;  3I2N A;  1T2X A;  1K3I A;  4JD2 C;  4A09 A;  3I7K A;  4WK0 A;  3F3G A;  5AJA A;  3EQ9 A;  3UVN A;  2EIE A;  3RLM D;  2EIB A;  4J86 A;  3OKW A;  1H2X A;  1H2Y A;  2P9U C;  2QR5 A;  2XYI A;  3QI0 A;  4A7J A;  4ERZ A;  1U4C A;  2HU5 A;  3JRO A;  3T3P A;  3I7P A;  2AGZ A;  2BBK H;  1XKS A;  4XEI C;  1R5M A;  2QC5 A;  3EQ8 A;  1E5T A;  3V4V A;  3IVM A;  2Z2O A;  3KRW B;  3E0C A;  3JB9 L;  1GOH A;  5A2Q g;  2EBS A;  1VE7 A;  1N6E A;  2I0T A;  2VDO A;  3MXX A;  4OZU A;  3MUO A;  2J55 H;  3P4F A;  5CXC A;  2H47 A;  3SLE D;  4O3T B;  4PXW A;  3V7D B;  4EWR A;  1ERJ A;  5FFO A;  5C92 A;  4FA9 D;  4ZOZ A;  1QFM A;  4BP8 A;  4ERY A;  4CI8 A;  4MK0 B;  3SFZ A;  3RSE C;  1U8C A;  3JZH A;  3K72 A;  3T3M A;  2OVP B;  3UR4 A;  4GQ1 A;  1SQJ A;  4CY2 A;  1XHM A;  1E8N A;  4J0X A;  4CY1 A;  2HES X;  3EG6 A;  4A11 A;  3RMZ D;  4CC9 A;  3JAM g;  4K3J B;  4GQ2 P;  5EAM A;  5EAL A;  3ODT A;  2PM6 B;  3A0F A;  4A2M A;  4MMX A;  5H14 A;  3GD1 I;  3JPX A;  5K1C C;  3MZL A;  3F3F A;  5HYN B;  5H17 A;  5GXI A;  2P9P C;  3EI1 A;  3MUN A;  2OVQ B;  5EMK B;  1XIP A;  5HE1 B;  1JOF A;  2EIC A;  3IUM A;  1VE6 A;  1BPO A;  2CNX A;  4MMZ A;  2I3T A;  5GMK n;  3BG1 A;  3K27 A;  3MVD K;  2AGW A;  2H6N A;  1MDA H;  1OMW B;  3EQ7 A;  4J82 A;  4O45 A;  4E54 B;  2P9N C;  5I5I A;  2G99 A;  4BUJ C;  4J87 A;  5FXY A;  3I7N A;  4A08 A;  4Y5R D;  5CXB B;  4LGN A;  4X61 B;  5EAP A;  4J8G A;  3NID A;  4O02 A;  1PGU A;  3RN1 D;  4A11 B;  4Z7N A;  2HJ4 A;  3W15 A;  5C9Z B;  2H9P A;  2HJB A;  3AL9 A;  4J78 A;  3SBQ A;  2XZG A;  3ZE2 A;  5AMS A;  3EI1 B;  3DDU A;  2YNN A;  2CE9 A;  2AGX A;  1Q47 A;  2J57 G;  1K8K C;  1MG2 A;  3EWE A;  2VZ1 A;  3RFG A;  2XL2 A;  4A0B A;  1U2V C;  3DM0 A;  4Z7Q A;  3FRX A;  4ZN4 A;  3SHF A;  4NC4 A;  1GOF A;  3GFC A;  2CO0 C;  1FWX A;  2CO0 A;  3IUL A;  4BCC A;  4D9S A;  4J84 A;  2EID A;  1MG3 A;  1L5G A;  2AGL A;  3VI4 A;  3I7L A;  4BCD A;  2MTA H;  1TBG A;  2OK6 A;  4DNV A;  2VC2 A;  4AMZ A;  3ORV D;  3L4M D;  2OVR B;  4CI2 A;  4Z7O A;  2P9K C;  4YVD A;  1TYE A;  3MZK A;  3RFH A;  2O9K A;  3FCU A;  3NIG A;  5CYK A;  3ZDY A;  4ESG A;  4O3U B;  3V4P