5EMLA

Crystal structure of prmt5:mep50 with compound 10 and sam
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 203
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emlA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emlA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emlA02
5AVNA 1QAOA 2ZWAA 3FUUA 1O9HA 4E2XA 2AN4A 2P3LA 5AVHA 4E3VA 1R8YA 1XIFA 3BANA 3BWYA 5T67A 1P1BA 2PBFA 1FP2A 4P7KA 3G89A 3PT9A 5D1NA 4C08A 4QE1A 2NP6A 2ZDSA 4MIKA 4NECA 2IGTA 1N2XA 3MAGA 4FSXA 5GP1A 1DE5A 1HNNA 3HCFA 3CQIA 3DX5A 2QULA 5K8VA 2VDVE 2O57A 3KPVA 3L8DA 2ZTHA 5H02A 3LDGA 5FCDA 1D8WA 2JJQA 2CMGA 5GIOE 5ICGA 3EVAA 2AOTB 3KPYA 2XINA 3FRIA 4ZB5A 5DM2A 1I9GA 2I57A 2ORED 2PV0A 2PX2A 3BWBA 4L7VA 2IFTA 4XIMA 3PX2A 3TKYA 4WVLA 4X1OA 5DM4A 4BLWA 4E2WA 3M0YA 1JQEA 1XYMA 1XINA 3ITYA 2E5WA 2R3SA 4RVDA 4GJIA 3HCBA 5FHQA 1S5MA 2HV9A 4HHLA 3GRUA 3C0LA 3G7UA 5DWQA 3REOA 1YFLA 3P97A 4DMGA 2ZCJA 3E8SA 3M0XA 3SXJA 4DM3A 2R6ZA 3VNMA 2JG3A 5FWAA 3ANXA 2FYTA 2HK0A 4HHMA 3U0HA 1QYRA 3EMDA 3PLAE 3KR1A 3A27A 5EEGA 3PVCA 4CTKA 2C7PA 3M70A 2XYRA 2BR3A 2EX4A 4YTSA 3AWIA 4LWOA 3OZSA 1XLGA 4QDWA 3BKXA 3B3GA 1XYAA 2PT9A 3FPGA 3HVIA 3OU7A 4AZTA 3CQHA 4E2ZA 3HM2A 3EEOA 2H1RA 3DLCA 2YVLA 3ITXA 4H0NA 1SUIA 4X60A 4GJJA 1RJDA 3EGVA 2OB2A 2I56A 4XUDA 3V97A 3OU6A 5DT2A 1G6Q1 2VS1A 1AQJA 1RJGA 4X61A 5EIWA 5EOVA 4X63A 2EJUA 2GH1A 4UOEA 5KQSA 4RTSA 3WQOA 1VP3A 1WY7A 2ONZA 4IKPA 1EJ0A 1NV9A 3DUWA 4ER5A 3ERCA 5FA5A 2OO3A 5CM2Z 1EQAA 4RWZA 4PYJA 5GWXA 2AVNA 2AR0A 3A7EA 1XVAA 3EVFA 3P9NA 1XIBA 1KYZA 3IHTA 5DTMA 9XIAA 4LG1A 4HH4A 5DPMA 3EVGA 5DM1A 5FWDA 4XUCA 5EZSA 4AZSA 2OU4A 3P8ZA 2GS9A 5EG5A 3QC0A 1XDSA 3G2QA 1KPHA 3GU3A 2AOXA 5CCBA 1AV6A 1D2GA 1ORHA 4QPPA 1L3BA 3NTVA 4P7GA 3THRA 4YV0A 5MHTA 3MCZA 2AOVA 3HNRA 3V8VA 7MHTA 5DX0A 3HCDA 2OY0A 1XLCA 3M0LA 4QVGA 1UFKA 3DMGA 2YUIA 5EVJA 3SMQA 3TM4A 4C06A 3ER9A 2CWWA 3I64A 2VP3A 1X1DA 2B9EA 2FPOA 3A7DA 3HP7A 4FZVA 3O4FA 5DXJA 5EC8A 5FADA 3MQ2A 5GOZA 3T7TA 1B42A 2YXLA 4C03A 1XLHA 2BR5A 4PYOA 1NW6A 3ER8A 2XBMA 4RVGA 2WK1A 1A0DA 3VYWA 4PIMA 3VC1A 3UBTA 5EHIA 5TNVA 1NW5A 3HVKA 3M0MA 3KBJA 2IIPA 4RV9A 5P8WA 3CC8A 3DOUA 2PKWA 5F2NA 4AZWA 2LD4A 3GRYA 3M33A 5F2KA 2V7EA 2JHCA 1KR5A 4LWPA 3FPFA 4IWNA 3GCZA 5K03A 2NXEA 3JWHA 3KBVA 5E1BA 3UJAA 5FA8A 3DMFA 1OR8A 1JSXA 4QTUB 1HMYA 1ORIA 3JWGA 3VC2A 5IKMA 3ID6C 3EPPA 4C04A 5DTQA 2G0WA 5EZQA 5CD1A 4GOND 3ITVA 3KKZA 5DXAA 4K1GA 1NV8A 3TR6A 1X19A 2ZBRA 4HGYA 3GDHA 4PYKA 2H00A 4XISA 4RTPA 3B3JA 1BC5A 4BLVA 3XISA 3VSEA 1DCTA 1JQDA 3QZAA 4PINA 4E31A 4OQDA 3C6KA 3KQVA 2C7RA 2ZZNA 3VNKA 3KQSA 1XCJA 3R24A 3B5IA 3FRHA 3R9XB 1VQ1A 1DIDA 1L9KA 2XVAA 6XIMA 5EMMA 3UA3A 2GB4A 4V0RA 3AXSA 3A4TA 4PNEA 4XSMA 2FK8A 3LGAA 4KDRA 5JR3A 2FK7A 4QQKA 3KQOA 5E8JA 5GM2A 4DQ0A 5LQUA 5K05A 2ZIFA 3UWPA 3MTEA 3XIMA 3SX0A 3TC3A 1R6AA 5K0CA 3VNIA 1XIDA 3SSNA 4E2YA 3NW9A 1JG4A 2P3QA 3HA3A 3LBYA 4GOOD 4HG2A 3UU0A 2QUMA 2BM9A 2ESRA 1DUSA 5ERGB 2CL5A 3O7WA 5E9WA 4Z2YA 1YF3A 3LCUA 1R8XA 5E1OA 2GPYA 7XIMA 3A26A 4QDJA 2HNKA 1NW3A 1WXXA 5EMLA 2PVCA 3EGIA 3FTDA 2DULA 4YUXA 1TZ9A 5E2BA 3I53A 2GLKA 4EKGA 5U4XA 3OPNA 2ZULA 3DBNA 1D2CA 4Y30A 2P40A 4QDPA 5KVAA 1SKMA 1GW9A 1PRYA 1WS6A 4C07A 3CGGA 3NJRA 3AXTA 1K77A 1KP9A 2J6VA 2OKCA 4OA5A 5K0LA 3UJ9A 2IDKA 3M6VA 1SQGA 3OZTA 4KWCA 1Z3CA 4QDKA 2WA1A 4R6WA 5K0JA 5FULA 1FPQA 4KW7A 1NBIA 2Q41A 1L3CA 3B89A 1F38A 4OVXA 2YQZA 3P2IA 3R6TA 4ER3A 3KQYA 4A8RA 4RTMA 5B7YA 4DF3A 4ER7A 3FVMA 3P6LA 1X1BA 4JXJA 2I9KA 2XIMA 4DCMA 2QRVB 3ITOA 3DMHA 4HTFB 3HVJA 3X0DA 4KW2A 3P2EA 4RTQA 3C3PA 3GRRA 3CJRA 3HA7A 4KDCA 4A8LA 3TOSA 1BKYA 2NXJA 3MTIA 1KPGA 5GINE 4QQNA 4A8NA 2X7WA 2YTZA 1UWVA 1DXIA 3HCCA 3E05A 3GRZA 2PSSA 5EGSA 3FZGA 2I6GA 2QRVA 4PCLA 4QTTB 3EVCA 2G4JA 3BKWA 3AJDA 5CVJA 3THSA 3KQPA 3G8AA 2PXAA 4P7FA 2P41A 2ZVJA 4A8IA 3VYLA 2EFJA 3BUSA 3KBMA 1L1EA 2QW5A 3MCTA 1XLKA 3KCOA 3L23A 4RVHA 5BW5A 3KBSA 2PY6A 3G2PA 4RTKA 3NVKI 5E9JA 3GGDA 4K6MA 3UZUA 1XISA 2AOWA 3EGEA 8XIMA 3M6UA 5K0NA 2BM8A 1EJ6A 4FGZA 3CNYA 1P1CA 2PWYA 3B7PA 3M4XA 2IH5A 1XLJA 1JR4A 1Q0SA 2B78A 2G71A 2QE6A 3BZBA 3EVEA 3T7SA 4YUYA 3ELDA 1QT1A 2VZ9A 2IBTA 2AOUA 5D1HA 3SR4A 5HEKA 3SGLA 3D2LA 4DZRA 3IUIA 2Z6UA 3U81A 1TPYA 2X7VA 1RJEA 2JH9A 5HZMA 2I7CA 1O1HA 1XLDA 2XVMA 3G8BA 3CQKA 3FPJA 1Y8CA 4CWAA 5C0OE 3C0QA 1XLLA 1QUMA 1ZQ9A 1XYLA 1KPIA 2ZFUA 3DULA 3E23A 3BXOA 3C6MA 3GRVA 4KIGA 2OZVA 4F84A 1ZHFA 2ONYA 3TM5A 3TFWA 2G1PA 3TQSA 4F85A 4M36A 3WSTA 2P7IA 2P1DA 2NQJA 1ZGAA 3OCJA 1V39A 5EPEA 3KPJA 1DE6A 3JWIA 2EJTA 3I5UA 3KQMA 4HGXA 2PWPA 4HTFA 2AVDA 3NGFA 1VLMA 1U2ZA 1NE2A 2ZIGA 5E2AA 4B17A 2G70A 1SG9A 2QM3A 3P14A 4XCXA 5K09A 4W4QA 4C05A 2O0LA 4ISCA 5ICFA 3SSOA 5KQRA 1AQIA 1INLA 3M0VA 1G60A 4HSGA 3H2BA 5LQKA 1KIAA 4MQ4A 1I6NA 3OBEA 4PYLA 3DR5A 5CVUA 4ZB2A 1SVUA 2GAFA 3FPEA 1MJFA 5FHRA 3T7RA 5LQAA 1YFJA 4U7PB 2HK1A 3NMUF 3Q87B 3EVBA 2ZIEA 2B3TA 2G8NA 8XIAA 3T0IA 4RYLA 4PYIA 3Q7EA 4OQEA 5DRTA 5T6BA 4CTJA 3MERA 1VBFA 4RTLA 1D2HA 1KHHA 1JSZA 4IV8A 1XLFA 3MGGA 1QZZA 1XIIA 4OBWA 4HC4A 2A14A 2O05A 2PGXA 3FTCA 3GNXA 2Z6QA 3DH0A 3QOXA 