5EMLA

Crystal structure of prmt5:mep50 with compound 10 and sam
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 203
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emlA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emlA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emlA02
1DE5A 1V39A 1XYMA 1IXKA 2BM8A 2NXCA 4FP9A 3O7WA 1XLCA 2Q41A 1AV6A 5LSAA 5DRTA 4RTKA 3ME5A 5EPEA 2HTEA 2YR0A 3A25A 3UZUA 3L8DA 5XIMA 4BP3A 3O31A 3NJRA 3EVZA 3P2IA 4R8RA 3A4TA 1XLJA 2P3OA 4DCGA 1SVUA 2VDUE 2NQJA 4QDPA 2ZTHA 4HGYA 5LQRA 5HIIA 4HGZA 4HNOA 2QUNA 4Y30A 2KW5A 1HNNA 2O06A 4PFHA 4BLWA 1CLKA 5E9QA 4PYMA 5K01A 4GUAA 4E31A 4XSMA 3GRYA 4GC5A 1U2ZA 2CMHA 3BUSA 2HNKA 3KR1A 4F84A 2G72A 3KCJA 1PRYA 4H0NA 3M0XA 4YTUA 1RI4A 1FBNA 5EIFA 3EMBA 4CKCA 3XIMA 1SG9A 2ZDSA 1NBHA 3R24A 3UVAA 4A6EA 3B3FA 5E2BA 5EHGA 3SR4A 5K0JA 3HA7A 3CJTA 2PXCA 4YTTA 1JG3A 3LX6A 3IV6A 1XP3A 5HZMA 2PX5A 3GO4A 2PX2A 2ZZKA 5H02A 1I60A 2YXLA 5E8JA 2AOUA 5E1OA 4PONA 4YUWA 2GA9A 3O4FA 1ZGJA 1DIDA 3P97A 1NW8A 1KXZA 1VQ1A 3KQMA 2E5WA 4QPPA 1M6EX 2ZULA 2Y1XA 2ESRA 3AXTA 3OFJA 1AF7A 5DX1A 3GIWA 2IIPA 1XLIA 2CMGA 3CKKA 4GEKA 3FUXA 2UYCA 3P9KA 1KPHA 3REOA 2IH4A 4AZTA 3OFKA 4FSXA 4YMGA 5EKXA 5J8LA 3T0IA 2IDJA 1ZQ9A 3PTAA 4MTLA 1G55A 3FTFA 2WK1A 4E70A 3KCOA 1BKYA 2NP6A 3HCAA 3NDJA 3IHTA 2ZIGA 1UFKA 2X7WA 2ZVRA 3R6TA 5E8RA 5E9WA 1WS6A 3QXBA 4A8RA 4YUYA 1R8YA 5D1HA 3C0LA 1YX1A 1NV8A 2GPYA 3KBWA 3G88A 4E2YA 1JTFA 4QEHA 4QPNA 3DX5A 1F38A 2JG3A 1XTPA 4OBWA 4XUDA 1XICA 4QE5A 4RVFA 4XKMA 3SX0A 3I58A 3HVIA 1S5NA 2OB2A 4OVXA 2VZ9A 3HVJA 4ER0A 3OE5A 4QDWA 5KYGA 2NQ9A 4EK9A 4PGHA 1L1EA 2JJQA 4HH4A 5EVJA 4P7KA 3UFBA 4FS8A 3M0YA 1X1AA 2G1PA 3PFGA 1BHJA 5LQAA 4PCLA 3DUWA 2OXTA 3UBTA 3DMFA 3EVEA 4C4AA 3JU2A 1UWVA 3NVMB 4ZTBA 4XCXA 1TZ9A 2GYIA 5FWAA 5K0CA 2Q02A 3UJ6A 3UJ8A 1TPYA 3HTXA 1H1DA 2PLWA 4LNCA 5XIAA 2I56A 3NWEA 3QV2A 4OBXA 4R6XA 1GW9A 3H2BA 3FPFA 4C07A 3M0VA 3OU7A 2I6GA 1TW2A 2ZW9A 1XLDA 3KR2A 5CVEA 2X7VA 5LQNA 3ITTA 5AVHA 3BWCA 3FVMA 3KBVA 3GNXA 3UJ9A 1XYAA 2I57A 2AOUB 4U7TB 4V0QA 4LG1A 4ZB2A 4P7GA 1YFLA 2HWKA 4AZWA 3ITXA 4QE1A 1WXXA 4BY9E 1WZNA 3FTEA 3FPJA 3KKZA 5CD1A 3GCZA 2C7OA 2I62A 2ZCJA 4XSLA 1N7JA 4Y2HA 4XUCA 5EZSA 1XIBA 4GBED 3M6WA 3HCBA 3HEMA 4E3VA 4PYKA 4GOOD 3KQTA 4DM3A 2PWYA 2VDVE 3KPUA 1YZHA 3HVHA 5DXAA 4DF3A 2V74B 2PY6A 3G2OA 4ISCA 5BXYA 1VBFA 3G89A 3ELYA 5EKUA 2OZVA 4Q7IA 1R18A 3DP7A 4DZRA 3R0QA 3EGIA 4PIMA 2ONZA 1ZGAA 3OPNA 2AR0A 1A0EA 2PBFA 1MHTA 3LBYA 2H11A 3E05A 4POOA 1O9GA 4GF5A 5DM4A 2BR4A 4CWAA 1F3LA 3B3JA 2AN4A 5GIPE 2QRVB 4Z2YA 4MWZA 3OE4A 5FTWA 4HC4A 1Q0TA 4M36A 1XDZA 5AVNA 4PYLA 2GVEA 4X61A 4RTRA 5LQJA 5GINE 3E8SA 3QYSA 1NW5A 5CVJA 3IUHA 3TVAA 3P9IA 1Z3CA 4IWNA 1JSZA 3ITYA 3WSTA 1A0DA 4O29A 4RVDA 3EVFA 5H6HA 4K3ZA 3BWMA 4YUZA 2K4MA 1IM8A 1PJZA 1XIIA 5ICCA 4YUVA 4F86A 2YXDA 2PKWA 2G70A 2O05A 9MHTA 1I9GA 3KR9A 4F85A 1R6AA 2CWWA 4YMHA 1XLLA 4C03A 3I53A 4GLEA 5E9JA 4C06A 4C08A 2ZIFA 1XIJA 2R6ZA 5T67A 4CXMA 3RIEA 2NXJA 4FR0A 4YV2A 1RI3A 6XIAA 1KYZA 3NWBA 3P14A 5K05A 2YX1A 1X1CA 3EPPA 5HIJA 2C7RA 4AX8A 1I6NA 5MHTA 4PYJA 2UYOA 3C0QA 3V8VA 1TW3A 3LPMA 4PYQA 4V0RA 3KBNA 4OA8A 5K0BA 2PXAA 9XIMA 5EZQA 3HP7A 3OCJA 4RVGA 4ER6A 1XYLA 2N47A 1MJFA 1QUMA 3TRKA 1XCJA 3BGIA 1QYRA 2FRXA 4IKPA 5DTMA 3EVAA 2ZFUA 3EMDA 5G02A 5F2NA 3LSTA 3EGVA 3BGDA 1QAOA 1NT2A 2QUMA 5FHQA 1XJ5A 2EJUA 1VE3A 3CQHA 2UYQA 2HMYB 2HCVA 2ONYA 5K8VA 3DOUA 1KPIA 2EG5A 1KHHA 3F4KA 5LR6A 4C05A 5C1IA 2ZWAA 1JSXA 5K0NA 3U3HA 2P41A 2EFJA 4OA5A 4FSDA 1K77A 3PLAE 4ZBCA 9XIAA 3TKYA 1RI5A 2Z6UA 3BDKA 3KU1A 2NQHA 2ZIEA 1BXCA 3FRHA 3DH0A 3LMZA 2F8LA 3DXZA 1XLBA 4EQZA 1XLMA 2WA2A 2VDWA 3FPGA 3GJYA 5DSTA 3EVBA 3U81A 1VPTA 2P3QA 4KDRA 2QW5A 3EGEA 4US6A 3HCEA 5U4XA 3BWYA 2J6VA 3HA3A 2P40A 2ADMA 3VC1A 3C0SA 3ELWA 1N2XA 5K09A 3FUUA 1P91A 3DMHA 3LHDA 3DTNA 3ITVA 1D8WA 3PX3A 2Z6AA 4NECA 3ER8A 2XBMA 1QANA 2PT9A 1JR4A 3KTCA 3CGGA 2AOTB 1T43A 2G0WA 3TFWA 3SMQA 3ELUA 3GRZA 5BW5A 1INLA 3B89A 3QC0A 3KPWA 3LGAA 4YUXA 3VYWA 3N4AA 3LBFA 2YQZA 4AZVA 3ID6C 3JWIA 1O9HA 4GJIA 4RTLA 2AOVA 5C0OE 1I1NA 4LWOA 1XVAA 2ZBRA 1XCLA 1RI1A 1DIEA 3BXOA 5JUWA 1KIAA 5F2OA 1ZHFA 1FJXA 2P7IA 5DTRA 2ZLBA 