A;  4WK4 A;  1JJU B;  3PSC B;  3B7F A;  1H2Z A;  3I89 A;  3GC3 B;  4E5Z A;  3PE7 A;  2HU8 A;  3OKY B;  3C5M A;  3O4J A;  1GG2 B;  4L9O A;  3IIW A;  2VDP A;  5FKS A;  3IUJ A;  3V5W B;  4IA9 A;  3O4H A;  3UKU C;  2I3S A;  3EI2 A;  4N14 A;  5AFU 3;  4GGD A;  5FFG A;  3I8E A;  4PNK B;  4WJK A;  5B4W A;  2YBA A;  4G1E A;  3FCS A;  2IUV A;  5I5M A;  1JTD B;  4L3H D;  4PSX B;  5E6R A;  2B5M A;  3L4O D;  3DSM A;  3CFV A;  4NEN A;  3SN6 B;  4QL1 A;  4E5Z B;  3IKO A;  4FWW A;  3CFS B;  2Z2N A;  3DWL C;  5EML B;  1GOG A;  3VGZ A;  3K6S A;  3FM0 A;  2YNP A;  4QT8 A;  3BG0 A;  4QAM A;  2P9L C;  4H5I A;  1UOO A;  2PM9 B;  3JRP A;  2BKL A;  4XYI A;  3RN0 D;  5K19 A;  2H9N A;  5TEF A;  3J81 g;  4A2L A;  2J56 H;  4G1M A;  4L1Q D;  4AN1 A;  4CZV A;  4AX4 A;  3J80 g;  5THA A;  1M1X A;  4J77 A;  5FKT A;  1N6D A;  2P9I C;  3PSL A;  2H14 A;  3CIK B;  3EI3 A;  3HFQ A;  4O1Q D;  2BCJ B;  4MMY A;  5FA5 B;  4BL0 A;  3EI2 B;  3ZDZ A;  5GXH A;  4CY3 A;  1GOT B;  2VDM A;  2HU7 A;  3K26 A;  4NSX A;  1TYQ C;  1H2W A;  3NVQ A;  3OW8 A;  3AL8 B;  2QXV A;  4CY5 A;  4FA4 D;  4JHN A;  5M5V A;  3O4I A;  3K71 A;  3SBR A;  5FKQ A;  3VH0 A;  4A09 B;  4TZ4 A;  3UVL A;  3IUR A;  4JT5 C;  4Z8L A;  2PBI B;  3JZG A;  5KDO B;  2I0S A;  2TRC B;  5IGQ A;  2XDW A;  1YFQ A;  1JMZ B;  2CN2 A;  2IUQ A;  1SHY B;  4XYH A;  5CXC B;  3OF7 A;  2B5L A;  4J0W A;  4J79 A;  4JSN C;  2B4E A;  4ZOX A;  4CZX A;  3PXT D;  3V9F A;  3SJL D;  3ZDX A;  4CI1 A;  3PVU B;  3IIY A;  1E8M A;  3IJC A;  1A0R B;  3SCY A;  4AN0 A;  2G9A A;  4BCB A;  4FHL A;  1PI6 A;  1B9X A;  2I0R A;  5HE2 B;  5M5R A;  3JZN A;  3IJE A;  4A0B B;  4CZY A;  2XU7 A;  2YB8 B;  3SWS D;  4GQB B;  2H68 A;  3O4G A;  2VDN A;  2UZY B;  3NVN A;  2P9S C;  3U4Y A;  2OK4 A;  3C9C A;  4G56 B;  2CE8 A;  5TEE A;  1K32 A;  2IUP A;  2YMU A;  4G55 A;  3EI4 A;  2H6K A;  1P22 A;  2VZ3 A;  3MKS B;  2IWK A;  4U1E I;  5E6U A;  2H13 A;  4JT6 C;  4A0A A;  2IAA A;  1B9Y A;  5SXM A;  4O2W A;  4PSW B;  3NIF A;  4RE6 A;  5FQD A;  3OL2 A;  2Z2P A;  3FGB A;  4J8B A;  4AOW A;  2GNQ A;  3VA6 A;  4UM8 A;  2YNO A;  1A12 A;  4O9D A;  2QZP A;  4DNU A;  3QHY B;  1PBY