1N7IA 2GVEA 5B7ZA 2GLUA 5CVEA 3G5LA 5LQRA 2Q02A 1R00A 3LECA 3O31A 3AYTA 5HIMA 2BH2A 1XICA 3OE5A 4PCAA 3OZRA 1YB2A 2AN5A 3KPUA 3PX3A 1FP1D 4EK9A 3KR2A 4P58A 1YUBA 2VDUE 1XDUA 4XUEA 1FBNA 3UJDA 5C9ZA 4EMSA 2UZ4A 4HGZA 4PGLA 3MHTA 2BZGA 3XINA 2P3OA 1NBHA 2ZLBA 4PGGA 4YUVA 2ZSUA 4P7JA 1XLIA 1O9GA 2O06A 3KU1A 1NKVA 2GUBA 4KIFA 3BDKA 2I62A 5DTRA 3SSMA 4IV0A 1Q0TA 4KVZA 1BHJA 5XIAA 4Y2HA 1H1DA 2F8LA 5LQNA 4KRGA 10MHA 2HTEA 3PS9A 5ICCA 3RODA 1X1CA 3C0KA 3UJ8A 3U3HA 3LPMA 4RTOA 2PXXA 4GLEA 1VE3A 5DSTA 3QYSA 1BXBA 2ZWVA 4YV2A 4QEEA 4EACA 1XLMA 1NW7A 1R18A 1KXZA 2HWKA 3LMZA 4Q7IA 3FUVA 3OE4A 2JHPA 5DRYA 1XDZA 5DSXA 2K4MA 4CKBA 3F4KA 3FUTA 2YXDA 5BXYA 4YV1A 3IUHA 3N4AA 3LCCA 3QOWA 3EEYA 3UJCA 3ITTA 5EMJA 4OX9Y 2BR4A 3UFBA 2PX4A 2HCVA 4OA8A 1QAMA 4ER6A 4E33A 2IP2A 2NXNA 3I9FA 5E8RA 3FYCA 3KTCA 1JTEA 4C4AA 3KR0A 2NQHA 4FR0A 4QVKA 5HIKA 3FTEA 5FQOA 3HCAA 3LSTA 4PIPA 2AZTA 3K0BA 4DVOA 3KQWA 4AX8A 3JU2A 3P9KA 2ZW9A 5EKUA 4M38A 2JHAA 3QV2A 4GC5A 4R6XA 4WXHA 5M5BA 1SUSA 2NP7A 5K0FA 6XIAA 4QE4A 4R8RA 1BOOA 1I4WA 3KBWA 5LR6A 4V0QA 2ZZMA 3P9IA 2QUNA 3UA4A 3I58A 5E1DA 3HA5A 2O07A 2P8JA 3KQQA 4YTTA 5FUBA 2OB1A 2PJDA 3NWBA 1FJXA 3OU2A 4DKJA 4YMHA 3P2KA 3AAMA 2PX5A 3KCJA 3CCFA 4YMGA 1M6YA 3FUWA 4AZVA 5B80A 3DLIA 4PYNA 1VL5A 1JG1A 2FRXA 2B2CA 3GNLA 4CXMA 3IV6A 4PFHA 5EEHA 5CIYA 3NDIA 3LHDA 3JWJA 1JTFA 1VP9A 2OBFA 4EKIA 1XIHA 3BGVA 1EIZA 3NDJA 4QEHA 3TVAA 3CWHA 1XIJA 2Y1XA 5CVDA 5EHGA 3PTAA 3KPWA 2FHPA 1YX1A 1ZG3A 2ADMA 5EMKA 4PWYA 3HTXA 3BGDA 2YR0A 1XYCA 3QXBA 3LCVB 5G02A 1JG2A 1RJFA 4O29A 4U7TB 5GM1A 1O54A 2AOTA 4GQBA 3HCEA 3NVMB 1XCLA 3G2OA 5T64A 1QANA 3DP7A 4EVIA 3GO4A 1DL5A 1NW8A 1T43A 3KBNA 3SVZA 3BT7A 4GBED 1NT2A 1X1AA 4FP9A 3UVAA 1YZ3A 3ELYA 2JH8A 4ZTBA 5DLYA 5HILA 4CKEA 4RTRA 4YUZA 2ZBQA 2IH4A 4XSLA 5DM0A 4BLUA 5FQNA 3P9CA 2GYIA 3BWWA 3G2MA 4HRAA 3C0SA 4EQZA 2OXTA 5IH3A 1XP3A 1I60A 3EVDA 5HIJA 2UYCA 9MHTA 3TKAA 3TMAA 3UJ7A 2P7HA 2NNWB 1SQFA 3KR9A 3DXZA 4MWZA 4E30A 3AALA 3UXIA 1RI2A 4ATNA 4GC9A 5H6HA 1G55A 2QYOA 5H1WA 3ORHA 5XIMA 3P71T 2HR1A 4J4KA 4BP3A 4ZBCA 2ZZKA 4YTQA 4XKMA 5K0GA 1AF7A 5K0BA 5DX1A 3R0QA 1N7JA 1XIEA 3CBGA 4QPNA 4RX1A 2OYRA 4RTNA 3AY0A 3FTFA 5F2OA 4EAYA 3CQJA 3LBFA 5BW4A 5LQJA 3SM3A 2VDWA 2UYHA 2PLWA 3RW9A 2EG5A 3OFKA 1M0EA 4OBXA 3E7PA 3FUXA 1XLEA 3BZGA 1RI3A 2ZBPA 3FYDA 1VIDA 3HEMA 4AUKA 8MHTA 2PT6A 3KQTA 2XISA 1F3LA 3OFJA 4GEKA 5K0EA 5B1SA 2CKDA 1MNZA 2YXEA 3IEIA 1L3IA 4GOMD 4F86A 5DX8A 2XYQA 3PFGA 5HIIA 2OPBA 5KS2A 1WXWA 4A6EA 5EQJB 5HOQA 5EIFA 1G8AA 4BP1A 4ER0A 1UIRA 1XIGA 4ZB0A 1P39A 1OADA 2WA2A 2V74B 4FSDA 3RIEA 4E70A 2NYUA 4FT4A 1BXCA 2GA9A 2IH2A 1XLBA 3ITLA 1RI4A 1XTPA 4YUWA 1RI5A 4M37A 2IPXA 3C3YA 3LDFA 4PONA 3LKZA 1XIMA 3AYVA 3A25A 2AOUB 2G72A 1RI1A 2AN3A 1R74A 4R8SA 1S5NA 2B25A 1XYBA 4YTUA 2QY6A 3BWMA 1IM8A 3BWCA 3CJTA 1I1NA 3DXYA 3ELUA 3G5TA 3LKDA 4FT2A 5CUQA 4CKCA 4MHTA 2FCAA 4M7RA 4XIAA 3HVHA 3LX6A 3PB3A 3UJBA 5EKXA 3BZJA 1YZHA 2C7OA 4R05A 5XINA 2AS0A 3G88A 4PGHA 5J8LA 5E9QA 2IBSA 3LDUA 4GF5A 1G8SA 4GUAA 1WZNA 3DTNA 4YTRA 4E32A 2ERCA 3GWZA 5GIPE 2XYVA 4QE5A 1M6EX 1TW3A 1DIEA 2DPMA 2P35A 3K6RA 4A6DA 5CVVA 1ZGJA 5KYGA 5HFJA 2NQ9A 3TPZA 3R3HA 2C7QA 3M0HA 1KYWA 5K01A 3BGIA 2YX1A 1A0CA 3CJQA 1MHTA 5LSAA 1A0EA 3IUDA 2UYQA 4MTLA 2Z6AA 2KW5A 3EVZA 1PJZA 2PXCA 5E1MA 3MB5A 4BY9E 2Y1WA 1JG3A 4RVFA 5ICEA 1P91A 2ZVRA 3M6WA 3UJ6A 5FTWA 2IDJA 1JQ3A 3CKKA 4DCGA 1QAQA 1VPTA 2HMYB 3FPHA 4FS8A 1XLAA 4RSRA 3KWSA 3GJYA 5C1IA 4RTJA 1IY9A 4G56A 3CVOA 5LQCA 3TLJA 4K3ZA 3PFHA 4X41A 5JUWA 4DUOA 1WG8A 2UYOA 1IXKA 3EMBA 4PYQA 4PYMA 3GIWA 4US6A 5I7GA 1XXLA 4LECA 1EAMA 3NWEA 3KCLA 1QTWA 1ZKDA 5BP7A 2NXCA 4HNOA 1EG2A 3GXOA 3ELWA 3VNJA 4GOLD 3S68A 3B3FA 3LL7A 1CLKA 4LNCA 1TW2A 1MUWA 2H11A 3M6XA 3ME5A 3TRKA 9XIMA 1XJ5A 4POOA 2CMHA 3DXXA 3KHKA 3VNLA 2PX8A 2N47A 5CCXA 4DA4A 1G38A 3IYLW
chains in the Genus database with same CATH superfamily
5AVNA 2YRXA 1U9IA 4IY1A 2HRDA 2ZAMA 4I50A 1W2VA 4JX6A 1VR6A 2WSRA 5H4GA 2ES4A 3D7NA 4FNGA 3HCBA 2IYYA 3K8MA 3LI1A 1LLWA 5DKFA 1UD5A 5KZMA 1AE1A 3MI6A 4L28A 5HDQA 3HO6A 4KCTA 2ZRVA 1NM5A 4GI4A 2UWFA 4AF8A 5BT9A 4UTLA 3GBPA 2EJUA 3II6X 1JZ4A 4IKPA 1X7YA 5AYZA 2DWQA 3U09A 1ZVJA 5GNYA 1HYQA 4JVMA 5ALOA 4AZSA 3NC1C 4AYWA 1GOWA 4PLCA 3R40A 1CJBA 1WMFA 1WO2A 4MRRA 4M1EA 2GJXB 1GGOA 2Z08A 1Q2XA 4B6OA 4D9IA 1P6BA 4YMZA 4QLAA 3QEAZ 4H7JA 4FM9A 2JBMA 3LOTA 5IJZA 1AK9A 3B1WA 1OLUA 2FJPA 5CDSA 3FFBA 4GOKA 1KVSA 3O8RA 4UBOA 3IEKA 2O56A 3HB4X 2AHRA 1UOQA 5KTSA 4ZTUB 1P0NA 1SM9A 1V0MA 2EPLX 2W2KB 3DLBA 3RS8A 1SOWA 4L0DA 2VR5A 5JSZA 5REQB 3F3YA 1NF3A 3A3OA 1IFXA 3V0SA 3JR7A 2BEWB 1NW3A 1V8BA 1SZJG 1RADA 1SC9A 3J7HA 3DVAA 2WMDA 2E5FA 1U8TA 3NJRA 4YCJA 2I66A 4I9AA 2F3TA 3TF5A 1P0QA 3FIUA 2CIPA 3QLEA 4RHEA 4B73A 1GL9B 5KHAA 4W9TA 4CCCA 4P84A 4JH0A 4DUZB 1KYVA 1BMDA 5IRPA 2BFPA 4J2MA 2Y93A 3GRZA 4W5JA 2ZJ0A 4S04A 1TZJA 4MQFA 1XRRA 1AUSL 3G2PA 2ZWZA 1RXVA 1TLTA 4IDHA 4CIYA 2X4IA 1A80A 5T9CE 5DCDA 1HTBA 2W2TA 2JAQA 2C95A 2Q5HA 4W9NC 3IPRA 4HNVA 5ADHA 4UMCA 1Z68A 1MTOA 4GNKA 3QJ5A 2ZFUA 4TTQA 2Q5JA 3WDJA 