2DULA 4B17A 5DTQA 5KVAA 4RTSA 2NYUA 2C7PA 2OO3A 5B7YA 1NE2A 4P58A 3Q7EA 4M38A 2JHAA 1XIFA 2QRVA 4QTTB 2LD4A 4L7VA 2EJTA 4DMGA 3C3PA 3T7SA 3EEYA 2OU4A 1AQJA 3FUWA 3UU0A 3KQOA 4HSGA 3RW9A 3UA4A 3KQQA 3GNLA 2NXNA 5DX0A 2XISA 3A26A 3DLIA 4DUOA 4DA4A 4HHLA 1SQFA 3CJQA 3M0HA 5CCXA 3THSA 5CCBA 5CM2Z 4RTMA 1NBIA 3OZSA 1XLKA 3M6VA 3ER9A 3MERA 2GLKA 5IKMA 4KRGA 4QTUB 5FA5A 4FT4A 1D2HA 3BT7A 3G2PA 4R8SA 5ICEA 1BXBA 1R74A 2QY6A 3CWHA 3C6MA 3SSOA 1DUSA 2O07A 3MB5A 2BM9A 3BWWA 3SGLA 5CVUA 1S5MA 1XDUA 1VP9A 3OZTA 4HGXA 1KYWA 3XINA 4QE4A 4E30A 2PX4A 2XIMA 4QDKA 3M4XA 1KP9A 2UYHA 4M37A 5EIWA 3KQPA 3GWZA 2JH8A 5E2AA 2OY0A 5D1NA 4EAYA 3UXIA 3I64A 1RJDA 1NV9A 2CKDA 4RTOA 4A8LA 3OU2A 3B5IA 5GWXA 1A0CA 2IGTA 3CJRA 1OADA 2P1DA 2NP7A 2IP2A 5B1SA 4GOND 5FULA 4K6MA 4XISA 3V97A 1O54A 4ATNA 2GB4A 1G60A 4KWCA 3PVCA 3FPEA 3DR5A 4HTFB 1XYCA 2PJDA 3DBNA 3VNLA 2PGXA 4PNEA 3TOSA 3D2LA 4IV8A 4QQKA 3NMUF 3AAMA 3KR0A 1JG1A 3LL7A 2BZGA 5EC8A 2QULA 3KWSA 1IY9A 2HR1A 3VNJA 4GJJA 4J4KA 5DM0A 5KQSA 3ERCA 2PSSA 5CUQA 1L3IA 3KPYA 3AJDA 2I7CA 3C3YA 2IH2A 5HIKA 1B42A 2AN3A 4HRAA 5XINA 1XLHA 5EMMA 5H1WA 3FTCA 2YVLA 3P9CA 5HILA 4RWZA 1RI2A 2B2CA 3DLCA 1VLMA 3UJBA 2OB1A 2DPMA 4ZB0A 2AN5A 4X41A 1ZG3A 1JQDA 4XUEA 1ZKDA 2FPOA 3QOXA 1Y8CA 4E32A 1JQ3A 2PV0A 3X0DA 4M7RA 2G71A 3OBEA 1VIDA 3UA3A 5EEGA 2QYOA 3LDGA 2BH2A 1P1CA 2P35A 2VP3A 3HCCA 3S68A 1WY7A 4IV0A 1R00A 5B80A 1WG8A 4EKIA 2XINA 1G38A 3MAGA 3M0LA 4CKBA 1EQAA 2XVMA 4EVIA 3GDHA 2AOTA 4W4QA 3DXXA 1YZ3A 2ZVJA 4X63A 4MIKA 3HCFA 5EHIA 2AVDA 3GRVA 1JTEA 3Q87B 2JH9A 1DXIA 5B7ZA 6XIMA 5HIMA 4OX9Y 2GH1A 3AYTA 3IEIA 1XIMA 3OZRA 2QM3A 3GRUA 4A6DA 3ITLA 1OR8A 5ICGA 5LQUA 3A7EA 3SSMA 4RTNA 1DCTA 5DX8A 1EIZA 3I9FA 3T7TA 2FK7A 4OQEA 4BP1A 2PXXA 3TQSA 2ZZNA 2Z6QA 1HMYA 4RYLA 1WXWA 2IPXA 2YTZA 5K0LA 3CBGA 5DT2A 3L23A 1FP1D 3SXJA 2B25A 3PT9A 3T7RA 1JG2A 4R6WA 2XYQA 5DXJA 2AS0A 4UOEA 1XLAA 2BR5A 4RVHA 3E7PA 4PCAA 3RODA 4CTKA 4WXHA 1EJ0A 1ORIA 3P2KA 1RJGA 5BP7A 3FZGA 5EG5A 1D2CA 1X1BA 4DCMA 3AWIA 2R3SA 3M6XA 5DRYA 3K6RA 1JQEA 4RTPA 2PX8A 4LWPA 4PGLA 2P7HA 3HVKA 1QAQA 3EVGA 3FUTA 3ELDA 1L3CA 3PFHA 3KBMA 1YB2A 2PVCA 1BOOA 3FUVA 5E1BA 3M6UA 4EMSA 5K0GA 3CQIA 5GP1A 5FA8A 1X19A 2IFTA 2HV9A 3R9XB 4K1GA 4XIMA 2XYRA 5DM2A 2HK0A 3KBSA 3ITOA 4AZSA 2FK8A 4E2ZA 4EKGA 5DLYA 2IDKA 2P3LA 2I9KA 4X1OA 3LECA 1KPGA 1P1BA 3M33A 3SVZA 3BANA 1BC5A 2FHPA 4P7JA 5FUBA 5FWDA 5CIYA 1SUIA 3PS9A 3TM5A 3BKWA 3IUDA 4KVZA 5ERGB 3GXOA 3TLJA 3FPHA 3C6KA 3G5TA 5EQJB 2JHPA 1L3BA 3CNYA 3HM2A 4KW2A 1XIGA 1NW3A 3NTVA 2IBTA 2Y1WA 1N7IA 3G2MA 4HG2A 4HTFA 5CVVA 3B3GA 3ORHA 10MHA 4RTQA 3AY0A 1KR5A 3MCTA 2O57A 2H1RA 3TM4A 3BZBA 3K0BA 4ER7A 2B9EA 2XYVA 1YUBA 3PB3A 2B78A 1XLEA 2P8JA 3UJDA 5FCDA 3PX2A 4RSRA 2WA1A 3XISA 4KIFA 2BR3A 4G56A 3E23A 3TPZA 3TC3A 1FPQA 3IYLW 5FQNA 3B7PA 5K0EA 5FHRA 1AQIA 3HCDA 4PYIA 4E2XA 3M0MA 2AVNA 3GGDA 3EVDA 4YTSA 4MHTA 1XXLA 5BW4A 5FADA 7XIMA 2ZBPA 4FGZA 3OU6A 3EVCA 3QOWA 3C0KA 3U0HA 4FT2A 5E1DA 4MQ4A 4LECA 2C7QA 3M70A 3NGFA 1MNZA 2O0LA 3BWBA 8XIMA 1XYBA 1R8XA 3LKZA 4DQ0A 3ANXA 8MHTA 3NDIA 1MUWA 5C9ZA 1QT1A 4GOMD 3VNMA 3UJ7A 3R3HA 5T64A 4HHMA 5EEHA 4ER3A 5ICFA 3THRA 1DE6A 3LDFA 4KIGA 4U7PB 3JWHA 5EOVA 3JWGA 5JR3A 2PWPA 4BLUA 2UZ4A 3UJAA 3MHTA 2OKCA 3WQOA 4PYOA 3G7UA 4DVOA 5EMLA 4GC9A 4XIAA 4YTRA 2HK1A 3CQJA 1XINA 4E33A 4C04A 3TKAA 4P7FA 4QQNA 3FRIA 3KCLA 4PIPA 3KQVA 2OPBA 1EAMA 3KPJA 3G8AA 1XIHA 4RTJA 3CC8A 5DM1A 3QZAA 3EEOA 1D2GA 3HA5A 5GM1A 2JHCA 1VP3A 2AZTA 4R05A 5K03A 3DMGA 1X1DA 3MTIA 4OQDA 2PT6A 5LQCA 4CTJA 2A14A 3G2QA 3CCFA 5K0FA 3FTDA 4AUKA 2YUIA 1YFJA 1XISA 4ER5A 3BZGA 3KBJA 5T6BA 4EACA 5EGSA 2NXEA 3FYCA 3AALA 5E1MA 3TR6A 1NW6A 1EG2A 3I5UA 2OYRA 1SKMA 2IH5A 7MHTA 4WVLA 4KW7A 5I7GA 3P6LA 2FCAA 3LKDA 2ERCA 3UJCA 4X60A 3IUIA 3P8ZA 2EX4A 5F2KA 3LDUA 3MCZA 3MQ2A 2XVAA 5M5BA 2B3TA 5TNVA 2ZBQA 1NW7A 4YV0A 1XIEA 4CKEA 1P39A 4PINA 3SSNA 3VSEA 1XLGA 4QDJA 1G8SA 5KS2A 1FP2A 1XDSA 3KQSA 1O1HA 1Q0SA 5GOZA 5GM2A 3AXSA 1RJFA 4RX1A 4GOLD 2ZSUA 3LCUA 1SUSA 2QE6A 3KHKA 4RV9A 5HEKA 3GRRA 4YV1A 2YXEA 3KQYA 5DWQA 3BKXA 1RJEA 3JWJA 4GQBA 5IH3A 2CL5A 3UWPA 5KQRA 3FYDA 3SM3A 3G8BA 4KDCA 3MTEA 1JG4A 3DULA 3LCCA 5GIOE 1XIDA 4A8IA 8XIAA 1I4WA 3A27A 1L9KA 5DPMA 3AYVA 5P8WA 5HOQA 5HFJA 1ORHA 4JXJA 3NVKI 1VL5A 2V7EA 4QEEA 3DXYA 3CQKA 3NW9A 1EJ6A 1SQGA 4FZVA 2ORED 3GU3A 3VNIA 3BGVA 2OBFA 3TMAA 4YTQA 1G8AA 5LQKA 3P71T 4BLVA 5EMJA 3P9NA 3HNRA 5FQOA 2GS9A 2IBSA 1M6YA 2FYTA 3LCVB 1YF3A 2GAFA 4QVGA 3VC2A 2AOXA 3KPVA 1DL5A 3VNKA 2GLUA 1QTWA 3BZJA 4A8NA 4PGGA 2H00A 2VS1A 4QVKA 3VYLA 5CVDA 1QZZA 1G6Q1 1M0EA 1QAMA 1XLFA 3KQWA 2AOWA 1NKVA 2G8NA 2ZZMA 5DSXA 1UIRA 2GUBA 3CVOA 4ZB5A 2ZWVA 4PWYA 4PYNA 4E2WA 2G4JA 3G5LA 4DKJA 3P2EA 3A7DA 3MGGA 2NNWB 5EMKA