B;  1L0Q A;  5IJ7 E;  2IUR A;  2XE4 A;  1I2M B;  1VZ2 A;  4PBZ A;  5IGO A;  5EAR A;  3OTT A;  3ZE0 A;  3I8C A;  4LG9 A;  3IJ1 A;  2UZX B;  3GRE A;  5HE3 B;  4ZOV A;  3EMH A;  2JKX A;  1VZ3 A;  4GGC A;  3KCI A;  4FA5 D;  2HYE A;  3AH8 B;  5HE0 B;  2PM9 A;  3SXT D;  1QFS A;  4JXM A;  5FKR A;  3IUN A;  3F3P A;  4J73 A;  1PEV A;  2Q7Q A;  4ES0 A;  5CYK B;  4AMY A;  2HKR A;  3UVK A;  4H5J A;  4I79 A;  5EMM B;  2PM7 B;  2VDQ A;  3NVX A;  5EM2 A;  4L3G D;  4GM3 A;  2AGY A;  4WK2 A;  5TDH B;  3OKY A;  3EU7 A;  3DXM C;  1C9I A;  1N6F A;  5M5U A;  1QNI A;  4DNW A;  4ERQ A;  3N0E A;  3VI3 A;  1GP2 B;  2AQ5 A;  4FAN D;  3IUQ A;  1S4U X;  5H1M A;  2OJY A;  1JV2 A;  5CXB A;  4J81 A;  5FLX g;  4HDJ A;  3MKQ A;  4PBY A;  4GM8 A;  5HQG A;  3SVW D;  2B5N A;  5EM2 B;  2OIZ A;  4BH6 A;  2H3X A;  2WQ8 A;  3KRX B;  3AL8 A;  4QRJ A;  3UVM A;  3SMR A;  5JWZ A;  4X63 B;  3AFC A;  4GGA A;  3UKR C;  2GC4 A;  4GM9 A;  4AEZ A;  4FA1 D;  4GZ8 A;  2IWF A;  4FB1 D;  3BWS A;  3IJ0 A;  5C2W B;  4NBM A;  5M5T A;  4QQE A;  3PXS D;  4JSV C;  1JMX B;  1O6G A;  4X3E A;  4Y7R A;  4ZOY A;  4E54 A;  4OWR A;  4KFM B;  5GSA A;  3RRM C;  3C75 H;  4NAA A;  4X60 B;  1GXR A;  3PVW B;  4D0K A;  5C2V B;  4CI3 A;  4R7A B;  3EI3 B;  4RE5 A;  4JSP C;  2VDR A;  3ZWL B;  5IT9 g;  5M5S A;  2HXC A;  4GMB A;  3OKT A;  2GC7 A;  2XL3 A;  4K3I D;  2AH0 A;  4IMM A;  2AH1 A;  5EMJ B;  2VDL A;  5M61 A;  1NR0 A;  3ZE1 A;  3UVO A;  1UOP A;  5HDB A;  1NEX B;  5I5J A;  4A0A B;  1SQ9 A;  3C99 A;  1YR2 A;  4L1M A;  4FAV D;  3I7H A;  2CN3 A;  5C86 A;  2H9L A;  3EI4 B;  4PC0 A;  4A08 B;  3ULE C;  3I7O A;  4D6V A;  5TF2 A;  1O6F A;  1VYH C; 
#chains in the Genus database with same CATH homology
 3OL2 B;  1RI6 A;  4U7A A;  2W18 A;  2H9M A;  3SBP A;  3N0D A;  4UI9 R;  5IJ8 E;  4JSX C;  3DXK C;  1OLZ A;  5IC7 A;  2HKM A;  3MMY A;  4LG8 A;  3PXW D;  2H6Q A;  3I2N A;  4JD2 C;  4A09 A;  3I7K A;  3F3G A;  5AJA A;  3UVN A;  3RLM D;  4J86 A;  3OKW A;  4ERZ A;  2P9U C;  2XYI A;  4A7J A;  1U4C A;  3JRO A;  3I7P A;  2AGZ A;  2BBK H;  1XKS A;  4XEI C;  1R5M A;  2QC5 A;  2Z2O A;  3KRW B;  3E0C A;  3JB9 L;  5A2Q g;  2EBS