1RHJA 2A88A 1Z4PX 2FJUA 3D4BA 4KI7A 4FFBA 4ENTA 2W0SA 4MIMA 1I4LD 4C05A 3RB8A 5D7NA 1Z3IX 4TS3A 2HXUA 3M4YA 4CM8B 1IN7A 1LRTA 1JTVA 4F0JA 2WJIA 1OC2A 4LVUA 3QJGA 2X2PA 2QDGA 2F1JA 2GCOA 2ZC8A 3XINA 1TU4A 1ONRA 5FBRB 4KIJA 4MWAE 3GT0A 4IV0A 3MS4A 1YU6A 1GOIA 5LQNA 1K0UA 3U3ZA 4CHGA 2R7KA 4ZO4A 4JC8A 1AQJA 1TTQB 2PUAA 3LMZA 1YIXA 4K1XA 3E82A 3LBIA 4BB9A 2CCGA 2ZSAA 3JD2A 4NL1A 4KAFA 2MMCA 1P1HA 1P4RA 3A1WA 3KQUA 2QJWA 4DR5B 4MZ8A 3SKXA 3SVTA 2X9NA 5DSZA 2QUNA 5B36A 5CSSA 4YREA 5BPFA 1VBJA 1O5OA 5H5JA 1OZFA 4CLRB 1JZ3A 2JKZA 2G8ZA 2NO7A 3WRYC 1GVOA 3FFWA 4H9UA 4XWUA 2FW0A 4GQBA 1QSGA 1BGVA 1JB9A 4MPTA 2PTDA 4YP9A 4GBED 1HTWA 1EINA 2XIQA 1N5MA 3U1TA 4X9SA 3TUIC 1W1VA 3GTFA 2OUIA 3Q2DA 2OYRA 3PDIB 3QPYA 3AJ7A 1IGWA 2YINC 2RJNA 1OX6A 1W5PA 4CU8A 3GGOA 2EWVA 1L3IA 4U7GA 2XQVA 3GO2A 3C5VA 2GJ8A 4AHQA 3HB1A 4GISA 2P4UA 5L6MB 1WETA 4UUOA 4TXNA 1PKMA 4QGFA 3EPHA 1BVHA 3F47A 4RZ6A 2WAAA 4F8XA 5XINA 4MVCA 4HN2A 3H4XA 1VJIA 3SYLA 3F3KA 2ZUVA 4HDNB 4BBAA 1XBYA 4NYYA 1A0CA 1PJ9A 1RQBA 3NX4A 2MWMA 3FPSA 3J7AC 4H7DA 4K2HA 1M67A 4W8GA 4HD8A 5ECWA 3DC0A 3P2OA 3AVWA 1QTWA 4HQVA 3UW1A 5C32A 3ABZA 4L9SA 2Z1NA 4DUXA 2D24A 1JE0A 2WZHA 3FAXA 4Z8YA 5AJUA 1II8A 4S1NA 2TAAA 2G9RA 4Q03A 5MF6A 2AEMA 4DXVA 5DM2A 2I57A 3GFTA 4CMJA 4ZV7A 2RGAA 2ZRJA 4NOKA 5H8UA 3ZD8A 1EXDA 1GHRA 5H91A 1JU4A 4PG7A 4J0JA 1MENA 4LWQA 3BD9A 5KYXA 2H3BA 1EGZA 1ISWA 5L3QA 3MWDB 1PEDA 1O9BA 3K2QA 3W8EA 2H1RA 3RWBA 1PT7A 1JJIA 1A5BA 5JFOA 2HPAA 3OC6A 3R09A 4HIBA 3ZDCA 5CYFA 2D0FA 3DU0A 4R53A 2QN2A 4CLXA 4LCEA 4F4CA 1ODKA 3ZBQA 2YHBA 2QTFA 2PKCA 2OQVA 4EAQA 1I1XA 1IY2A 5EVJA 1ZHOA 4B3SB 3HP7A 1JZ2A 3S46A 3BXGA 1MTZA 2YDAA 4J6EA 4MVJA 2VAPA 1I10A 3PPVA 1CIPA 4HPJB 4RV9A 3FPFA 1Y3CE 4UHKA 5HNRA 1WW8A 4ZVMA 2WF9A 1PZFA 5DGTA 5BURA 3L4TA 4JMLA 3MO4A 5T91A 1LRQA 1ESNA 1YE5A 2VOJA 4LK2A 2XW6A 4X7BA 4DO7A 2ZUDA 2R8ZA 2NX9A 2QMEA 3LG3A 5DE3A 3ZJ5A 4V0RA 2BCGY 1FWBC 2AN9A 3TLEA 3GMTA 2F9FA 4FNTA 4WA7A 5KMGB 3PTZA 1WMDA 4WW0A 2N3ZA 3QBEA 4MB1A 3V8BA 1IAVA 1T5AA 1H4QA 1AN0A 1UUOA 1EP1B 1FVOA 2QNBA 2DQWA 1YL6A 3ZJKA 2QVXX 4MO9A 4DCOA 4G1BA 4YHGA 3CAQA 3MTWA 2AYYA 3IS4A 4EJSC 3RJTA 1UM9A 1HL8A 1O96A 5I9MA 3H11A 2CEQA 1X96A 2HQSA 3K9FC 3GD5A 3EDCA 2GHIA 4XE5A 4DBEA 4EOUA 2PSEA 3R0ZA 1KPGA 4IF4A 1QHSA 2I99A 1BVNP 1X97A 1BVZA 1C3XA 4FYWA 3VOSA 3ULKA 3LRKA 1G5AA 5LNSA 5D8ZA 5E9JA 5A4IS 1VFSA 3I52A 1ZRHA 1NXOA 4KUGA 3O2LA 4MIEA 2FZVA 1FTSA 2X5KO 4RW0A 2F9LA 3C0QA 1GEQA 5JH1A 3VOHA 3E6EA 2VBGA 3F4VA 3FDGA 1JXOA 1YE8A 3KPJA 4JB2A 3I5UA 2WWXA 4HGXA 2BI8A 3NGFA 2G9VA 1TEHA 1JPIA 2RAUA 4HS9A 4OMCA 3PX7A 3KXIA 2D5AA 2ZBUA 4RH3A 1RA5A 4X9YA 2H2IA 1F3WA 4EF9A 3GHHA 2VT0A 1GNLA 1XCOA 2A14A 1WXQA 4EYEA 2FWNA 2Z2XA 5IWCA 1M8FA 3OO1A 1MHPA 1QS0B 3OZDA 1MO2A 2YBTA 4P7JA 3ADCA 2I62A 5DVZA 1T2EA 4GXNA 3F2BA 5IN4A 3CEAA 4KRGA 3AIWA 3WSVA 4PMRA 1W7AA 5JXGA 2NQ5A 3VD4A 2C42A 3QJAA 4WEOA 3KR0A 1NVGA 4JEJA 3LQYA 3FD8A 5CJJA 1PXGA 3PTMA 2ZDHA 4BCDA 6XIAA 1N9GA 1GOQA 3WYDA 4DKJA 3P4XA 4FHEA 1AG9A 3BIFA 1J25A 2Z26A 3W7GA 4G5GA 1Q14A 2XGGA 1ZG3A 3D0QA 4NS4A 5I3GA 4F3KA 4PZUA 1RK6A 1PR6A 1CJTC 3A6ZA 4KPFC 4HEA6 2C2XA 4BLUA 1IXYA 2UBPC 3QKWA 2HHLA 3URNA 1MEWA 2J9GA 2NZXA 4QG3A 8CGTA 2B4TO 2PURA 5CA0A 3QWHA 3UWOA 3VBCA 2UYHA 1P4HA 4UBLA 4PHHA 4WNAA 1F3LA 4JIGA 5ITVA 5K3OA 4ZXOA 3WSUA 4MWBA 4U2CA 3NP7A 4O2RA 4XB3A 2D5BA 3E2QA 1NJ8A 5I9LA 1P4GA 2TMKA 4H9TA 5HVNA 3CV1A 2QL5A 1PJ3A 2JHGA 2X6QA 3FYUA 1YZHA 3PTLA 4U39A 3E0FA 3CF2A 2FR8C 4GMXA 4QYIB 5H81A 4F1KA 1Z8AA 1QNFA 3CO8A 3TPZA 3IAS6 1SGJA 1W4LA 3V75A 1KKLA 1Q44A 3O83A 1HX7A 3B40A 1ZM7A 2OWWA 1II9A 3N0WA 1EJVC 4DUOA 2C4KA 4UNKA 4L4PA 4G4SP 4BU1A 3KYDB 3BAXA 3KVOA 4B7ZA 1XF0A 4LNCA 1MNAA 3FX4A 3RCMA 5AVKA 3ARRA 2CMHA 2P65A 5FUYA 2BBWA 1UKQA 2GN0A 5JQ9A 4TV9A 1Z9BA 4YH1A 1FVPA 2VCEA 2B1IA 3ESCA 4WMLA 3WICA 4D26A 4HK7A 2ODQA 4LJAA 2TSYB 4X3ZA 4RZHA 3HCRA 3AXXA 3M0YA 1YR1A 4L0QA 4PTYA 3D6UA 1V5GA 1NI4B 5FBZA 2QDDA 1JLHA 4WNAB 2OHFA 3M9YA 3TAOA 2FMIA 2PYZA 4UDXX 3P96A 3VX4A 3UR8A 4IG2B 4X61A 2O3QA 4TV9F 4KERA 2GK3A 1KI9A 1N6OA 2BWGA 4PZVA 3I9V1 2E5DA 4DN1A 4W9RA 4JR0A 3SJCA 1E6PA 2W6MA 3CLMA 2X5JO 5C2JB 2R8OA 3O0KA 4OTZA 4NZ1A 2ZSDA 3QGKC 4INFA 2HA7A 1KH3A 5KOJB 3EMZA 5FADA 3PGJA 1EXWA 4ZVNA 2QYGA 4CD7A 4PM4A 4CM5A 1UT6A 2XTKA 1PHRA 4QRNA 5ALYA 3G2LA 2LD4A 1SKBA 3MCWA 4QOJA 1CDOA 2HBRA 3CSUA 5HR6A 2WFLB 5CAKA 5EPDA 3EPPA 2OO0A 3GMDA 4DRYA 5FPPA 3W5VA 3AJEA 5FBHA 1DKNA 5HAOA 1BC5A 4KQ1A 1W85A 4S3EA 3TZEA 5DRIA 4N9WA 1CK4A 1HKKA 3VNRA 3KQOA 2GETA 3WQBA 3CNQS 5CGQA 1YOBA 3QKTA 4KLNA 3KZNA 1GD1O 4MW7A 1BCSB 1GONA 2I4OA 4TXMA 1GSOA 1IOWA 1CUEA 2PLFA 3CMGA 3H7VA 1T15A 2AUNA 1SFJA 2IX3A 1HLPA 5AJYA 1K77A 4PL1A 3WAKA 3ICQB 2HMUA 5K0JA 4KBXA 2IXVA 4ZVRA 5U7SA 4Q3CA 2QKFA 4KVFA 2I9KA 3WHPA 3S0JA 1U0LA 3W2FA 4JFVA 1ZVVA 3NUQA 1LDYA 2ZXUA 3UK6A 4FXRA 3CEPA 4AEEA 5EIBD 4IHJF 2QE6A 1SFRA 2OCIA 3Q37A 1Q4NX 1HT6A 3O38A 2Q0QA 4ZVUA 1XC7A 3KEQA 3VJMA 3BW3A 2WI8A 3CN7A 2ZYRA 2R8YA 5B3KA 2DZDA 2Y1KA 3N2MA 1CGTA 1IXSB 3TWBA 1K0FA 3WSTA 3LHZA 3JPYA 3T81A 2AZXA 2JI9A 2Z5VA 1XZCA 