chains in the Genus database with same CATH superfamily
3OVRA 4XUGA 1ILWA 3LBIA 4TROA 5BSHA 3O7WA 3PQFA 1I94B 4XAGA 4PNPA 5FF2A 2QY9A 1A5NC 4LVAA 2XITA 2RGLA 2GSWA 3V9AA 3ORWA 2FPWA 3N5CA 3TR5A 4TV8B 5DJ5A 1GLVA 2X7JA 4HGYA 4YGYA 3DC8A 3HFGA 1QIGA 1IVYA 2O06A 2VFIA 1TT5A 1I3LA 1G8KA 2GVLA 1VYVA 1L5NA 1XPRA 3CPUA 1UKSA 3O6YX 1J18A 2FMNA 1KR2A 2ZXAA 4NZ9A 3KU4A 3DWFA 3LC0A 4HAYA 3WMEA 5IBRA 3TSOA 5GJMA 5H16A 2V7VA 3VIJA 1IFXA 4TM7A 4Q4AB 2XI4A 4D3YA 3DG6A 4J0FA 1C30A 2REQA 2ZBGA 4ISBA 2Y0EA 4HWRA 2BGQA 3KAKA 4LXIA 3PUEA 3HB7A 5KX5F 1X87A 1YZGA 2NVUA 3RHGA 3TW0A 4K36A 1NY5A 2Z8ZA 5D2VA 3XIMA 4ABTA 4O1DA 1K3UB 3SR4A 2YYSA 1BG6A 2VWQA 3HA7A 5CX1A 3B1ZA 2G77B 1SIBE 3CSUA 3FB1A 2F3TA 4TTUA 1QHHB 4N54A 2BELA 3RM4A 4JTDA 4BWFB 3WQSB 1ZXXA 3INYA 3L65A 1ZITA 4UR9A 3RIGA 4QGHA 1U99A 3GO4A 4Y9OA 3NBFA 4Q32A 4B5XA 4FI3C 5I7RA 3A9VA 1YCHA 3CKMA 4R9UC 4LQ4A 2VD8A 3PB0A 1T5IA 1NBOA 1RAKA 3RWBA 3GFFA 3BURA 5KJEA 2FEKA 4IIHA 1E20A 2DH6A 2Z1NA 4FX5A 5SV2A 4OUKX 1V45E 2CLEB 5CLGA 3L4TA 4PANA 5PNTA 4DN1A 3PGA1 4QQ3A 2AIRA 3N4FA 4LN1A 2CMGA 4BF5A 3MJFA 3GLIE 5BN3A 4UR7A 2QQGA 5BSRA 3FF4A 4EZIA 4ARIA 3AFOA 3DDOA 4AZTA 4KITB 1ST2A 3FK4A 3GBVA 1BYUA 3UXHA 2GCOA 3TEMA 2NVCA 2VK4A 2XUAA 1CJUC 5GPRA 2Y4NA 2CXQA 4MR8A 4FOOA 1NDWA 2QF8A 3N6QA 3H3JA 1DIOB 1EK5A 2B4TO 4PB3A 2C5GA 3QV7A 1RM0A 2PRIA 2RGUA 3F74A 3VXKA 4K7JA 3LCRA 1WDPA 3F7NA 2ZVRA 1YS6A 4V0OA 3V5OA 3SK0A 4OKDA 2ZSHA 4YUYA 5KX5A 3U62A 2D0GA 3PHCA 5B2EA 1Z0DA 3D7KA 1N1GA 3ELBA 3FZYA 3R7NA 4P98A 2YOGA 4P54A 1XCGB 4MKHA 1RAEA 4GI9A 3LPFA 4HDQB 4R69A 2ISQA 3ZNOA 1S6YA 4OBWA 2E6UX 2EIXA 2I1OA 1Y3FE 1WQ3A 5BXTA 5CKSA 1TQ8A 1CR0A 1OILA 4DZAA 1CJCA 2GTPA 2HLDD 4EPVA 4OVXA 2JK0A 1TT5B 1ABFA 4X9SA 3TRHA 4QDWA 4O13A 3FG9A 3GMSA 1X80A 1UFOA 4MWBA 1QDLB 1CRLA 2OM6A 3M3DA 2B61A 4IXXA 2J9ZA 3FA2A 4P84A 4W1RA 1C30B 5EFOA 4MI3A 2REQB 3QPEA 1FXWF 1VHCA 1UH4A 1TZ9A 4LZPA 2NVUB 1UPXA 3BK0A 3W6YA 4DB7A 2W6MA 3GO2A 1EHYA 4JC8A 3K9GA 2AR7A 5IXSA 2O2SA 1JH9A 5CX1B 3P26A 3LBCA 3EEQA 2AQOA 3POCA 3TE6A 4EE9A 5B12A 1YDFA 1UK6A 5E0KA 1YJXA 3MUAA 5HCNA 4GYFA 4C4PA 1N3LA 1JFTA 3DLPX 4EA8A 3QWFA 4E14A 3WNNA 5CG2A 2COUA 1ZNNA 3IAFA 5EVCA 1VLQA 4FUTA 1W1VA 2W2XA 1LWJA 4N42A 1FDOA 3NYWA 1IUKA 3T1TA 2J9XA 3K70C 1RR6A 4JXXA 4Y7DA 1YS2X 2A0NA 3BOSA 2WJHA 4MA0A 1TQDA 3R0XA 1KK2A 2GVJA 4YFYA 1M1NA 3PPIA 4QPDA 4QRNA 2F9FA 4Y0VA 2AN9A 2DBZA 1IWAA 2GM9A 3HEMA 3DBPA 2A6LA 4E3VA 1FWFC 3PTQA 4BQRA 3WWOA 4L16A 1IPHA 1U31A 2BEKA 1JUBA 4AXXA 3NO5A 4NASA 3HB1A 2OYCA 2GCOB 2VIIA 1CY0A 1V03A 5L40A 1U8EA 4YGXB 4MR8B 1FFQA 3FOBA 3MN1A 3PNSA 4XQCA 4C22A 1JQJC 1J09A 5ILOA 1P2VA 2B0MA 3VM6A 1E4NA 4RZ4A 2VQDA 1QPBA 2SFPA 5T3UA 4XAPA 4IHJA 1Q3KA 4JI6B 3UW1A 4MJXA 5FKJA 3DFKA 2VPIA 1W1A1 4A0RA 4J3XA 3M5XA 1AJEA 2E3ZA 1J0IA 4J3VA 1QGAA 1FXWA 4F5YA 1XZFA 3D4BA 5HJLA 5DM4A 2Z1SA 2GAAA 4N3NA 3ZBTA 5IVPA 4O33A 2VR1A 1F3LA 4XDGA 4XWGA 4LBWA 3IP5A 2QRVB 3BGSA 5FESA 1CSEE 4WHMA 3L2LA 4XDZA 2ATMA 1I6LA 5FB3A 3QHQA 2AN1A 5AVNA 2GVEA 2ODAA 4JT2A 4FNPA 2IXVA 3C3KA 4O1IA 1O7JA 1L6SA 4D98A 4K6KA 5CGZA 2QUZA 1BIFA 3CEUA 4NRDA 4AMUA 3UP8A 5A4JA 4IWNA 4ZREA 3R7FA 3DFTA 1ZHHA 1JJAA 4YN5A 4F71A 3AUFA 5IT0A 4K3ZA 2WG0A 1L6IA 4MYRA 3DE6X 3RQSA 1COZA 2NUTA 2VEKA 3PQ5A 4ZA0A 1SIUA 3V55A 1IUNA 1SZDA 2NSHA 1J8DA 2J9ZB 3RRYA 4F86A 2WB4A 4J76A 2R7LA 4OKSA 5A3VA 2NLOA 4HZ8A 4OJYA 4G8BA 4DO5A 1QPGA 2YUTA 1A95A 1FXSA 1KVTA 3A1DA 1XVTA 2A58A 1R4MB 3NYQA 4JJ7A 4KP7A 5T67A 4CXMA 5CXQA 3D8UA 5LMZA 4UTUA 2XJ9A 3HP4A 3GH1A 3B53X 5E2IA 3MYOA 2N75A 4L3OA 5ALXA 2QLFA 1SSGA 1G94A 3LUTA 4QEDA 2FX5A 4H8NA 4EIWA 4CM3A 3OE7A 3KJFA 