A;  1N6E A;  2I0T A;  3MXX A;  4OZU A;  2J55 H;  3P4F A;  5CXC A;  2H47 A;  3SLE D;  4O3T B;  4PXW A;  3V7D B;  4EWR A;  1ERJ A;  4FA9 D;  4ZOZ A;  4ERY A;  4CI8 A;  4MK0 B;  3SFZ A;  3RSE C;  3JZH A;  2OVP B;  3UR4 A;  4GQ1 A;  1SQJ A;  4CY2 A;  1XHM A;  4J0X A;  4CY1 A;  2HES X;  3EG6 A;  4A11 A;  3RMZ D;  4CC9 A;  3JAM g;  4K3J B;  4GQ2 P;  5EAM A;  5EAL A;  3ODT A;  2PM6 B;  3A0F A;  4A2M A;  5H14 A;  3JPX A;  5K1C C;  3MZL A;  3F3F A;  5HYN B;  5H17 A;  5GXI A;  2P9P C;  3EI1 A;  2OVQ B;  5EMK B;  1XIP A;  5HE1 B;  1JOF A;  2CNX A;  2I3T A;  5GMK n;  3BG1 A;  3K27 A;  2AGW A;  2H6N A;  1MDA H;  1OMW B;  4J82 A;  4O45 A;  4E54 B;  2P9N C;  5I5I A;  2G99 A;  4BUJ C;  4J87 A;  5FXY A;  3I7N A;  4A08 A;  4Y5R D;  5CXB B;  4LGN A;  4X61 B;  5EAP A;  4J8G A;  1PGU A;  3RN1 D;  4A11 B;  2HJ4 A;  3W15 A;  5C9Z B;  2H9P A;  2HJB A;  3AL9 A;  4J78 A;  3SBQ A;  5AMS A;  3EI1 B;  2YNN A;  2CE9 A;  2AGX A;  1Q47 A;  2J57 G;  1K8K C;  1MG2 A;  3EWE A;  4A0B A;  3RFG A;  2XL2 A;  1U2V C;  3DM0 A;  3FRX A;  4ZN4 A;  3SHF A;  3GFC A;  2CO0 C;  1FWX A;  2CO0 A;  4J84 A;  1MG3 A;  2AGL A;  3I7L A;  2MTA H;  1TBG A;  2OK6 A;  3ORV D;  3L4M D;  2OVR B;  4CI2 A;  2P9K C;  4YVD A;  3MZK A;  3RFH A;  2O9K A;  5CYK A;  4ESG A;  4O3U B;  1JJU B;  3PSC B;  3B7F A;  3I89 A;  4E5Z A;  3PE7 A;  3OKY B;  3C5M A;  1GG2 B;  4L9O A;  3IIW A;  5FKS A;  3V5W B;  4IA9 A;  3UKU C;  2I3S A;  3EI2 A;  4N14 A;  5AFU 3;  4GGD A;  3I8E A;  4PNK B;  5B4W A;  2YBA A;  2IUV A;  5I5M A;  4L3H D;  4PSX B;  2B5M A;  3L4O D;  3DSM A;  3CFV A;  3SN6 B;  4QL1 A;  4E5Z B;  3IKO A;  4FWW A;  3CFS B;  2Z2N A;  3DWL C;  5EML B;  3VGZ A;  3FM0 A;  2YNP A;  4QT8 A;  3BG0 A;  2P9L C;  4H5I A;  2PM9 B;  3JRP A;  4XYI A;  3RN0 D;  5K19 A;  2H9N A;  5TEF A;  3J81 g;  4A2L A;  4L1Q D;  2J56 H;  4CZV A;  3J80 g;  5THA A;  4J77 A;  5FKT A;  1N6D A;  2P9I C;  3PSL A;  2H14 A;  3CIK B;  3EI3 A;  3HFQ A;  4O1Q D;  2BCJ B;  5FA5 B;  4BL0 A;  3EI2 B;  5GXH A;  4CY3 A;  1GOT B;  3K26 A;  4NSX A;  1TYQ C;  3NVQ A;  3OW8 A;  3AL8 B;  2QXV A;  4CY5 A;  4FA4 D;  3SBR A;  5FKQ A;  3VH0 A;  4A09 B;  4TZ4 