3WK5A 3UHPA 2Y99A 1KV8A 4EM6A 4M6WB 3M1AA 4F2PA 3GP3A 2WSPA 3A2NA 4KPYA 1GGJA 1VOTA 5ALUA 1NR7A 1Y4DE 4OFWA 3W6LA 1Q0PA 1N7IA 3ENVA 2PU0A 3LKBA 4Z0PA 2VXCA 2ROQA 4LSBA 4ONVA 5CC7A 1XLIA 5TR9A 1BFNA 2C0CA 1JIKA 2HSZA 3OPMA 4O28A 3RHSA 1Z41A 4Q8WA 3HDJA 4Y2YA 5CCEA 5A3RA 4DHEA 2FN4A 2J24A 3FUTA 5BMVB 1PL9A 2GUUA 3G1YA 3Q98A 2NUXA 3V1TC 4DCSA 4FE7A 4RV8A 1B6RA 2VHQA 4KSBA 4R6XA 4Y7EA 4B31A 3EZFA 5EUMA 3OZ7A 5HTOA 1P4CA 3DYVA 1IXQA 5KQMA 1T4CB 3TFOA 3DT9A 4FMPA 2V9DA 3EWAA 4QO8A 1ZTVA 4GABA 1XIHA 2BPOA 3QVLA 3G24A 5G02A 4O29A 1L6FA 1UZ1A 3QVKA 1UXOA 4RSGA 2XJ9A 3EQ2A 2RGGA 3TG8A 3K2GA 4YUZA 1YOVB 3O95A 1LY1A 1XTSA 3ILXA 2JLCA 1FSFA 5C55A 3ICJA 3SJAA 3VZCA 3F2IA 1C1HA 4EJ6A 3WYBA 1I30A 3ANLA 4Q4CA 3QPZA 1M2HA 3BSWA 4G1UC 1HXJA 5JNUA 1Y8RA 2GCOB 4AN4A 2PWZA 5DTEA 4EUKA 1QQTA 3OFJA 3TYBA 3ABXA 1SU8A 3SBXA 4QEZA 1V41E 1TF2A 5ALXA 1W5QA 2JIMA 4C0JA 3UPBA 1ZI6A 1VB9A 4NBWA 3W0KA 5A6LA 1M6VB 1R74A 4H2DA 3DPIA 1NKTA 3ZZ0A 3OTIA 4OBRA 3BRSA 4B81A 1WZCA 2MR5A 1FEZA 4KE7A 3NFYA 4R85A 5LNUA 1UUQA 4GCAA 1IN6A 3PUOA 2WWIA 3F6EX 2P5SA 4TVCA 1L5QA 2P9EA 3BBLA 1XALA 1MJ5A 2C91A 2QT3A 2JATA 3FNGA 4ZGBA 1LPSA 4KPUA 4FLMA 1EAMA 1IBMB 1CY7A 4QNWA 1JR1A 3DHVA 1IYZA 3QENA 4PUEA 2P9GA 2O2ZA 3C8FA 3P80A 1FMCA 4M53A 3G89A 3PT9A 2IY9A 1H65A 1FJXA 4ZXLA 5I2UA 3V3TA 1BEZA 3WQRA 5HNUA 3PQ2A 1Y4AE 4RPHA 2WAYA 3RKRA 3GG0A 4DM3A 1ML1A 5IHPA 5F1UA 2I9UA 5JNVA 3ZWCA 3USBA 2GPJA 2VDPB 2EC5A 1AQYA 3EGVA 5C5DA 1ONPA 1XFAA 2DSNA 3THCA 1MR3F 3A9TA 3EXEA 5D51S 3LBHA 4AJ2A 5EFOA 1TEZA 4WTOA 1GYQA 1ZIOA 1ACJA 1KGDA 2MUCA 6LDHA 3GUVA 3UG4A 3H6KA 4RVUA 1YTKA 3WMSA 5A5VA 4S0ZA 2Y1LA 4AWUA 2CLEA 1E5LA 2PAFA 2PRIA 3TZKA 1FFRA 2XBMA 1ZXBA 5BNTA 5D8DA 4TWZA 1TMLA 2IIPA 3GEHA 3VOIA 5F2KA 1SUBA 1DPGA 2TS1A 3ZLGA 2WDZA 3UWUA 4CL3A 5IC4A 5IKMA 3MD0A 3AWOA 2OWCA 1GK8A 4FIQA 3H5WA 4FBLA 4LRQA 3U6WA 1NHWA 1DIKA 4AUBA 4UXHA 2VHTA 1UC9A 2HK7A 3SCNA 1AJZA 1C7TA 1WSAA 4ZICA 2JLVA 1OXXK 4DGSA 5JJIA 3ZHYA 5C5CA 5B55A 2X8JB 5T8KC 2WHYA 1FQJA 3WRVA 2B3DA 1N2CA 1HH4A 3C3DA 1NY5A 1CVLA 3KWJA 2GQ9A 4JUDX 2NO0A 4UAGA 3SZOA 5HJXA 4P9NA 3EGIA 2Z1KA 1IT7A 3QLTA 4MKVA 5H8PA 1D2KA 2BTQB 3NXFA 2XUJA 1PRYA 4V0ME 1BXNA 3KDSE 3W76A 1BX0A 3GBDA 3RWOA 5BVHB 3WDHA 2XJ4A 4BEQA 2P77A 4MYHA 5I51A 1QE5A 3I61A 3STGA 4MEJA 1VFLA 1UP6A 3HEAA 3ZGVA 3IRSA 5GINE 3D47A 2REQB 3PUYA 1PGOA 2LIVA 2DPHA 1ZK2A 4G07A 2PMWB 5FFMA 2PMFA 5FRDA 3VHRA 1UJ2A 4AMVA 4C3VA 1WAUA 1GJWA 2QTGA 2XUPA 3C8UA 4AKTA 5F4WA 3BGJA 2W92A 4B5WA 2FMHA 4MRMA 1XNGA 3P5BA 3MB8A 1OAOA 2GN2A 4D6HA 1CNEA 5IT5A 4GMGA 4K81B 3CUVA 5JD5A 1IBSA 1I4EB 2PZNA 2QM3A 4P38A 5ICFA 3I1YA 2C2KA 3O8AA 2BFDB 3TOXA 3SIWA 1H50A 3NQEA 3TNLA 1FFAA 4GFDA 1QK4A 3PFFA 3BT7A 4IMCA 2J4FA 2JIRA 2PEYA 3WLKX 4PUMA 4PZ0A 5DBFA 1D3HA 1JUDA 3T4UA 4OBSA 3K70B 3CV3A 1YHTA 1XDUA 4YNGA 4FCVA 3F3MA 5ECYA 1IQ0A 2P2CA 2BDEA 2CXEA 4XD6A 5HR5A 4GLOA 4QJ4B 3H2CA 4HUJA 1OWLA 3FGCA 3IMKA 4NNPA 2EQAA 5G2WA 2Z04A 2GSHA 1KZ9A 4FONA 2VDLB 3ARQA 4ED9A 5JNSA 3CEHA 4XSGA 3BG9A 3MFQA 3CF6R 4NULA 3ONBA 1XP8A 3B1JA 2YZGA 3FF1A 3PJUA 3H9BA 2JHAA 1C1DA 4KLAA 4ZJYA 4NBSA 2GUYA 3FCXA 5HUOA 3AICA 2E48A 1YVEI 3MYRA 3AF5A 1DXQA 4G41A 4UBIA 2R79A 1DKQA 4NPAA 5M17A 5EEHA 2ACUA 2R1TB 3HUUA 3E18A 2FRDC 4ARSA 3U5ZB 4X6UA 2DBVO 1EH5A 3I39X 3PYXA 5JEDA 4II7A 4A0FA 1ZUNA 1RLIA 1PT9A 4CKEA 5DM0A 4LVBA 3DCNA 1DQRA 2NU9A 3OZFA 1F2DA 1SQ6A 4MQ5A 1Z4LA 3GT4A 4RX1A 4IJBA 1Z33A 2VJMB 3AU2A 2V9CA 1R6VA 2EG5A 4FNRA 2PS3A 1L5HB 3I42A 1E18A 2JPDA 2QV7A 3TS1A 3DVLA 1F8IA 3VR5A 1G0NA 3OCZA 1XD0A 2VPWA 1JDBB 5AKHA 2HJHA 3ZWNA 4OUEA 3PG8A 5C8XA 1JDFA 2F67A 3LUBA 4YTUA 1NQWA 1A69A 5T4FA 2DH2A 4CM4B 4H3HB 3OPSA 2QLJA 1G5HA 1LS1A 1XG3A 2PFGA 1MN6A 4AS2A 3IUDA 3W9SA 4NNAA 4K6KA 1AMOA 4FB5A 2PXCA 4EKEA 1CUWA 3KSDO 3N0RA 5KSWA 1YU9A 2XMRA 1ZESA 2XA2A 1ZN7A 1JKJA 2XYLA 4YRCA 5J1SB 4R2MA 1GPWB 2HCRA 2X0NA 5ILGA 4G0ZA 2FU5C 5M29A 1ZP3A 1Z34A 1QS0A 1GUFA 2VCCA 4U5IA 3G3MA 3BRWA 2DYKA 1H2RS 3BIJA 5D2TA 1JJVA 4KR2A 1KRMA 3TJXA 3EXSA 1OT3A 4P92A 4YS1A 1YGYA 5EZ5A 1H1YA 4YASA 3URMA 3PM6A 1GWJA 1XLWA 3EWCA 2BTOA 1NZJA 3OIHA 1FYDA 2B94A 1OFGA 4PYSA 1O5IA 4CQLA 1DJLA 2AN1A 5IJAA 2VX4A 3UC5A 4N18A 3L7LA 1L4KA 4WFQA 2Y0CA 3IFSA 4QJ4A 3EDEA 3SX2A 5FA5A 4MKZA 1HY3A 3PF3A 2VFHA 2BOEX 5EG5A 1J56A 1O89A 3VSDA 3HNRA 2XM1A 1LGYA 2XQGA 3UMFA 2V3WA 3EDYA 3PE6A 4NI8A 5CXUA 2W4XA 2O4MA 3EDKA 3QWBA 2BGNA 3INTA 5TNVA 1N6RA 3CLRD 1LG1A 5AHEA 1KGXA 2OTCA 2V7EA 1JFLA 1JZ7A 5LVAA 3QN3A 3A6HA 2VJXA 1TUGA 2VI5A 3E1SA 4JFAA 4UATA 1ODCA 3I1JA 1NP6A 1KXTA 2I3AA 4J91A 5AJZA 1UXGA 3MCAA 4TX8A 3VSEA 2QCNA 2WYOA 1ZPTA 3W87A 3PNQA 3H05A 2QR5A 3LWNA 3ICOA 4QCEA 4TMTA 2Z28A 5JR3A 2GK1A 4XYEA 2PH5A 3N19B 1GR0A 3IBFA 2QDXA 2OD9A 1XHEA 3R5FA 3LB0A 4C6SA 2Q1UA 4JA2A 1JAHA 1UBKS 2YZ2A 2XPCA 1C7FA 4AVNA 4R1MA 1GDTA 3OZBA 4M80A 2ALRA 1QH8A 5LGZA 3BB1A 2GJ9A 2BWJA 2QUIA 5J2TA 1R4ZA 3L65A 1CGYA 3O8QA 4ZQRA 2VT2A 4B3DA 4UFPA 3RC3A 1JGIA 1XZEA 4P8VA 2EJBA 3JAKA 2A4KA 2Z2BA 2IP1A 1M33A 2ZANA 4O8AA 5BQXA 3EZXA 4YCPA 2QRVA 4DC9A 2ETXA 3THSA 3D8SA 3TQKA 2AL1A 4BC0A 3NANA 