3GVVA 3SU8A 4M9RA 3NL6A 2VC2B 1BJRE 1GFWA 2ODQA 2Q1TA 2COEA 1QKJA 2HSWA 1Z47A 1MSSA 5TQVA 3EXFB 4LYFA 3IA2A 3LA4A 4D6XA 3T4WA 1JHUA 4RF4A 2QR6A 2BGIA 5KTRA 1M1NB 1QI2A 2QL5A 1QYRA 1WF6A 4IKPA 1U7OA 2Z5FA 2I2BA 3EVAA 3ZJ8A 3FMFA 1VKHA 5A9SA 3FSGA 2UV8A 3LC1O 3ILHA 2E89A 5G02A 1ZJYA 1LDMA 1E2MA 3I62A 1VE3A 3R2JA 1B90A 5E6RA 5FD8A 3BAWA 3SC2B 2UWFA 5AJTA 5IZCA 1Y9DA 3MGAA 4IHJB 1TF7A 1GTJ1 2IGBA 2Z58A 3EB4A 4NXKA 2R8XA 3MPOA 4IJWA 2QIWA 4TPKA 1IIHA 1CFJA 2V1XA 3COJA 4KFSA 1RI5A 4RF5A 4MGHA 2A67A 1DP4A 1F2UB 1UQRA 1CUSA 1V6XA 3LRMA 1ONEA 4E5VA 1BYBA 1UR2A 3DH0A 2F8LA 2PDFA 3EGDB 1XLMA 1UD4A 3SUWA 3KQHA 2F1OA 3PUIA 1KHTA 3WDPP 2O0KA 4Q12A 5HJYA 2OTCA 2N1MA 2QMZA 2V0CA 5BN5A 2Y66A 4M0FA 1PD0A 3D6JA 3A6OA 5B3AA 1G4PA 1U8CB 3ABZA 3T4EA 2OEMA 3H9BA 4G1NA 1LF1A 5ALSA 3E38A 5JTUA 1UWIA 4Q48A 1SVLA 4I9UA 3JAMA 1K5GA 2Q3BA 3NQCA 1X42A 2GZ3A 1E62A 4JZYA 2XBMA 2WUFA 2WU0A 3KFVA 1LL7A 3ZV4A 3AB8A 821PA 5C32A 1OF6A 2P5UA 2HGSA 3GRZA 3WNZA 1BSVA 1GQ2A 4DSAA 1TMGE 1QYVA 1V9LA 2CJYA 4PTZA 1O08A 2WD9A 1G8FA 1D5CA 2W6JA 5MGBA 3B6MA 4MZ8A 3CO4A 1H0GA 1VE9A 3JWIA 4C6QA 1WZ2A 3W88A 3WDSA 2BTMA 2Y8EA 3O84A 4XB1A 3WGVA 3CLSD 2VP0A 3ZDYB 1GJUA 1LKZA 1XRSB 4PGAA 1O6FA 3GC6A 3WO8A 4QTZA 1U9YA 4NC9A 1C91A 2Y7EA 3QPYA 3S5JA 2CFTA 1ZSVA 1V47A 1HLPA 5C7IO 4B17A 3F71A 4DQXA 3I9MA 2FDRA 2ZDQA 2C7PA 4OQXA 1NE2A 1GDTA 2OORC 2A4AA 2XECA 1BS1A 3FPCA 3QHMA 3NWOA 4E5SA 4EOUA 4LS1A 4BJ6A 1UQUA 3QGMA 1P29A 4L95C 4FDUA 1EFUA 2EKZA 4RZQA 5JCJD 2WAOA 2IPGA 2J7EA 3KM8A 1T29A 2NX2A 1Z5GA 3ACBA 4RY2A 1UCWA 1KQGA 1O2DA 1W29A 5HWJA 1PWYE 1G291 2PGFA 1KBJA 1LZLA 3O07A 5ALPA 3VSDA 4R7TA 4WTOA 4YDRA 4M1SA 3NB0A 4TN5A 3PNZA 1IG3A 5FAGA 4IM7A 4MDEA 1GOMA 1SQFA 4LANA 1WMFA 2ZXFA 4DABA 3M0HA 2XFRA 3T0DA 3L0KA 4CV0A 4B34A 2XZ9A 3FYUA 4DJDD 3SHVA 3LBMA 3PZIA 2R6OA 4EPEC 3WSUA 3GT0A 1ZUHA 5BR4A 1WV1A 1D2HA 4JP5A 1J06A 5AW3A 3QW3A 5K0TA 4AUNA 1C3OA 3CWHA 4LWQA 4BQ3A 4IHKA 1OW3B 1XYGA 1DDOA 3I4KA 2QVXX 5DEOA 4BV8A 2I03A 2BM9A 4R4JA 1DPFA 2ZIWB 2QRHA 3SFWA 3MYYA 1JNDA 5IJAA 1GG0A 3D8TA 1S5MA 3UGJA 4MW5A 2VZSA 1XLTA 3IPLA 4PZUA 3FR7A 1QR6A 3OCZA 4BE9A 1PQYA 2FZDA 3REQA 2OZEA 1QFSA 2UYHA 5FBZA 4HRYA 3UMVA 1KI4A 1GYQA 3NOYA 4BZPA 4OHBA 3I64A 2QS8A 4C2UA 3EZGA 1FW8A 4ZYYA 2GO7A 3ONWA 1ZVMA 4NCIA 5D37A 2NP7A 1BGAA 3PC6A 3G9XA 1GJPA 1VYHA 1DELA 3L1IA 4B2IA 5TGDA 3VKFA 3DV9A 4KO1S 4KEMA 4DJEA 5L53A 4WERA 1CR2A 3I7RA 1TPEA 3QMMA 3GN1A 1Z7AA 2EO7A 3QVGB 4HJWA 4IV8A 1N8KA 2PTZA 3L0BA 3AAMA 4WFKA 4KXUA 1EWQA 4XD3A 3HG3A 3Q6IA 4D3XA 2WK2A 1D2NA 1G98A 1Y7LA 4HAIA 2CXSA 4H7EA 4IVNA 4KXYA 1QW9A 4K9NA 3WP0A 2I9EA 5TAOA 3ET5A 4JVMA 2TRSB 4J0DA 2IYSA 2YWJA 1HTIA 2XNDA 4WLCA 1E5TA 4IXNA 4EG5A 3GCWA 3IIMA 1JX6A 3URMA 2BY0A 9LDBA 4EX4A 3BAZA 4ES4A 1OFTA 3LXUX 3P9CA 1W5SA 1RXOB 3H2JA 5AYYA 4PZDA 1PQWA 3T1VA 1VLMA 4PBSA 3VYSB 3FLEA 2Z8XA 1QZ3A 4WY0F 2J30A 1V6AA 4HMEA 4DLAA 3QOXA 2I3DA 4DSOA 2NXHA 2D3TA 4M1BA 4EWLA 1T4CA 4W5QA 3LZ3A 1P6WA 2RHTA 5FJRA 3ANUA 5HUOA 3D3KA 2IYAA 5MFPA 1UJ5A 1U33A 1KIFA 2QLYA 1KSJA 4G0OA 3QY9A 3FYUB 5AHKA 4Z0HO 1WY7A 1YZKA 3OF5A 3OO0A 5EJFA 3W7IA 2Z2JA 4B92A 1RJ9B 3ROPA 2ECKA 3VYRB 2QUVA 2G9NA 4Q22A 3VMOA 2Y27A 1JZ3A 3L4BC 3WF0A 1W88A 3L04A 5KQMA 3AIIA 1HQCA 2WWXA 1M68A 3O0FA 1C3OB 4QOFA 1UD5A 4UMVA 4CEIB 1L5SA 5H80A 2B81A 1TYZA 1CJBA 3SSZA 1XEAA 1HR0B 1UKZA 4LHEA 1V8OA 4YI5A 2VT2A 1JQAA 2F62A 3HXMA 3PG5A 3S1SA 3LQKA 5A5VA 3ZO9A 4X93A 2B82A 2XQJA 2ZTMA 3N8NA 1H5YA 4A8JC 2ACVA 4U7FA 1N2CB 1DC6A 1Q17A 1IBCA 1QFZA 2IUUA 3ZOAA 3G1FA 3AUSA 3TQSA 1GPLA 4AZGA 3GNDA 2CLMB 4NY1A 1VHDA 3WHKA 2UZ1B 2WJEA 5L51A 1HMYA 1W3KA 1N8SA 3K72B 1J11A 2D2IA 4FCVA 1WB4A 4HFRA 4U4MA 4PPFA 4U39A 4N9CA 4WY0A 1QO5A 1D6NA 3UESA 3NAGA 4IOTA 3E22A 2P2YA 4R6WA 1BEUA 1GTRA 1TKCA 3DDZX 3HGMA 3G2NA 3OIYA 2BR5A 1PL8A 3E7PA 4LZJA 1R5BA 4M6QA 4OLFA 3TOCA 2YWCA 3COSA 2XT6A 3P2KA 3Q9LA 2EGHA 1RTTA 4G1VA 1OBHA 3B8DA 2QRKA 3D54D 4ZYZA 1DEKA 1T0HB 4L4ZA 4PQGA 2HOQA 3HM9A 3N6JA 3BMXA 4HGNA 1XALA 1WVGA 3EOBI 3FUTA 1CUZA 3B9DA 4Z54A 1OTHA 2R68A 1PNTA 4Z53A 3NEJA 4UEKA 3UKJA 2R8PA 5G4KA 3FUVA 1K4KA 4ZQPA 5CT4A 1DQSA 2W66A 4K9MA 1IB6A 3ZCXA 1Q1EA 1B3VA 1N2OA 3OEYA 1ZONA 2P9JA 3DO5A 