A;  3UVL A;  4JT5 C;  4Z8L A;  2PBI B;  3JZG A;  5KDO B;  2I0S A;  2TRC B;  5IGQ A;  1YFQ A;  1JMZ B;  2CN2 A;  2IUQ A;  1SHY B;  4XYH A;  5CXC B;  2B5L A;  4J0W A;  4J79 A;  4JSN C;  2B4E A;  4ZOX A;  4CZX A;  3PXT D;  3V9F A;  3SJL D;  4CI1 A;  3PVU B;  3IIY A;  3IJC A;  1A0R B;  3SCY A;  2G9A A;  4FHL A;  1PI6 A;  1B9X A;  2I0R A;  5HE2 B;  3JZN A;  4A0B B;  4CZY A;  2XU7 A;  2YB8 B;  3SWS D;  4GQB B;  2H68 A;  2UZY B;  3NVN A;  2P9S C;  3U4Y A;  2OK4 A;  3C9C A;  4G56 B;  2CE8 A;  5TEE A;  1K32 A;  2IUP A;  2YMU A;  3EI4 A;  2H6K A;  1P22 A;  3MKS B;  2IWK A;  4U1E I;  2H13 A;  4JT6 C;  4A0A A;  2IAA A;  1B9Y A;  5SXM A;  4PSW B;  5FQD A;  3OL2 A;  2Z2P A;  3FGB A;  4J8B A;  4AOW A;  2GNQ A;  3VA6 A;  2YNO A;  4O9D A;  1PBY B;  1L0Q A;  5IJ7 E;  2IUR A;  4PBZ A;  5IGO A;  5EAR A;  3OTT A;  3I8C A;  4LG9 A;  3IJ1 A;  2UZX B;  3GRE A;  5HE3 B;  4ZOV A;  3EMH A;  4GGC A;  4FA5 D;  2HYE A;  3AH8 B;  5HE0 B;  2PM9 A;  3SXT D;  4JXM A;  5FKR A;  3F3P A;  4J73 A;  1PEV A;  2Q7Q A;  4ES0 A;  5CYK B;  2HKR A;  3UVK A;  4H5J A;  4I79 A;  5EMM B;  2PM7 B;  3NVX A;  5EM2 A;  4L3G D;  4GM3 A;  2AGY A;  5TDH B;  3OKY A;  3EU7 A;  3DXM C;  1N6F A;  1QNI A;  4ERQ A;  3N0E A;  1GP2 B;  2AQ5 A;  4FAN D;  1S4U X;  5H1M A;  2OJY A;  5CXB A;  4J81 A;  5FLX g;  4HDJ A;  3MKQ A;  4PBY A;  4GM8 A;  5HQG A;  3SVW D;  2B5N A;  5EM2 B;  2OIZ A;  4BH6 A;  2H3X A;  3KRX B;  3AL8 A;  4QRJ A;  3UVM A;  3SMR A;  5JWZ A;  4X63 B;  3AFC A;  4GGA A;  3UKR C;  2GC4 A;  4GM9 A;  4AEZ A;  4FA1 D;  4GZ8 A;  2IWF A;  4FB1 D;  3BWS A;  3IJ0 A;  5C2W B;  4QQE A;  3PXS D;  4JSV C;  1JMX B;  4X3E A;  4Y7R A;  4ZOY A;  4E54 A;  4OWR A;  4KFM B;  5GSA A;  3RRM C;  3C75 H;  4X60 B;  1GXR A;  3PVW B;  4D0K A;  5C2V B;  4CI3 A;  4R7A B;  3EI3 B;  4JSP C;  3ZWL B;  5IT9 g;  2HXC A;  4GMB A;  3OKT A;  2GC7 A;  2XL3 A;  4K3I D;  2AH0 A;  4IMM A;  2AH1 A;  5EMJ B;  1NR0 A;  3UVO A;  1NEX B;  5I5J A;  4A0A B;  1SQ9 A;  3C99 A;  4FAV D;  3I7H A;  2CN3 A;  2H9L A;  3EI4 B;  4PC0 A;  4A08 B;  3ULE C;  3I7O A;  4D6V A;  5TF2 A;  1VYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...