1R2RA 4L1GA 1UEXC 3W77A 2F1KA 1G7VA 1SJDA 4CUCA 3KX2A 5AVRA 1TO6A 2G37A 2NMVA 2EFGA 4KQJA 3FMIA 1UZAA 3I01A 3IS3A 4ZRDA 4XKYB 2CEAA 5EPEA 1RAFA 1DE6A 2H18A 5HDRA 2AVDA 3V8RA 2R7NA 3IBYA 3WMLA 5AUOB 1NQ6A 3WOHA 2NX2A 4BQPA 2BASA 4RTLA 1OCBA 1IT0A 2XN0A 4UARA 1J0XO 3DH0A 3QFWA 2GLUA 4NRRA 3OE5A 2RAPA 4ITVA 1JRCA 3M9WA 1V0JA 1A8PA 4WKOA 2WV8A 4WXMA 1BMTA 4F2DA 4EY8A 3OA5A 1EDTA 3TE6A 2HADA 3E12A 4PC3A 4XDHA 2WJWA 3L01A 4GUDA 3NPUA 2ID8A 4NZOA 3GH7A 3CZLA 5AOUA 5ENDA 4Z51A 4CKBA 1ESWA 2VEGA 3PLNA 3FLMA 1WE2A 2A59A 1OB0A 3GZAA 3VKJA 3H2ZA 3H75A 3LCRA 2OHHA 1ZIYA 3K4PA 1BOOA 1SVLA 2JEQA 3E70C 4AI6A 5CC6A 5JJLA 3HP4A 3PSVA 4OTKA 1JFFB 3WD4A 1K4YA 3G1AA 3QXBA 5LYJB 2OG9A 1UH5A 3T35A 1J6OA 1IXOA 1N8FA 1YS2X 4CLOB 4HWTA 3FA4A 4IXTA 4HJRA 3H2NA 3L68A 4B5KA 1BSVA 3IDZA 5IM51 4OJTA 5FFNA 2IYEA 3SM9A 4G5FA 3L0NA 4O0KA 1DXFA 3DDCA 5HKBA 4KRTA 4JC0A 5AHNA 2ZBPA 4PTDA 1Y8QB 2IYWA 4Y9DA 1EI9A 3GG7A 4NUWA 3I5XA 2XVNA 1CUYA 1L4BA 4RVSA 3T1YB 4O4LB 5BNIA 3DBOB 1H4TA 4IMGA 4CKZA 3VA7A 3W74A 1K8XB 3UC9A 4ZA2A 4NQRA 3OE7A 5JMWA 1VRDA 1DWPA 2R24A 4WZHA 2RKBA 1TZCA 4NZCA 3R9KA 3GLKA 1WDQA 4G81A 2BZNA 1E96A 2GCPA 4Q4HB 4QPZA 1QWKA 4D6DA 4BF9A 4AAYA 5FR2A 1S38A 3R43A 3OURA 5HCIA 3SICE 3KYCB 1F6BA 1M2NA 4Y2SA 2QLBA 4URYR 4BC1A 1M2KA 3KUUA 4I4TB 3CH9A 1CRWG 4DDMA 4HS4A 4XBJA 3Q58A 2VP5A 2WLTA 3S1GA 1FHLA 2I76A 4DDHA 3CZCA 2C0AA 1JW9B 1FOEB 1WZIA 4BJ6A 3EYWA 2PU5A 4HEHA 4ZQHA 2R3SA 3E4CA 1JSRA 1QQ7A 4BQOA 3I2GA 3K1JA 2O23A 2IU0A 2UY3A 4EMBA 1L9WA 3IGSA 4LNUB 1L5FA 1C3FA 1DKRA 5IDYA 1TIPA 2XVXA 2YKKA 4QITA 2V67A 4QFBA 3TQ0A 2YUTA 3SY1A 4GHRA 2XGIA 3GOHA 2WJGA 2FHCA 3SKYA 5C46F 4AXNA 2CXXA 1ULHA 3PQ6A 2LGJA 2QTVA 3H2IA 1IVYA 1M6WA 3PR1A 1PFVA 3GU3A 2ACQA 1ONBA 4MR8A 4M5PA 2Y77A 3WGHA 1RCXB 5G4KA 1Z44A 3LQ2A 2FDSA 1NKSA 3KUCA 4HRVA 1TPEA 1VRXA 2LTAA 4LZOA 4DBSA 3T3IA 1XF9A 4CT4B 1J8MF 2VDRB 3CC8A 4L9YA 3Q5GA 5JCJD 1MV8A 3Q4GA 4JBWA 4N65A 4FCTA 1HMYA 4WLFA 1PX0A 4IJQA 1YNOA 3UXYA 2QVNA 2PTXA 1T8UA 3P2VA 1P6UA 4UOZA 3SCPA 3KTXA 3K0KA 5I6SA 2WLZA 2VDMB 3AXHA 1QMGA 1YZTA 2PWBA 2VK2A 4IF6A 5HR7A 3G6LA 1THTA 1T5IA 2RBEA 4XDZA 4RS4A 1EYEA 4WVXA 3I6IA 3QEBZ 1BH6A 1CPUA 4D9HA 2I80A 1CWUA 1C9MA 2J3QA 4FIDA 4LV4A 5H1YA 2QTLA 2XVPA 4RDXA 4W8AA 2WUFA 1LPOA 1N5KA 5EP3A 4OU4A 1FCUA 2HMAA 2J59A 4RWEA 5K1ZA 2NPIA 4AD1A 5JAQA 3BMNB 5GONA 1ZJZA 5IUKC 1ZYUA 4YWHA 4CD6A 2BM8A 2IITA 1EHIA 1VGVA 1JR4A 3LLMA 4BNUA 3L67A 4PC8A 5H80A 2FPWA 1TV5A 4MGHA 2QYTA 4UNNA 2FSHA 4O3MA 1HO3A 5JY1A 3A2KA 3TA6A 4R8VA 3E0WA 4YMSA 5H9VA 3OQPA 2Q6KA 4K6HA 2JLYA 3OF3A 3B13B 2INEA 5CPSA 1I0IA 3PUDA 4MQ4A 4R1SA 3KFVA 4TRNA 5JSFA 1Z7AA 4GPEA 4Y9NA 2A9PA 1MOSA 4L4LA 4ZALA 1D7FA 3FSRA 1VFPA 5T8KA 4UQPA 3PD1A 1KFBB 4FPSA 4PB5A 2J48A 5HMLA 2BVNA 3OB8A 5B7GA 3QNMA 4J03A 3F4WA 1RPAA 3CR3C 3DJFA 4ASUA 4GWGA 4R1TA 2D5CA 2UY2A 4U0JA 2Z24A 3AESB 2DXIA 2A9RA 5AI0A 4BMXA 4ANFA 1UJ5A 1EGHA 4HNNA 4KU4A 4LYPA 4LC0A 2R4QA 1COZA 4DG9A 4I7EA 2E3JA 5H3LA 3FOBA 2YL5A 3GHTA 5K7JA 4E13A 3ZJ4A 2YIVX 2DP4E 3CVJA 1KW1A 1Y7VA 4AJPA 3PC8A 1VG0B 3LTYA 2CDNA 2NZ2A 4BE4A 4E5YA 5BOFA 5EUBA 3KWFA 4CG3A 1EVZA 3WQPA 2BZSA 4Z4HA 4KAXA 2ECFA 3A0UA 3WDKA 3I2IA 1AHHA 4DLUA 1N8IA 4A3UA 4ARAA 3LYEA 5GONB 3PFRA 2I87A 4BAUA 1OFVA 4RZIA 1FXUA 4CBVA 5HIJA 2C7BA 1V9CA 3INYA 2QPLA 4PRTA 1UBNA 3EX6A 3RYSA 4UAUA 2WZDA 3OG2A 3EWNA 1BW9A 1CDDA 2P2GA 4OHPA 5EXTA 2YSWA 5HPOA 1FDVA 1MW2A 3A1FA 3KYJB 1BVRA 3WUGA 2D00A 5IT0A 1UOEA 2VJLA 4RETA 1YRQA 2C04A 3G22A 3PUJA 5SY9A 4B3HA 4E0CA 3FOWA 5D5PA 5LCXA 1NI3A 4M51A 3HGJA 5BRJA 1IM8A 2GEKA 4LXYA 2J87A 3JYLA 1PF7E 2P2NA 5CPNA 5GAJA 4E8GA 1DI0A 2EKLA 1FVHA 5GIPE 1TW3A 3EYAA 3PXEA 2GKOA 1EPVA 3M9XA 1KDVA 4M6VA 5LDHA 3MSRA 3C2RA 2PRZA 1XGDA 4MCIA 2IKGA 1KI4A 2M6SA 1KR0A 4PYQA 5HWJA 1PUIA 1WDTA 1Z8NA 4LECA 1IJEA 2HB6A 2OJPA 3VZDA 2JL1A 4GD0A 3QLDA 3IP9A 5FF2A 3RBZA 1I5EA 2C2MA 4RMIA 3KCNA 3VGBA 3ISTA 2ZTHA 4Y1RB 3KK0A 2QVZX 1FTQA 2BV3A 4L7VA 1ISSA 3KBOA 5JMOA 3K9QO 1H2YA 3GRUA 1WXGA 2Q3BA 2FGZA 1LRNA 2AYXA 2XYRA 1QC5B 5HZHA 4J3FA 2HBYA 2LKDA 2XVZA 5EXXA 1CUGA 1KXVA 3CX7A 1J8DA 5A7GA 5KU1A 3PWAA 3ORFA 4J4TA 3EXEB 1J4AA 5KIAA 1HF3A 2X4DA 3GUCA 3BA1A 2VJYA 1FYXA 5EC8A 1QTIA 5KTKA 1EDEA 1EWDA 5JZMA 3EF0A 3W9YA 1JKIA 2OGWA 3E5MA 2J0QA 3G8YA 2D20A 1GT8A 1JSXA 4KKXB 2ZDQA 2YY7A 2G0WA 4K40A 2FQWA 3PUKA 2XWPA 2Q3LA 2VGFA 5GJWC 2IKJA 3VGGA 1XROA 4ZTZB 1U5BA 1MAVA 4ZRNA 3SSJA 1E0XA 3OCVA 4S1OA 2WBLC 4IMPA 4UJ5A 3ZX5A 5BVGB 2D2VA 4HWOA 4NQ1A 1KK1A 1X1NA 1TYEB 3LV6A 5JALA 4ZQCA 5KEZA 2AJ8A 3FTDA 2HX1A 3R7AA 4KNYA 5AW6A 4GH3A 4DR7B 2HQBA 5DGHA 5JZVA 1Y3HA 5HQEA 4YFYA 4Q7BA 4K6FA 4BO2A 2R00C 4R6WA 3UWYA 1VKOA 1NT4A 3MTBA 1TJRA 3FYYA 2HROA 3TAKA 2Y89A 3CMFA 3GDTA 1NUTA 2PX3A 5C7VA 3C3PA 2JVKA 4L9XA 5HJ5A 4MB3A 1LD3A 3MTIA 1JECA 1U2RA 6YASA 3UBMA 2DX7A 4O1HA 1XMXA 4C6OA 4A8IA 1MT0A 2IHUA 3TSWA 2E5CA 3QQ0A 5DCUA 1BXRB 1FUKA 2QRNA 3GH3A 4OP3A 4PQEA 5LZ9A 4KTTE 1JV2B 3ZY3A 5IKEA 3QYPA 5FYQA 4ZCRA 1G6CA 1GUZA 2XSXA 1THMA 3UF9A 1VJ5A 2PS9A 2FDCA 4Q1AA 3L4XA 3VJRA 3QH4A 3KLNA 4CMGA 1QM5A 1XKTA 1EGVB 3UCCA 1X0XA 