4K39A 4RMGA 4L4OA 3T5PA 4PVCA 5DX7A 1VXRA 1GDDA 2I9KA 1NU8A 2X2EA 2Q7OE 2PWBA 4OOZA 1JAXA 1L4HA 2PZLA 2H7XA 3AOEC 2GOUA 3T7CA 4UCGA 1JPHA 1OCQA 5BWNA 1YOVA 5CIYA 1CGWA 4D8UA 5LQMA 3BH7A 5IKEA 2CKRA 2ZZ1A 4DLXA 1N6IA 3G5TA 4JBNA 2JHPA 4MNKA 4PWZA 2R91A 2PKRA 3G8DA 3VPXA 1YS7A 4MPJA 4ALMA 4S39A 1Y1RA 4Q7BA 1KM4A 1C3FA 1JUEA 5HFNA 1C80A 3GPBA 1XK6A 2CL7X 3N8IA 1TM7E 1ADJA 5JCZA 2HPVA 4LOCA 3GXDA 2ZPAA 1B0UA 1VBNA 4FFBA 3PC8C 2Z2XA 1AKVA 5DW0A 1ZZEA 5KQLA 2WTUA 2VT6A 3W01A 3F9CA 1HY3A 2X8BA 3QE9Y 1VL0A 3C6ZA 4OXIA 3FMVA 5B58C 3CVJA 1JRLA 4CNUA 4N0QA 4YI3A 5E6SB 2J6XA 1LLOA 1A1SA 3OD5A 5DB4A 1KLYA 4L9XA 3FR8A 1KNQA 1TRKA 1CZLA 4E94A 4OYYA 4DA0A 1B8UA 3KE9A 4R98A 4YTSA 2FUNB 5AM2A 4UTMA 2H65A 4FGZA 4MKNA 1VB3A 3JVUA 1WR8A 3W7AA 3W1EA 4OQ4A 3UXAA 3WFZA 1LPAB 4NKRA 3ZDDA 2DIEA 4KFRA 3AHIA 4Y6LA 3D3WA 1XL0A 5FWYB 3QFSA 4MRVA 4KSCA 3RJ5A 4C01A 2A7PA 4B3CA 3ARRA 4AX4A 1W0CA 4YUAA 1K06A 2FA9A 1YVUA 3JYPA 1DCKA 1CQZA 4P5EA 4N9QA 2BWGA 1FYEA 3ATZA 2IOFK 3SCTA 1E2UA 1FWRA 1EDDA 4OGLA 2QRJA 4ATDA 3FZEA 3IRDA 2UZ4A 5ALQA 5G4KB 3H22A 3RV3A 1XTZA 2Y1KA 4GC9A 3FCXA 4MYDA 3V4VB 4NYJQ 3C87A 3W1QA 4M46A 2PGJA 4CR8A 2JAXA 4B4OA 4IS3A 3RUHA 4HZ7A 2DFNA 4ETMA 3FRIA 4BOYA 3GNQA 4MV3A 2PTWA 3DENA 4MI6A 1P1JA 2I34A 3IQHX 3B38A 4C1NA 4YN3A 4KYVA 2ALJA 2D54A 2YWHA 3WSVA 1EF3A 1I4TD 3HC7A 3NHAA 3DMGA 1A8QA 1IHUA 3FOEC 4ZI7B 3HPQA 1CBGA 2WBLC 3ZI0A 1YOVB 2G4FA 2G50A 1BKDR 1GUZA 2ZYHA 2O20A 2FJUB 1SB9A 1JIJA 1H1TA 3ANMA 3TR6A 1QYIA 3T9AA 4NZZA 5C1BA 3KOZA 2WW5A 2YV1A 4C2BA 1E0DA 4HQ6A 3BE7A 3EQ9A 2ACWA 3PVFA 4G9PA 4ZI5A 3JQDA 3S99A 1SXHA 4ZICA 3W07A 2POCA 4JU8A 5ICSA 3LNMA 1N7KA 2OE2A 3K1AA 3L7LA 3RYHA 3LKDA 4HR7A 3LYLA 3TP4A 4YLGA 1FL9A 5AN7A 1VSVA 4P4SB 3SN1A 5LM3A 3DS8A 4RZHA 4DV3B 1LQ0A 3ZDXB 1JI2A 4CKEA 3JQFC 3KVVA 1T0IA 1H2XA 5JYDA 4LY0A 1E8MA 3OQEA 2FSPA 3O2NA 4S3GA 1UBSA 4RE3A 4NDAA 3KQSA 3ZHUA 3T07A 3TIXB 1FP4B 1ZW1A 5HHTA 2V5VA 4PSVA 3K1JA 4MDPA 3HGJA 3OZBA 2ZRVA 4Q6BA 3T81A 1DZIA 3B6KA 1YBAA 2FRDA 4HQ0A 3KQYA 4PZCA 3LXRA 3EWDA 4TKLA 4ZEWA 4GQBA 4F96A 3ZDEA 1M3SA 3NQ6A 3NXFA 2YXNA 5E1QA 3IXLA 4JBIA 1RHMA 1CIPA 4Y2VA 3PUXA 5D04C 4DV0B 5M1TA 1Z4KA 4REQA 1KGXA 3LCCA 1P5HA 1TV2A 1U0TA 4QAWA 4IKEA 5FEXA 3CH9A 2JGLA 4ZAXA 3AVQA 3ZFHA 1LBQA 2Z00A 1IJEA 2R6FA 5HFJA 1I3OA 5FP0A 4HVLA 4RD2A 3RQIA 3M5PA 2J07A 3EA1A 5TEVA 3CQKA 1C7QA 2OBFA 4MVJE 2IELA 3P0WA 3SADA 4EF9A 7AT1A 3R7MA 1GQLA 1Y3CE 1RZMA 3N0RA 3W7HA 1GYPA 3CZ4A 5E4JA 4HQLA 4N0RA 2HBVA 1YTDA 1N9GA 3TYZA 1QWGA 1E9VA 4DTIA 5I02A 1CEOA 4PO8A 3ADKA 1QZZA 5CDUA 1CWYA 2YV3A 3U6KA 2DT8A 4CL2A 5FXMA 2XZTA 3ZHSA 1J6UA 4G23A 2PKXA 5H8UA 2ZTJA 1EAYA 3W81A 3PFMA 4I8XA 5THXA 4R7GA 1TYGA 4QYTA 2F55A 3G85A 1NSTA 4M8UA 1PNVA 5K4GA 1KEVA 3LD5A 4OV9A 4U2GA 3V7UA 3ME5A 4MSUA 1TYAE 2VRKA 1WPRA 1EE2A 3O38A 1Y0EA 4UZEA 3L8DA 3GTHA 1WIWA 4BF7A 3ETGA 3EVZA 2AG1A 5C7YA 4LU0A 4GWGA 4ZOAA 5HK9A 3RYHB 1E4EB 4DCGA 4CQDA 4JLAA 3B48A 4HYWA 3V1YA 3RT1A 1VYUA 4KX5A 2WY2D 2GEVA 2E9SA 1TV4A 4ZANA 1HNNA 1M04A 2FJPA 4CKEB 4PFHA 3RGTA 1TKRA 3AS3A 3VKJA 5K3FA 3WLEA 3VC6A 1WU7A 1UBSB 2INGX 3WXMA 3PITA 1U2ZA 2CMHA 3QI2A 2VF7A 3E8XA 3QHAA 1AUXA 1UF9A 4UFIA 3ROTA 3WI7A 5CFNA 1PVNA 2YN0A 2C57A 1ADFA 4HN4A 4CBVA 1KXVA 1HFWA 4QQRA 3SQOA 3TXVA 1RAAA 2JB9A 1RMQA 2HXSA 2ZRKA 2XEDA 1BWVA 5CIQA 5ILGA 2Q6ZA 1XVLA 3I92A 3LBNA 4P4LA 3OAAA 1I7PA 4JJ4A 3VNQA 3IEXA 4LTMA 1I60A 4GLJA 5LD2C 1JIXA 2QTWB 4UUMA 5E8JA 4OHQA 1YCFA 2OZ0A 5AECA 4O6VA 4ZYUA 2VSYA 1RHCA 2EATA 2HLHA 4WLNA 1CPUA 3IIEA 2CLFA 3JWEA 4CM1A 1VKOA 1RCQA 3WD1A 4B3MB 1RXYA 4G0UA 3JQAA 3GG2A 3Q15C 2NZUG 3FPAA 1J0KA 1KEUA 1OGSA 5JNSA 4MA5A 3DP9A 4JEHA 1DTSA 4JSYA 2H3DA 4DCCA 4HLNA 3BCDA 1SGJA 5I3KA 3LHKA 3RXZA 1ZQ9A 2ACRA 2POTA 1JKJB 3EZ2A 1DAGA 1EP1A 5FUXA 4LBSA 4UE6A 4E07A 1W5AA 4E70A 5FBQB 2BVNA 1QW7A 5CBBA 3B9RA 4LUSA 3LDVA 2QDGA 3QOFA 4JY9A 1XX1A 3RF9A 2QWXA 2W61A 4BDSA 3C2VA 2WZEA 1HWYA 2FR1A 1WUIS 2FG5A 1VKRA 1BMTA 5D1HA 1U6JA 2AKYA 2NUPA 5AKJA 2WWYA 5A2AA 5HBRA 1JTFA 3OZEA 5TC4A 2L2QA 2PO7A 2C3PA 4MAMA 1STOA 3FOKA 2H59A 1ME7A 1UKEA 2HPAA 1VKNA 1TCMA 1I75A 5JH2A 1SMAA 1FLDA 1KY2A 4PXSA 3OZIA 1O0SA 3GAAA 1OGIA 1GNPA 3TI9A 1JAIA 5FLYA 1NW9B 3QNWA 3G02A 4JCCA 3T3IA 5AVRA 3PHGA 1CVIA 4BBAA 4LVUA 4QYXA 1MEWA 4DQDA 2O55A 2O1WA 4IT1A 3S8HA 1EPUA 4JIQA 1U2GA 5KVCA 4XARA 3PX7A 4IOJA 4DBEA 1A7KA 3NHYA 4WDXA 4JMPA 2R47A 3EEBA 3OZFA 1QI0A 4OAPA 2P10A 3BD9A 3DMFA 3VR5H 1RAHA 3PRJA 3NOEA 4HNUA 2NGRA 3IV9A 5ICMA 4XCXA 2WINI 3UXYA 4HN4B 3QEKA 2QL7A 3WK0A 4H59A 1NIJA 3NBUA 3HTXA 4MUJA 1R2SA 1BXRA 2I56A 1SRQA 3M41A 1COWA 2G7ZA 4I8YA 3FPFA 3EXG2 5F1OA 4D4MA 4KMMA 1H9BA 2KI5A 5JJLA 2WJWA 3S0JA 1QBGA 4J29A 1ESMA 3M5VA 1KV8A 4UCQA 3UJEA 1I7LA 3K09C 1PKEA 2VTFA 3QLLA 2ZB7A 4GM1A 1UEXC 4YS6A 3H6OA 3AUXA 3PKJA 3KKZA 4L4RA 3IV3A 5K3AA 4Q4MA 3L8HA 1J00A 3IX7A 1K2WA 3EUAA 5KNLA 3H17A 4BCEA 2QTZA 1C8VA 4I5IA 1YTKA 1J97A 3UT5A 3JQAB 2G06A 3TQ0A 3P81A 1V0KA 4RH1A 3M0ZA 1E2EA 3B1JA 4GOOD 3KQTA 1QF6A 4NDZA 5AKGA 1XROA 4EG8A 2A0XA 2X41A 3TW6A 3WK4A 3FSUA 4CDRA 3VC7A 4MZXA 2XZPA 3AY6A 1IZ7A 1USGA 4OF4A 4KQ1A 4H60A 5EP2A 3OQOA 1EJRC 4B7ZA 1EP1B 3VR5D 3L9CA 2GJRA 5IFKA 1JQBA 5A8QA 3N2LA 4A8HA 3DLAA 2ISWA 1L2TA 4K8EA 3TOXA 1DXOA 4UVEA 3NIWA 1ISJA 1G5FA 1Q1NA 2OHVA 4C6SA 3AVUA 4LNUA 3GYGA 2NUPB 4NMXB 4I7VA 3C14C 1QVVA 4E2BA 5FR2A 3GEHA 4H9VA 2DZWA 1WCIA 2IYLD 2QW8A 2XMPA 2ZICA 3NIGB 4OYHA 1VYRA 5DV9A 5IT4A 4PZEA 4UTJA 4NONA 4PLCA 4C7BA 5JMOA 3IP7A 4EJ0A 1ZIYA 3L21A 4OHFA 3A1WA 3RYCB 1NYTA 3BRWD 4X61A 1KI2A 1E18A 1YQQA 3IGFA 4A26A 4MR9B 2ZKIA 5DIZA 4PXYA 2PLMA 1J5PA 3EG9A 4C0XA 2JJ2D 5KDLA 1KFEB 4ZQNA 1W0JA 3CCBA 5CB8A 1KO5A 4DR5B 5I7OA 4RVDA 1GNXA 2X4DA 3KVMA 2CLSA 3BXEA 4O4JF 3O1JC 3T1NA 2IXGA 3WLHA 2YS7A 1FQKA 1O66A 4ITVA 1DJMA 4HU3A 2AXQA 5EZ5A 4F8JA 1CPYA 4YUVA 1Y4SA 4ZT6A 2TAAA 4PFMA 4MIMA 3QTBA 3E1SA 2YYTA 4TT3A 2O5EA 2VDIA 1I9GA 5GZ1A 1GQQA 3OG9A 4GLEA 1XD8A 1DQZA 1ACJA 2Z0IA 2VMFA 5ER6A 3B40A 3Q3VA 3ISTA 1QCYA 3V4RA 1BXRB 3TR9A 1N77A 1W3NA 2XUFA 2G09A 4XTRA 3QI7A 5K3EA 4EVZA 1G21E 1MI3A 3ODGA 4G0YA 3EZYA 3AWDA 4MUYA 4TL9A 2GRUA 4JKOA 2MWMA 4YL2A 4M7OA 2IYYA 5EJEA 4PYJA 2UYOA 3NYRA 3C52A 5TXGA 5ALIA 5HKBA 4IFTA 2PD3A 1EE1A 4OBSA 2J08A 3OKAA 2ONEA 1TCUA 5K0BA 4CG2A 4LUYA 5JYCA 5EZQA 4KV9A 4HH1A 5BRJA 1G2IA 3VM7A 4NJEA 3DV2A 4DNMA 1CUFA 3M6AA 2C9YA 4HLUA 4FJ1A 1D3CA 3PSWA 1G7UA 1XBVA 3M0IA 2AZ4A 1U3TA 4LK2A 4ZHQF 2XKAA 1FMCA 1NC1A 1P72A 5F9MA 4X6LA 5EL1A 1GGKA 3MBFA 2HB6A 1G6OA 2O7NA 1K02A 1OXXK 2M6SA 2ZXDA 2R7NA 3CF4A 2PO5A 3RF7A 1P6QA 2G3IA 4Z1MA 4UE3S 3R94A 4NF2A 1SPXA 4O4JA 3S28A 1CT9A 4DQUA 1EXPA 2PK3A 1SO5A 3UV7A 3WL0A 5K8VA 1KJ8A 5A4DA 4NT0A 3VIKA 5IKXA 5LXXA 1H5UA 1OIVA 2NSXA 3MD0A 5K7JA 4JPGA 1BKHA 3LI2A 3Q65A 2WIAA 4GINA 2PUHA 4LNUB 1U1DA 1WCIB 5REQA 1W9HA 2A1UA 2E0IA 2P0AA 3WC4A 4HT3B 3ZT6A 3JQ8A 3V7NA 4L9ZA 1BRMA 2YDRA 3KEHA 3V4LA 4KTVE 3ZXWA 2AQVA 3PCTA 4Q9DA 2YJ3A 4P83A 3KX6A 2ERYA 4V2IA 4UEWA 2P3QA 1IXOA 3EW7A 3RUAA 5H4HA 3CIOA 2P53A 2CV1A 2G9ZA 4F2HA 5BR1A 1HKWA 1Y4ZA 1AF4A 3GOHA 1Z34A 1RPJA 3T5TA 3WDRA 5HOEA 3QVKA 4HHHA 3W0LB 3WIBA 1TAHA 7ABPA 1Z25A 4IQ0A 4ZHQA 1ZCBA 4AY1A 3AVTA 3KTCA 4H1VA 1DWFM 4JI0B 3KT0A 4NQRA 3K0CA 4JTLA 1RPNA 2DG2A 1CHDA 5I9MA 3ANTA 1K9TA 4FILA 3KJIA 4G0VA 2QP4A 3M47A 5LC1A 4QT0A 1GYRA 1W1IE 4BLSA 2YW3A 4D80A 4YAJA 4TU1A 4EIVA 1NLYA 4PHFA 1VL1A 2EPMX 4LFBB 1Z88A 2C0AA 1C7FA 1TYDE 3H1BA 3EY4A 3LC2O 1DIEA 3KIPA 5LA2A 1QK4A 2M1ZA 3BFXA 5SICE 1QG2A 2XZDA 1OPXA 3PRKE 4WUIA 4MXDA 4R8LA 4RFLA 3GN2A 4AL4A 4KXFB 2V6BA 3MJDA 5DU2A 1Z6XA 4TKVB 1JJKA 3ZGOA 4NJEB 3Q7EA 1E32A 1E73M 3IIIA 2BJHA 1FA9A 5EY5B 2IKQA 4H9UA 1Q6CA 4MV7A 3WEZA 3Q7SA 2SBTA 3HJEA 1GQOA 5A9TA 5JO0A 2MIIA 1J1IA 3WEMA 1YUMA 4HSGA 2V82A 3TFQA 3UETA 2Z4SA 5LDDC 1J8VA 3CV6A 3Q1KA 4O4JB 3A26A 5EU9A 4DWWA 1RD4A 3HU2A 4HHLA 2VHWA 1WXGA 2BM1A 3CV1A 3TTWA 5CCBA 3FCSB 3WBEA 2FGLA 4I1SA 1BU8A 4ZTUB 1QHFA 1FK8A 1X14A 4HMNA 4KRGA 1H4PA 2P6PA 4CNBA 4CL8A 1E3ZA 3TWBA 3AF2A 4XIJA 1MRZA 4ZKDA 5BYAA 2EQ5A 4G4IA 2RHCA 5REQB 2A1UB 3O3RA 1ODSA 2E2WA 1QOQB 1W3TA 1EBFA 3JQ8B 3THCA 4IIJF 2EJVA 2ZB3A 2V3DA 3SOPA 1XDDA 1Y5WA 3RAOA 1GVHA 2FRVA 3RIXA 1XDUA 2VPYA 1W5NA 2CE2X 2O9TA 1IY1A 4M1MA 2FB3A 5KNBD 2EL9A 4P3XA 2EPNA 1LT8A 1P4JA 3M4XA 4ZAWA 2BOEX 2NXWA 2A88A 2KSQA 3O74A 5DMMA 2ECPA 3NX4A 2FVLA 2A5YB 3QBDA 4MHSA 5E6ZA 3VUFA 3PHHA 4R7JA 1M0TA 1H0RA 1MJNA 5HDRA 3MXTA 4ZHQB 1H65A 