3FOZA 2X86A 2QVBA 3NAMA 2VZEA 5K6RA 5J2UB 4MA4A 5AB3A 3E15A 4HWRA 1Q2UA 1LUCB 2Q1WA 2J9XA 3A9CA 5HK4A 4CTJA 1G7RA 4TXLA 1N2OA 3OKPA 2ZOXA 3B8UA 3OZUA 1NG1A 4JL1A 1GXSB 1SUFA 3ROZA 1GNSA 4GX0A 5FJRA 3VJLA 4KO1S 2HGZA 3ZBUA 5K51A 1KEVA 5XIAA 4BJ5A 3L0KA 2ZTMA 4NICA 2PYDA 4MB4A 4YI5A 5LOVF 1MA3A 3ZE7A 3WF0A 3IR5A 5KPDA 2QAJA 2EZ4A 4I1UA 3C56A 5L9FA 3QFFA 5DGXA 3LCCA 1E55A 3FVVA 4XQGA 1BXRA 2VFFA 4OA8A 3HACA 4MIOA 4AIOA 1HUQA 3BGGA 1ALDA 4FMDB 5C2CA 3GRFA 4LC1A 5CNMA 2OOKA 1CLXA 1XHFA 4KEMA 1CNMA 1W3IA 1W9UA 4F8YA 3VPHA 5A2CA 2UKDA 1JRLA 1F3EA 3L0DA 1ZLPA 3TH5A 5A1AA 1ZD9A 3O7UA 3PZVA 3AWDA 4I7UA 2D2JA 2EKCA 2O0TA 3K0FA 1Z83A 4IFKB 3GIYA 1PO7A 5D00A 1QYVA 1MXDA 1XU7A 4JCOA 4Z9BA 1R4MA 3I5YA 2NG1A 4IX0A 4JDBA 3PJWA 2ZRAA 3QZ6A 5K0SA 3VXGA 4B80A 3SADA 3W8RA 3HMKA 1B8NA 1AF7A 3SS8A 3FTFA 3D2AA 4DPLA 1F1BA 4WNIA 1QFZA 2JFXA 4NCBA 4UM5A 1GA6A 3A9VA 1JLMA 3NRBA 2NSOA 2AV6A 4WOZA 2OWEA 3L93A 3RIEA 1KF0A 1FS5A 4Q32A 2AQHA 4BS0A 3WK4A 2ADAA 4XIAA 3NHLA 3PB3A 4MVJI 4R05A 4BV2A 2VF7A 2Z4GA 1KZGB 2OBYA 5EJIA 4V24A 2XYVA 1EFLA 2IUSA 2UYGA 1QK3A 1S5PA 2UYQA 5E1MA 3L4VA 3OLEA 4EMUA 3COTA 3E3HA 2ZJ8A 3DN5A 1ORWA 2HPHA 4FI3F 4RNCA 2GRAA 1KJWA 1OBFO 1R6UA 2VYFA 2NU6B 4J8PA 1TJ0A 4R33A 4MYCA 3I01M 2XZ9A 4J4HA 2H3HA 4QLJA 3BJEA 3LGXA 5ITZA 4I7VA 2AJLI 4G5SA 5JECA 1TFUA 5C8VA 1Q12A 2VWQA 1L4MA 5FNZA 1UWKA 2F43A 3HV0A 1S2CA 4E94A 2XVGA 3VAVA 2QULA 1QW7A 4LDJA 3B9AA 4P7NA 1Q3KA 4HBGA 3ITYA 3NSXA 3ALGA 4Y6GB 1IK6A 3ILYA 4HCDA 1N2HA 2ZVQX 1YDMA 4H4DA 4KXXA 4LX0A 3L1HA 4YB8A 2QI9F 3BMVA 1G3RA 2WTXA 4EY6A 4UFJA 4UZUA 2C88A 3AI1A 5EMYA 2Q4BA 1ZN2A 4DBDA 2JC3A 1NJ6A 4IGMA 5EZSA 5FWDA 3IRUA 1CQWA 2ZT5A 1T35A 3WJSA 5DX0A 1V4BA 3MLBA 4ZYTA 2QQGA 2AMYA 4BE9A 2DPYA 3VYRB 4C6HA 4PMNA 1KP2A 3RFCA 3GUYA 1P61B 3VTFA 3SX4A 1IWPA 1JZTA 3H2KA 3SEZA 3VDMA 3C1TA 2CEKA 3FPLA 5FYDA 2PM8A 5HMSA 4IDAA 1EOMA 4TTGA 4LZWA 4HGYA 2H8KA 1CBUA 1IOLA 1U28C 4TTPA 5ALWA 4JUCA 2O7RA 4UVDA 3DDSA 3DHYA 4P6VF 4OE7A 4K6GA 2XMSA 3M3HA 4PR0A 4QISA 1OYAA 4UU8A 2GBCA 2FJ0A 3RAGA 3PC2A 5HQ3B 4Z9YA 2YBUA 4RE2A 5ERGB 2GPYA 2OEPA 3MTDA 1EX1A 1YJCA 4DRXB 4H6RA 5TF0A 3QPWA 3EISA 5LZ8A 1FDTA 2LP4Y 1N9GB 3W1RA 5FULA 4FSAA 3WLSA 3KQYA 3EQ9A 1UJQA 3WNCA 4Q4HA 2E1DA 2CZCA 3GJ4A 4GBGA 1H2FA 1UDAA 3T06B 2VAVA 4ORIA 3G0OA 4W5RA 3VX1A 4D8XA 4K9QA 3KXQA 5CKSA 4JTRA 4WZ6A 3RT9A 4DF2A 1HVQA 4NJHA 3Q41A 1T6MA 4MV3A 3CWNA 5C18A 3GRPA 4PEVA 2R4TA 4JXKA 4IJ6A 4N0RA 2NTEA 1NF7A 3STXA 3COYA 3VGJA 4G5RA 3NQ41 2GWNA 4JIQA 5CJ5A 4FCCA 4EMTA 4CGTA 1RRFA 4P4SA 4NRSA 2W43A 4N3AA 3ETDA 4OSOA 4EZBA 3IBSA 4D8ZA 4OCZA 3ZCXA 1Z6YA 2B35A 4MRPA 4ALJA 2Z30A 4XZBA 4AF0A 4G9GA 3OSUA 2GGEA 2QIPA 4F48A 2VEOA 5FL1A 1QIKA 1NPTO 1FP1D 1RXYA 4K38A 4RDIA 4RO0A 2YFOA 4PCUA 4U33A 1PTGA 5KKAA 1TIWA 3EPRA 2NW6A 3ED5A 2QMJA 3W37A 2AL2B 3SAZA 2XYHA 4C6KA 1P72A 2OT3B 3B20A 5TPZA 5CEFA 2QPAA 5JAMA 5BXQC 3STEA 2UVPB 1B6TA 1C81A 4TVKA 3H19A 3DZKA 3F5SA 4A36A 3SLGA 2BS9A 3DC7A 2VZVA 3T09A 1EUNA 1R3SA 2DORA 2E40A 2HJSA 2O54A 1BF6A 2ZB4A 2ZFAA 3F2DA 4BJ1A 3T5AA 1JNDA 1Y9EA 1BN6A 4IR7A 2IJGX 1GA1A 3GGJA 2GCGA 5K8IA 4M9ZA 5I7SA 3NHFA 4YCDA 2QLFA 4F6LA 1EIZA 3LGEA 4MQEB 1Y4SA 4H1ZA 4IOJA 4Q8TA 4YRKA 1YJBA 2RBKA 4AYTA 3KZCA 2YZRA 1I1HA 3E9EA 4QG9A 3LXCA 1CIVA 2VRQA 3OCCA 5EHQA 2Y6ZA 3T5DA 4EO7A 1NASA 4W7UA 2NNWB 3D7RA 1JF8A 3CX6A 4ZEOA 3MANA 4JI5B 2F4VB 3HYRA 3GGSA 5K3CA 3ZLTA 1ZCAA 3GU1A 3F6BX 4M0MA 5I00A 3ROMA 2YV5A 4TX6A 3A24A 3QXSA 4EHNA 4OBTA 1LF5A 4H8HA 1DEAA 3RIXA 1Q1EA 1C9NA 5THKA 3PQCA 1JDZA 2FDRA 3UPDA 2QMUA 3PJXA 1WHSA 4HFJA 4JHMA 2J5QA 3VNYA 1CQJB 1U9ZA 5H82A 4R8SA 4BGEA 4JD5A 1ZL2A 3S7ZA 3QX8A 4MVXA 3UW6A 1NXPA 3VU9A 1B5TA 1BCRB 4LMPA 4A6DA 2A3CA 4D41A 2AAAA 4K8RB 4PMDA 2VO5A 5E9AA 4H6WA 4O2LA 2E6DA 1K63A 4ND4A 2ODPA 1OF6A 3TZHA 3QPCA 2C79A 4Q4QA 1CZOA 2V2HA 3H65A 2HPZA 1YVUA 2PDNA 5LIYX 4HB7A 1TJ2A 4JYDA 1MUWA 1TVMA 4HN4B 4RXMA 4X0NA 3USES 3AI3A 2MINA 1Q1NA 4QJ5B 4FA3A 2VK4A 2RDUA 3NQFA 1TD1A 4PU0A 1XRMA 3R75A 5TJ9A 5EMUA 1IB6A 1KRXA 5FV4A 3FRIA 4TYNA 2FJUB 4E2WA 3OP1A 3ZJUA 4O4JF 1IL0A 2OZLA 2H54A 1AVTA 4U7DA 4B3BA 2XVKA 1ZU5A 2GPWA 3LJKA 4FO4A 2VYVD 4CN6A 3CNBA 4GVLA 3AEKA 4ZGYA 3ZDFA 4LAOA 5DT5A 5JAPA 1XVTA 1JGTA 2EERA 5BV2P 2F48A 3D02A 2P53A 3WDPP 3NBXX 1JZ8A 2QX8A 5A3HA 4AF6A 2DFAA 1ZC4A 2PWVA 2GS9A 3TSAA 4R2KA 1ICPA 1BKHA 4PTMA 2FR8A 1OHHA 4M0FA 4BFUA 2VNCA 3C8DA 4QD3A 2ST1A 4ZVSA 4IGHA 2SNIE 1GZSA 5T5QA 1PPIA 2J3LA 5AVYA 1TB3A 2PKWA 3DHFA 4M49A 3KBVA 5E1BA 2EFYA 3DMFA 1UAYA 1YCHA 4NZMA 3GE7A 4GOND 4FC7A 5AK4A 3S4TA 3KLKA 1W9VA 4G8TA 3FRHA 2Q2OA 4TWBA 1OUMA 1X1QA 3F03K 4F9DA 4MVJP 1KARA 3H22A 1EHYA 1EP1A 3R9XA 3QVMA 4AYGA 5L45A 1PHQA 3WEZA 2DRIA 5JBQA 1GQIA 1IE3A 3PD0A 1WZAA 3O05A 1JEQA 1ND6A 3QVXA 1E9RA 2F55A 1ZD4A 4YLWA 3GAYA 2OKCA 4XWTA 1DAKA 3NZ1A 4RZ2A 2OLAA 2Q49A 1VPDA 1LDBA 1SCIA 4ER7A 3ELFA 3CZJA 2X76A 4HHEA 3SFKA 2BJHA 4F21A 4D6IA 3T9CA 1E62A 4JGDA 5G1PA 1MC1A 2PSSA 1A9XB 4DBLE 4UBJA 4FF7A 2ZVJA 4UPEA 4YRFA 5EI5A 5IAEA 1BDBA 2C98A 3OTGA 3STHA 3Q3JB 1QB8A 3GDKA 5K0NA 1GEGA 2B5OA 2Q8LA 2NZ8A 3OOHA 1HLGA 2YWGA 