4WDUA 2HHLA 4C6OA 3RASA 3IRSA 4Q3DA 1SGWA 5LIUX 3AJ9A 1EA9C 4ATNA 1G60A 4NJJA 4Y2TA 3PVCA 5DCLA 2KM1A 4OL9A 3DR5A 3CIFA 4QZVA 3AJXA 3BH4A 1TV3A 2EC5A 3H5RA 1QTQA 2WM3A 3D2LA 1LPPA 1TF2A 5HDBB 5HR5A 3IUSA 2IX3A 1JG1A 2BZGA 2PCLA 1W9UA 2PMFA 1UOOA 3IR5A 3OJGA 1KM1A 1WO2A 1ONBA 4I14A 2BDTA 2ZJFA 3RRAA 4NWIA 3G18A 2AEEA 4RE4A 1XRJA 1MMFB 3MCWA 4X6XA 1ZWKA 2VR5A 2PQ6A 1SVSA 1OV6A 1IU9A 4FEEA 2YXPX 4ND1A 4LZWA 5H9VA 4TUFA 4DO7A 2JKVA 4IIJA 2G6TA 2QJGA 1MTZA 2AJCA 1Q3TA 4X3ZA 5CAEA 4S0XA 1T2AA 1E79A 4XZNX 4R1LA 1F2VA 3MGBA 4C4OA 1TCAA 1XZCA 4U2BA 2AN5A 1KTBA 1JFSA 3EIUA 3GFPA 3D4OA 4IQEA 3WA6A 4PTLA 3X43A 2RGYA 4WBXC 3O9VA 4CMIB 3W0KA 1B1YA 3NQVA 3EXRA 3S1XA 2A33A 3H5LA 4YB8A 3UA3A 3GNOA 2VJDA 1V6SA 2W2NA 4UREA 2P3EA 1NFPA 4IZGA 3S68A 4KLAA 1UUOA 3BHJA 3GWQA 2TMDA 2F4NA 3M0LA 5FCZA 1GL7A 5HKAA 5M2FX 2Z4RA 1XTKA 3TUIC 3GRCA 1S1PA 1ZP4A 3OZVA 3AMCA 2JA2A 1H1YA 3PXGA 2WJ4A 3A0RB 3WL6A 5EIEA 2E9MA 3BTUA 4I2NA 1Q6QA 3CLTD 3JTEA 5AK0A 3K8MA 3DW3X 3CZEA 2RKWA 5KHAA 1JTEA 4AC7C 1RWOA 4DRZA 1I7QB 4HAUA 3R5HA 3A21A 4OX9Y 2YL2A 3F9RA 4EG7A 4DUGA 2OSYA 3GRUA 3ORSA 4UTXA 1QHXA 3GJ5A 3W7PA 1SU4A 4XFJA 2D0IA 5DX8A 4JVNA 4OCZA 1FQ0A 4DSUA 4L4YA 4GGBA 5DNCA 4LHZA 2HQAA 2WWTA 3UKOA 3LRTA 3FBGA 4KE9A 3NETA 1MLDA 2Q4EA 5KVQA 1UJCA 4G7EA 1EINA 2D2OA 3ABQA 4RYDA 3NBMA 1ACMA 3QLUC 3H9CA 4R54A 2Y4SA 2H8GA 3NEAA 3WLAA 2AS0A 3I01A 5H1YA 2C4NA 1YHZA 4F91B 1GOKA 1YR6A 1ICIA 2IYVA 4HA1A 1ORIA 1JFVA 3E3OA 2Q3FA 2R3SA 1CRPA 3UHAA 4XH9B 4BB6A 1T3ZA 3AMLA 2R48A 5AHFA 4R3NA 1YNPA 2P6OA 4CMCA 2UUOA 2ZP1A 4AW7A 1B9ZA 5L3VA 5AK6A 3KAPA 1WCXA 1A5MC 2CD9A 4YXGA 5L4SA 4IIJB 5DNWA 2HYIC 1DRWA 1T5OA 3NAQA 2GXUA 1N2ZA 3SS9X 4UBPC 1F9AA 1RHKA 5HRUA 3LPPA 4KO3S 5AH0A 4M1OA 4G1FA 2VTDA 3H9EO 1WCWA 2F1HA 4U5KA 1OHHD 1P0FA 1CRWG 1KYIA 5DM2A 1KY4A 4XVQA 3SAJA 3KBSA 2AEMA 2QD1A 2IDKA 3P80A 2WC4A 2PNJA 3LX8A 2O9RA 4H1ZA 1M6WA 3PJXA 4X1OA 3HMCA 3DDUA 1BVUA 4EG1A 2R6GA 4P7JA 5JCPA 4Y9RA 4Q03A 4Z7NB 4YMUA 2VFEA 1TA9A 2V7QA 3W1VA 4KVZA 4QM1A 2VT0A 4DSNA 3PB2A 1AZ1A 3OICA 4J2MA 2ZIZA 2VR2A 3HM2A 2JJYA 1GTHA 1MKYA 3O92A 3NTVA 5J2TF 1Z4OA 3OIHA 1UFRA 4B3FX 2WYHA 4I7EA 1JR6A 4EUKA 2C84A 2P0YA 4ZC1A 2XUCA 4NYMQ 4YP5A 3N2BA 1XGZA 2EKLA 2JVKA 2ZRHA 3A6JA 3MCTA 2YMMA 1B6RA 2P4UA 4BFAA 4V1CB 2I67A 1U2DC 1A76A 5ECVA 3BZBA 2ZJYA 4L50A 1QF9A 4LGVA 3NPWA 4ER7A 2Q9CA 1YUBA 2QX9A 3L8EA 1ZIDA 2D4HA 5J2UB 4TV6A 4KJZA 3W05A 3DCIA 1L1FA 1HDEA 2P8JA 3T06B 3M4ZA 1Y3BE 1MC5A 1EO5A 4F3YA 3B8VA 2QIPA 4FNMA 1NOUA 2P4SA 3U7HB 4F4UA 3SJZA 1P1XA 2W9XA 3E23A 1UBTS 1BXZA 3MOIA 5FQNA 5HVNA 3AVOA 4DRSA 5M7EA 4TXLA 1HX0A 1WZUA 2CVQA 3X1WA 3ABQB 4F8EA 3GLRA 3U80A 4CMEC 2J4FA 2P67A 1E9IA 2O0HA 1WNFA 2IITA 3FX2A 3RS7A 5KB3A 4XUGB 3IEMA 3DHNA 3H5TA 1HUQA 3WQ4A 1CUIA 1KBOA 3OFSA 5HULA 2WG2A 1G8PA 3VZZA 2J8TA 4HMCA 3AL2A 3X2SA 4DSTA 3SR0A 1RY0A 1GVRA 4UD2A 2Y1CA 4NFSA 2XQKA 2ZBFA 2FPPA 3RDPA 3NFUA 1XD1A 1ZYUA 1ZSXA 4DUPA 3V32A 2Q8QA 3QVVA 5BOEA 4UQBA 3KJQA 1WUYA 1C2YA 1N5RA 2L5HA 3DGBA 4NYJR 1PFKA 5TIMA 3E0IA 5IFTA 4KXLA 5KC9A 1LRKA 2JCGA 1AX9A 4ZQCA 2FSSA 1ELSA 3DMNA 3TQRA 4NCKA 4Z2AA 5J2TA 2D00A 3H5WA 3U56A 1VCHA 3L7KA 3MBIA 1VCMA 3DL2A 4F2BA 3WBXA 1AV7A 3AR5A 4B6RA 4ZT7A 3KL5A 2DQXA 4BQOA 5H5JA 1E99A 3U1TA 1RAIA 3EF1A 4XYMA 4RVSA 2BYTA 1POXA 2HEJA 1EAMA 3HJUA 4M53A 1QQ7A 4Q24A 1OK4A 4HNSA 4CFZA 1OFUA 3O75A 4IVPA 4LQDA 1XHEA 2A5GA 5CQ1A 1JJFA 4K68A 5A6JA 1YQUA 2RBEA 5I3GA 1TI7A 5LQCA 2EDCA 4CTJA 3MUZ1 2HBRA 3IILA 2PH7A 4R2MA 3RCYA 1NTHA 4W8LA 3S9IA 3CCFA 3EPNA 1VM6A 3V33A 5K0FA 1TK9A 4AUKA 4E4TA 2PPLA 5E09A 2K7FA 3PN8A 2OO7A 2PTDA 4C6CA 5AC4A 3EIFA 5DN1A 1NRIA 4PZ9A 2P1ZA 5E1MA 2EWVA 2GF9A 3N2NA 1LI4A 1U63A 1PUXA 4AKSA 2QG6A 4NQ1A 3PC2A 2UUAB 3BCSA 2L42A 4DYDA 2I6SA 2WUWE 3N17A 3HFTA 5BN3B 3N04A 2AI3A 3DBRA 1R9NA 2IKHA 1Q12A 4J0GA 1RHRA 3I5YA 1KMCA 4XDHA 4D6JA 3MMNA 3I8SA 3V9PA 1KAEA 4BNVA 1FBTA 5AI6A 3QUAA 2PKYX 1NLMA 1SZEA 5EPUA 3VSEA 3G0XA 4FHCA 4U3AA 2CMFA 4WCFC 4RPKA 2QI9F 3AIWA 2XMCA 4RGBA 4AVNA 4QNWA 2BMJA 5KX5B 1HOXA 2ZSUA 3FZQA 3RBAA 1XNGA 4LRSA 4X20A 4GKAA 2PL3A 3NP9A 4V3CA 2DFLA 4PHHA 1MRSA 3CW9A 3GE7A 2B2XA 4HSHA 2B8WA 1ODIA 3F6YA 2FSVC 2PWHA 1N55A 5A6BA 3FDFA 