3JQEA 3ZU6A 1C30A 1N2JA 2J1LA 3A21A 5L51A 5C0OE 1P5BA 5CZJA 1UBGA 3D4LA 5HNTA 4KR9A 4KEAA 4H7HA 1ZHFA 4CHTA 4PBGA 3ZHVA 2E6FA 9ATCA 4UD6A 3RNLA 3C3MA 3OGRA 1BG4A 3CCCA 4H8VA 3EDMA 1OF8A 3SUTA 4QHRA 2Q3DA 4RLIA 4MW0A 4OI1A 2HRRA 5JYBA 3QTPA 5COQA 1O6CA 1PTAA 4L5YA 4D1IA 1APBA 4GNKB 1FW8A 4XJSA 4LYEA 4OEHA 5MFPA 1V3KA 3NWPA 3E9YA 3KJQA 3SCWA 4MQ6A 1KZ6A 4M22A 1M7OA 3R4IA 3RJ5A 1EE9A 5J2UA 4BFAA 1STOA 2C61A 4UQBA 5CLLA 4GI7A 5JVLA 3L46A 1Y1KE 3MY9A 3UT0A 5IG2A 1E7SA 1D2EA 2FW6A 2ISVA 1IQUA 5DM60 5JD6A 4Q93A 1MC8A 4D81A 4DANA 3A32A 4B33A 4GIYA 1ZC3A 1M6YA 2FSVC 1OXTA 4C1KA 5C52B 4DXHA 1PZ1A 5H3HA 1VFHA 3C41J 3P3BA 4YAIA 4BKNA 4V2IA 1R3RA 1K7XA 2J45A 4B2DA 4AAJA 1QANA 4WKGA 4H17A 3RYFA 3SCVA 3UERA 3P9SA 1V1RB 1YS4A 4GCXA 3DXZA 3CAKA 3JYOA 4L6DA 1A1VA 5CXSA 3HYNA 1RPTA 3E0LA 3UXLA 3UZZA 2CDRA 3RSHA 5GADl 1TE2A 3AV3A 5D9MA 5J04A 3K05A 1ZN9A 3OY7A 2BBFA 1Q7MA 2W2MA 1K3UA 1RD6A 1QGZA 3I30X 1XJWA 1N57A 1A8IA 3L7RA 2GA9A 4LH8A 1DMSA 3LDFA 2G72A 2YS7A 3NBZC 3GDWA 3GZ4A 1VJZA 1YSCA 2AQOA 3PC3A 2FCAA 3BZJA 3O2SB 5M34A 1EK1A 2EBHX 1KTCA 3ETNA 1E2UA 2AZMA 5JAHA 3B8SA 4HTAA 3BJRA 5TT0A 4IIVA 1ZS9A 2RKOA 1CUZA 2NO4A 3MB5A 1TUFA 1HQTA 2H4FA 3OPYB 1SBCA 2ZR9A 3UWEA 1E5QA 4AJJA 1UBEA 4AJLA 4YDSA 3L6CA 4DNPA 1PIWA 4XZWA 1E77A 3LK7A 1G38A 4B35A 1ZJ4A 4XXHA 4YCAA 1JWLA 1XMIA 1K8QA 2XV1A 5BORA 1YJ8A 1ZUAX 1BVYF 4XWOA 4P33A 1M53A 1RP8A 2O8BA 3SXJA 4C3ZA 3KC2A 2BONA 1HGYA 1JAIA 4TKVB 2AC7A 1E4EA 5GV8A 1XRNA 5IM4A 3OJ0A 2I56A 3PXUA 3N39C 5LP1A 3AU6A 4X63A 2G9NA 2A21A 3HEBA 1L8XA 3ICCA 4DLSA 5KNDD 1X6NA 1XIBA 3GSMA 4JU9A 4RIFA 4OHKA 3H3JA 1W96A 3ZN2A 3LVQE 1OTXA 1TB4A 4KLZA 4NZPA 1NUSA 1CE8B 4EGFA 3KVVA 1N2BA 1Y7HA 1ZRSA 3CO0S 3PRYA 4GGPA 2VIIA 3KOMA 4FE3A 4C29A 4L4UA 1EZ1A 4C1NB 4ZO6A 1E60A 3CXUA 5M3BA 4DA0A 4IEIA 2W67A 2HLNA 1KC7A 1U3CA 4YRDA 1KFCA 4X3OA 4B34A 2ZXDA 1UH4A 2GFQA 3H84A 1ZUD1 4LYHA 1VIWA 2W8BA 2AKMA 4ZQBA 2CLIA 3NYDA 2HA3A 1GTHA 3G0UA 4QYWA 1QQBA 5HUPA 9LDTA 1SQ5A 1GAQA 3QKSA 4GRDA 3KU4A 2PUHA 1JQLB 1LPNA 2CLHB 1L4YA 5C1BA 4DIMA 5G41A 4OYYA 5DF0A 4OA5A 3BW4A 4ALLA 1C1YA 1Z3CA 4JB8A 4N6EA 2I3BA 4BVHA 1RHQA 3MUNA 3GEIA 2PMEA 4B6RA 2YQ4A 3JW7A 3M44A 4X6XA 4D0LB 4PMJA 2WZBA 3TRIA 4X9XA 2H8GA 1VCGA 3MMWA 4GO1A 1Y48E 3EGJA 2CLOA 1NSJA 3W2LA 4CQ8A 4MVJD 4UNPA 3CB8A 5AKEA 1ME9A 2QCCA 3U57A 3UK2A 3HN2A 2AMFA 1XLJA 3KHUA 2QXYA 1FBAA 4CN4A 4TXEA 1D8TA 1I2OA 3LDVA 4O25A 2HMCA 2LUOA 3ICPA 1RAAA 4INPA 1W37A 4TM7A 4AZ0A 1LL7A 3MIIA 1OF1A 3B8IA 1DIRA 4L4OA 3V0TA 3PULA 5BRNA 1AKRA 2PUVA 2NQJA 1TWDA 1UR4A 3NDYA 1EC7A 4D4HA 5A8PA 1MABB 5CD9A 3I3OA 3L1KA 1Q65A 4XPIB 1I6MA 2PMDA 1LJ8A 1UMCA 2DTEA 1SB9A 5CT6A 3IV7A 1SR9A 2Z7GA 1A8UA 3EEGA 2PDBA 4EB0A 1DAPA 1R00A 3S5UA 3P0RA 3CL7A 5A06A 5C9ZA 3LLVA 4XASA 2WM0A 5FWYA 1CXEA 1NWSA 4G8BA 5HBRA 4QKQA 2YHUA 4UZEA 1SZDA 4Y8FA 1VYTA 2HTEA 4YI3A 3OQVA 5F9HA 1TV2A 1VE3A 1Z7WA 4HDMB 3BB4A 3UCXA 1MMFB 2WIGA 3NLLA 4YV1A 2WVUA 1KD0A 3AB8A 2WABA 2RHGA 1WZEA 3TZCA 5E8RA 3EBPA 3GC6A 3IHKA 3LT2A 4MDHA 1WUYA 3FI9A 1O6GA 3LHWA 3G77A 1T1EA 4A35A 2RSLA 3WBJA 4DF1A 4RL3A 2PJDA 2OB1A 4JJ4A 2IMRA 2DUXA 4NX5A 4M21A 2D23A 4M8NE 2A57A 4PY2A 4CRWB 3KPWA 1ELSA 1Y3AA 1QOQB 4AMBA 1O54A 1XCLA 2WU8A 3KB1A 3EXFA 1H60A 4ZEWA 5JFTA 4KFOA 1ISYA 3KAOA 4WL0A 3TKAA 3UK0A 1CZLA 3AHZA 4E07A 3FMFA 5H6HA 3TLAA 1E3JA 3W02A 3DGFC 4UCWA 5AM3A 3AEZA 2GD0A 1XX1A 2VX5A 1XJQA 4IRUB 2Z8XA 3WWZA 4B9AA 2CDAA 1US2A 3SZLA 1SO5A 4CKYA 3LLFA 3S8MA 1EEXB 4EGJA 1OFPA 4YBRA 4PULA 3MWEA 1JHRA 3SECA 4TL6A 2E25A 3GR8A 1VB5A 1V47A 2H90A 2QG9A 4PCVA 4GEGA 1BD3A 4QU5A 3NPVA 2VDHA 4O8RA 3G5TA 5IUJC 4U6QA 4TN5A 1HG0A 4ID9A 4IH4A 1WZNA 1UBUS 2VF8A 1XA3A 4FGUA 2WAXA 4WUVA 4TTJA 4KWEA 4RIEA 5CJMA 2FW1A 4LYDA 4JB3A 3QFCA 3I62A 3UUEA 3W6NA 5FI8A 1BFKA 4D45A 1RZMA 4H3SA 4QFDA 4BF5A 1U1FA 2YA1A 3V5NA 1C1XA 4KV9A 1GQKA 5K6TA 4DCVA 4BIIA 3GUHA 5KZDA 3PR2B 3BTNA 5JAOA 3IYLW 2PIAA 3PEWA 3DDNA 1QH0A 1XIFA 1RXWA 4DAOA 3ZE1B 1MNSA 4KO8A 3P32A 1DHRA 4PAWA 3RGGA 5AFDA 4IHQA 5ALTA 1C3OA 4G1EB 1KMMA 2J88A 1EK0A 3L7NA 2M9MA 1RYZA 4P7BA 1I4NA 3EAQA 3JZFA 2V5JA 3ZCVA 2OT1A 1WV0A 4Q7LA 2CLKA 4MS4A 4PG5A 1FLVA 1VKJA 1AO0A 3OPXA 1JYEA 1UYQA 4CG2A 4R71A 1OC4A 1V5IA 2D2IA 1XQ6A 3GJQA 2DFTA 5AFSA 1IDN1 1EQAA 1BYIA 2FLVA 3NJ4A 2X23A 2GK4A 4YY3B 4ENLA 4V1CB 4UUPA 1Z4MA 4Y9UA 1E20A 4CFZA 5HWMA 1YQWA 1XCMA 2YX0A 4K1LA 1ZJ6A 3L40A 3QBVA 3P62A 2GGJA 4E03A 3UJAA 1Z08A 4TMCA 3CPGA 2ZIVB 2IS4A 4BO0A 4PAOA 4Q9IA 1CZHA 1YDNA 1B8VA 2FMNA 2XCQA 2ZJ1A 2ZQZA 4DJFA 3THXB 1Z0SA 1GU1A 3CX4A 4ESEA 1QV9A 3A36A 4RKWA 5EMMA 1QGYA 3MD9A 4D02A 4N7MA 4DYHA 1CJKC 5K05A 4MI1A 4X1KA 3UWPA 5KX5F 3NJ8A 2WNWA 2W6CX 3OEED 1X6LA 2CV0A 1IBCA 4WEQA 2KHZA 4HHPA 4Q7KA 3C1AA 2IHJA 1TRDA 3DFKA 1PQYA 1G4SA 2J4CA 3ZNPA 1K4GA 1QX3A 3G9XA 5A2GA 3PNOA 1JF5A 4G0QA 2Q1TA 2J7FA 3AKDA 4INJA 2ZYIA 3HVJA 3X0DA 1GVSA 3LPLA 3W28A 1OXUA 4WSKA 4BFLA 4JBXA 4DO4A 4F4FA 4O8ZA 3WK9A 2EFJA 4O4HB 4RF5A 1TVCA 1O94D 1Z48A 4FOUA 2QMZA 2W27A 5E7JA 3T3OA 4I8DA 1VSUA 3VC6A 1D7AA 1CNVA 1QRAA 1SVOA 4IH1A 5AM4A 3FPJA 4AY6A 4OH1A 3GY1A 2QENA 3BAIA 2Q6IA 3N07A 5EIXA 3ZWOA 2I7XA 4MV5A 3OZMA 1TZMA 4U2YA 2PD6A 2R1LA 4RKEA 4DJJA 3MBIA 2YJNA 2H3EA 1DJIA 4FHGA 2X05A 2GRUA 2GBIA 2G8NA 1FP4A 1ME8A 3TSZA 1Y8AA 2O05A 4NH0A 721PA 3OQEA 1P7VA 2C0HA 4IMAA 2PZKA 4NHOA 5BOEA 1YFKA 4ZVTA 4J1SA 2JZCA 2AN5A 2VEKA 1RS0A 3DBHA 3HU7A 3W3AA 3CPSA 3O26A 4MV1A 3OG9A 5DLEA 1IUNA 3MUFA 3W23A 3KTAA 3GKAA 1VLVA 4OREX 3HNPA 1H4VB 5LHFA 3FY4A 1OBCA 3JQ9A 3WZ0E 1J2YA 3HQOA 1GGVA 4PLZA 4O4JB 4JY9A 1R6WA 1SN7A 3L84A 5GJCA 3E53A 4NJGA 1NONA 4Z0SA 2RHRA 4QDOA 3KHTA 4P3YA 4DC0A 1IAQA 3TN6A 2FWPA 5HWSA 1DP0A 3B8WA 2ZRCA 3I9LA 2CNNA 1FFXB 2RB4A 4B3CA 2Y1XA 5LA6F 3WFZA 4ADUA 1KFKB 1NDWA 1VTKA 3RYIB 3GLHA 3EZ9A 3VM7A 1WQ4A 2OD7A 4MJ2A 3H12A 1A8QA 4CL0A 1JEQB 1J9ZA 5K99A 2UV8A 1KFLA 3W01A 2DUZA 1H41A 2EG6A 1WMEA 1F4PA 3INPA 3N9RA 3OVPA 2WPNA 2X1LA 4B3IA 3NUGA 2Q0SA 4J0DA 5HCUA 2IOHA 1YMYA 1JDJA 3JQDA 4OKSA 3BQ6A 3MHPA 2CKDA 1TE1A 4BCCA 3N4EA 4ZCIA 3EFOB 4BB6A 4BGIA 4MMYB 1BS2A 1TTPB 1V0LA 5D01A 2P3SA 4C1NA 1V3VA 2O9PA 2XE6A 1JAKA 2CW5A 4FKZA 3O94A 1FP4B 1NMXA 3H16A 3AHCA 1D5WA 8LDHA 5CUQA 1XZKA 3LPPA 3WB2A 5F52A 3DENA 2AS0A 4HLUA 5LD2C 3FSJX 4W5TA 4IXHA 3JQ7A 4E3WA 3OEEA 2ZA2A 2FE4A 3RK0A 3EB3A 2EKZA 1ZUHA 1H6DA 3N2CA 4NJMA 3KAQA 3UJ6A 2GEBA 4AWEA 3EC2A 1X9GA 2UYOA 2TMYA 1ZNYA 3IP1A 3T3PB 2YICA 4PZYA 5I48A 4FDTA 1SKQA 1KIFA 4J2OA 4CVWA 2TRSB 4JI3B 3S2ZA 3DBIA 1PZ3A 4JIEA 3OT5A 1N2XA 4FSXA 3AVUA 1TUIA 3O03A 2O57A 2OGJA 3EVAA 4NWIA 1RIIA 4Q3DA 2YNMA 3RKUA 5HMFA 1WHTA 1BMFA 1A4MA 2DDXA 1M03A 2JAOA 1GA4A 4KFRA 1G8MA 2FOLA 2GVZC 2FKNA 2GK1B 3MTQA 1V6CA 1XYAA 3FPGA 5F1PA 2HCJB 1EJXC 1TPC1 1OQAA 4DCNA 1BHQ1 2PDJA 3SYTA 4G7FA 3ZVNA 4LRTA 1E2BA 5CH8A 3VO2A 3CR8A 1WX0A 2BZ0A 4KE8A 3CS2A 4IICA 3PF9A 1E43A 3SJ3A 1O6BA 4TOIA 3ARWA 4C6NA 5DN9A 5C8YA 3ZWTA 3MJTA 1T2DA 2BKEA 3R3SA 2VH2A 4JGIA 1L5YA 2EJVA 2QIOA 3QGVA 1S4MA 2XGMA 3E2PA 1IDOA 4BBZA 2W6JD 1XV8A 2JD0A 3NO4A 3UCDA 4CUKA 3NO1A 2QRUA 1LPBB 3FDFA 3L7AA 1RYBA 4U2GA 3S2UA 2D3TA 2FPGB 3IVMA 4O52A 4DNQA 3ZW9A 2BE9A 2OSVA 1M7GA 2CE7A 4Z86A 3DFIA 2WM3A 1WNFA 4R81A 2XUHA 4QQRA 2CVQA 2MJLA 1O97C 1RFLA 2P6NA 2YOGA 4NAUA 2HRWA 2VZOA 2XF2A 3GBVA 1EFAA 1QYCA 4DA8A 4O54A 4UAVA 1P73A 5EJMA 5CB6A 2Z2ZA 4BBJA 3S3GA 4UTVA 2WA1A 3SHFA 1XKQA 3LC0A 4N5LA 3OKAA 2YQZA 2VGGA 3S5SA 5DXXA 1HNWB 1EFCA 1F0KA 2C03A 2QRVB 5IDVA 1OPRA 1YA4A 1HL2A 1UANA 4YJGA 5EE9A 4QVIA 3VOTA 4OLHA 2GHQA 3ZJYA 1BAPA 3W2HA 3EFBA 5G40A 1SD2A 4F93B 4MR9B 3WGYA 3CV6A 4NZ4A 4OUIA 4BK9A 2FG6C 1XMOB 1IE7C 2VCAA 1FFDA 1HXHA 1K6IA 4I9UA 1ZI9A 2J77A 3IQEA 3HM7A 3WRWA 1PDVA 3BTUA 2WJZA 1YQGA 3A4IA 2CLPA 1SU4A 3RFXA 2LKCA 1Y8BA 2Q4DA 2XSBA 3WTCA 5FHRA 1XZHA 2YWRA 1Z36A 2X2YA 4A8JB 1US0A 3K16A 4LYJA 4D97A 3FTNA 4S2UA 3ZDQA 3HO8A 2Z6QA 3RIYA 3OLDA 2EEZA 1O03A 4MB5A 4P58A 4LVFA 4JTAA 5C7OO 4TQGA 4DRZA 1AK1A 1BNCA 4LXUA 4GR5A 3MHTA 4D5EA 3Q1LA 3WY9A 1NBOA 3CLSC 4TUYB 1UDXA 1TIKA 3CVWA 4IUYA 5LJIA 2C94A 2JF6A 2XH4A 4AC9A 3BN3A 3H5RA 2A3LA 1SJAA 2VNKA 4OMDA 1OT2A 1K3TA 3GVHA 3WQ5A 1RRPA 4H0CA 2LDXA 1HETA 3EZLA 4I9MA 4C7KA 4JX8A 3VRHA 4U2EA 1U3TA 1ZAYA 2XB4A 3MZNA 4AZ7A 1A9RA 2NZYA 3NNSA 3P9YA 1PJ2A 3PNUA 2V3DA 3NOXA 1UG6A 5I6DA 3L77A 3B9DA 1YD7A 1DTSA 1MXGA 3KQQA 4ZJPA 2QHAA 3EODA 1P5JA 2B2CA 1JFXA 4M8LA 4NG5A 1W85B 2XA1A 4PC7A 4YRBA 4OYLA 3RLFA 1PGJA 2GDZA 1JJBA 2G40A 4WASA 1GNXA 3L2MA 4EPVA 4IEFB 4QNEA 1W47A 5EERA 3N5KA 4FKBA 3URBA 4P35A 3H4TA 1E5JA 5LNRA 1XMVA 5BVHA 2ZS7A 4PANA 3CLHA 4W5QA 1RLOA 1D1TA 1E3ZA 3H55A 4AHOA 1NRWA 1B43A 4RELA 2MCFA 1V7AA 4IXXA 2DT3A 4EG0A 3HBAA 3Q8XB 4XJTA 1DVRA 8MHTA 1DDGA 3WK7A 4I5DA 3S1XA 3PFGA 4JTCA 3RK8A 5IZ4A 3GFBA 4R2LA 3RVBA 3KZSA 4BP1A 1KYQA 4ZKDA 2IPJA 2E5BA 3TC6A 1LC0A 4E1VA 2PLJA 3HQPA 3WYGA 4BMVA 1YJXA 5IK2A 2JIBA 1GNQA 1NR1A 3ODPA 3NWRA 3WL7A 1ODSA 4EHLA 4EKYA 1XS2A 2O4CA 4EF4A 4ZT3A 1GZVA 3K6RA 3WSWA 4ENQA 1HO4A 3LPGA 1N0IA 1Z25A 1TAQA 4GRSA 4LJKA 5MHBA 1CPYA 4QAWA 2YBEA 1FUIA 1RZUA 2CLIB 4BEVA 1E51A 3U5UA 4ZOQI 4F92B 2REBA 4M3PA 3VHLB 3WXBA 3V3KA 2VYOA 3GHUA 4ARVA 3BWYA 3IVUA 1N1EA 3I5AA 1Z6ZA 1O58A 3TOZA 4NH4A 3SHVA 1KLYA 4DLKA 3F71A 4CCAA 1CT9A 3THAA 1ZRMA 2PGIA 3T1HB 5E4YA 1S7GA 3DV0B 2I2DA 2AGKA 3VU2A 2FYTA 3SHQA 1PR3A 4GX1A 3NALA 2O9RA 3K4DA 5IAAA 4RHUA 3WH6A 4GJJA 1RJDA 4REQA 1HKUA 2V6FA 2SKDA 3IJDA 3VR3D 2VDOB 4HT3A 2DEUA 1D1SA 4J29A 4EE9A 2ZADA 3E0VA 2WYWA 1OI3A 2M6LA 4QUDA 3QC0A 1W88A 4URHA 2EV9A 1QOPA 1OC6A 5HW0A 1CRQA 3TN7A 3L8HA 3KSBC 3GZ3A 4XVDA 4QVGA 1WE5A 2CBGA 2XMZA 2ASVA 3K8LA 3TM4A 2PGEA 3V4SA 1JBEA 3HPAA 4LNAA 8ATCA 2ZIWB 3ZLUA 3RRMA 1W8SA 3MFYA 3QUSA 1ME7A 2W79A 1I6WA 3DFFA 2X1UA 3HY6A 6TIMA 2I4TA 4LWPA 5HULA 3CURA 3QEOA 4FWBA 2ET6A 2DR2A 1LRJA 1G3MA 2W22A 2WWRA 5EZQA 3IK2A 3UWQA 4PX5A 2JZOA 5F4ZA 3Q1KA 1MG5A 1DLIA 4CNTA 2JGDB 3W86A 4JBIA 3SLKA 4G0WA 1EJ2A 4L75A 4DYVA 3EPOA 4DJEA 1A72A 1E2JA 2HBQA 4QJIA 4C7OB 1GPDG 3ARXA 3UA3A 1AFSA 3QTBA 1RE0A 3KJHA 3DFOA 5BUSA 3AQIA 1SG6A 4I6JA 2XGBA 3BO9A 4MQMA 3VKKA 3EEZA 1CEYA 2FZEA 2WJPA 2CNDA 4QDPA 2JI6A 3W2NA 2HA6A 3IIEA 3EUFA 1F05A 3G3DA 2OKOA 3L4UA 3OLXA 1GM5A 5KI6A 3HU5A 1G8PA 4QBGB 4XLTA 3GA7