2PDWA 3DCNA 3MTQA 2OFPA 3O8BA 2EHDA 2CLCX 3DL7A 8ADHA 3H53A 2Y9PB 1JG4A 2W63A 4Q3CA 2XUHA 1LP6A 5J2TB 3WK6A 5IN5A 4XOUA 4GD3Q 2QVZX 1X80B 1WZAA 1XQKA 3VIFA 3NOOA 1ZU5A 3NQMA 4MYCA 3FGNA 1NBEA 4FCWA 2CZDA 5F2GA 3PTKA 1JBEA 2J77A 3ITGA 2D1YA 4BV2A 2IBSA 4LDJA 2FYTA 1NVTA 2QVCA 1AS2A 2VNJA 2RGNC 5CDYA 3F3KA 3WIEA 3ONCA 5TS3A 2Q5FA 4AKGA 2EG9A 3HQNA 2CMDA 2KQUA 4KSBA 1P4SA 3LTEA 4WCVA 1SG0A 4XLZA 4H6PA 3UWOA 5E0KB 2GK1A 1IK6A 3PCXA 1GZ3A 1CIJA 4H1TA 4DE5A 3LCFA 4J9UE 3KQWA 5T7BA 2H5LA 3QSGA 4J3FA 2ZZMA 4KAFA 1Z7WA 1BDHA 4JR2A 4US2R 2EF9A 4PYNA 1VG9B 5CNMA 3ZCTA 4DKJA 2J9XB 5KEZA 1Z74A 4JD5A 1XYMA 2FB2A 2UBPC 2C83A 5CT6A 1J39A 3W82A 3SY8A 5JBIA 2B0JA 2DEUA 1P0KA 4LZNA 4TMBA 4MX8A 1H11A 2IUFA 1X97A 5AK5A 3OLDA 3DBRB 4EW6A 3OMXA 3UUGA 2H0AA 1RVDA 1UOEA 2NQJA 1QUEA 5D51S 3IQXA 3P84A 1FFGA 2OMEA 4CFSA 3HFRA 3JD3A 3DZCA 1W5MA 3W4JA 1KJWA 3RABA 1J2YA 3UWWA 3JASA 4LEIA 3X2FA 3H2EA 1S8FA 1I2AA 2HYDA 1BDIA 2VYCA 2CNCA 3RITA 2F61A 3BHNA 3E0WA 4KN8A 2QCGA 4DDTA 3OJ0A 4I3GA 4LMPA 3S42A 1DKOA 4TLBA 3PIIA 1ZEMA 1URPA 1VSBA 2WZTA 4RXGA 1OIWA 5EIFA 3RNDA 1UP4A 3AI2A 1SH7A 3EMBA 4X20B 4TVUA 4MWAA 3AJEA 1P44A 3NQAA 1DFHA 3CM0A 1YB7A 1ZN8A 4DY1A 3UZXA 4JVSB 2G3NA 3LUGA 5EJ7A 4MAAA 4MVXA 2RC6A 3IV6A 3PFRA 3GCXA 4LJYA 1GZHB 3UMJA 4M0UA 4UZSA 1TPZA 1I14A 3VJKA 1R6DA 2XWPA 4G67A 5DW3A 3LX9A 2NUTB 5J1TB 1RJRA 1QYXA 2AI1A 5KNCA 2VVNA 1DHTA 3KB2A 4TKUA 3CT6A 3OJWA 4JAVC 3T40A 3RYSA 4YEDA 1UZNA 2PSHA 4OHKA 1S2IA 4P36A 4IX9A 2YWFA 3F4CA 1CRZA 2VK1A 4DW8A 2EKBA 3AXTA 5FKYA 1C1DA 5DX1A 5IASA 5I23A 4CLXA 1BHO1 2UV8G 4H3KB 4NX5A 1EFZA 2JIZD 4DIDA 4D1IA 1O5XA 1IE3A 1RQPA 5AKIA 2VWSA 4NESA 5FF0A 1WXYA 3GFBA 3LTPA 2GK1B 3URNA 5AJVB 5SYNA 3TDMA 3GAFA 4IO1A 2BCJQ 5IOBA 2BZ0A 3FTFA 2ODTX 3OY7A 3WUFA 4MITA 4ZMSA 3M46A 1EH5A 1K9DA 4KQ6A 3MY9A 2W43A 3FTNA 2YZ2A 3UWMA 1FYWA 1R8YA 3JYLA 4MKSA 2Q5QA 3C0LA 2PLRA 3LFTA 1ECQA 4AF6A 2X0RA 1JEYA 2DHRA 2AF4C 2NO7A 2VT7A 5DM60 4QPNA 1US3A 1VJ0A 1DC5A 1KQOA 2FR8A 1EZ1A 1OD6A 2ZQZA 3LY9A 5A9SB 2QZJA 1FDRA 2BKEA 5CJ2A 3UM9A 5CT8A 5GJNA 2VK8A 1S5NA 2F2KA 3UQYS 3O2LA 2JAWA 3FJ6A 1WLYA 3A37A 4H0FA 5E6RB 4LFCB 2R00C 3S81A 4JODA 5AVQA 1B6SA 5CSUA 2PT7A 1T0PA 5CNIA 5M5DA 1KR1A 3SEFA 2QAPA 5T4EA 4PZZA 1PF7E 2I5GA 4XA8A 1RC8A 3W2IA 2Y7FA 3PP7A 3CK5A 5DO8A 2VYNA 4G5HA 1X3SA 2JALA 1MUUA 3M5ZA 2V5JA 1JD7A 2WO5A 3FHOA 4KN9S 2CXHA 1B41A 1KI9A 5H70A 1OLXA 1V3TA 2ZZ7A 4E38A 4EWJA 4Z1DA 5HM6A 2WT8A 3UV3A 5EJ5A 3B05A 1TPYA 4K2HA 3FPKA 3KUMA 1B9BA 2XSZD 3ARPA 2LCQA 2QNBA 1W5TA 1Z0JA 1ZMTA 1JDEA 1CXLA 3RS5A 3K92A 5BN5B 3OLQA 1G9HA 4MVJI 1ZM7A 4F9GA 2BRUA 3V7WA 2OHFA 2R9VA 3U48A 1LI5A 4LVFA 4PA8A 2W5FA 1HMPA 1KC3A 1UH5A 4AIBA 4E4FA 4ASTA 3HZRA 1QI3A 3MMTA 2QTBA 4TKUB 1GKLA 2AC4A 1IN7A 3QSYA 4PTVA 3TINA 4O8RA 4XQ9A 3P9PA 4DNPA 4J9JA 4XUCA 4JLVA 1XIBA 2AWNA 4O2RA 5C9RA 3TTOA 3W02A 4WBSA 4U7GA 3KFLA 2JCXA 5JZBA 1A2OA 2V81A 4JI1B 1YMQA 3G2OA 1IXSB 1AMNA 1FDWA 2P9GA 3BFJA 2B7PA 4WX2A 5EJ4A 1QFJA 3I9KA 1B76A 3NQ2A 3EGIA 5LNK6 1DEDA 3UZ5A 2QXUA 1ZGAA 1EP3A 4C29A 2PBFA 2C58A 1US0A 3ZUPA 4QAJA 3IL2A 1I4NA 3TTVA 1HLDA 1O77A 4TLLB 1YR9A 4UM8B 4CWAA 4IJVA 2OXRA 2R62A 4Z2YA 2XSBA 1RKVA 2I6TA 2VDLB 4DXHA 3P52A 3WF4A 2OAP1 2IPOA 4I1OA 2WIDA 5DYWA 3ADDA 4TYMA 2ZX5A 2ILVA 4YO7A 4XPZA 2C82A 1ZSNA 1W1PA 3NM3A 1RHQA 4Q3OA 3NL5A 3TVAA 1DOSA 1NMQA 2PQ0A 1A0DA 2RIPA 3VXGA 3NKVA 4A8PA 1CC1S 4KIJA 2WHXA 1RVKA 3DHPA 1UBRS 4FR5A 3MS8A 4WK0B 4NEHB 3HDGA 1HGYA 3THQA 5ICCA 3HCNA 4UBNA 5IFLA 2XTJA 4RXMA 3BXFA 2MR5A 2O05A 2CVFA 3UMMA 3BTSA 1EFRA 2WHQA 4X6YA 2YVKA 1UWAA 3I53A 1WW8A 1TJ5A 2DSNA 5KMGA 1XIJA 4HAZA 2RCNA 3OFND 4HUJA 2CESA 4LSZA 3B36A 2RHRA 4L02A 3Q11A 2X3YA 4JYAB 4JXCA 4HK7A 2QZ4A 2XE4A 4L08A 5ALRA 3REQB 4RL4A 2J9FA 4KPGA 1J5XA 1D7AA 3HO8A 4F9FA 3W1PA 3DLBA 1JL3A 1UMCA 1YZUA 4CU5A 1XH1A 1PJ4A 2PXAA 3B85A 3T9DA 3ZXYA 2GN2A 3OB8A 2A3AA 1HFJA 1JEDA 1MUCA 1SU5A 4ZVUA 2N47A 4ZEXA 4RBNA 2G8ZA 3BGIA 3NUGA 4G5SA 2D0OB 1SMKA 3W37A 3ACCA 2HRBA 2I1VB 2IHJA 3KELA 4NZPA 4ZAVA 3KCNA 2VUIB 4GXNA 4ZRNA 3KVNA 2IHBA 3VO1A 4JD4A 4NH4A 1JUKA 2CNWA 4RC9A 4RD0A 1M8GA 2O8CA 3OGSA 1H3EA 4RPLA 4X9XA 4F3CA 4XW2A 1DWIM 1XA4A 1EH9A 5DMYA 4NG4A 3RSFA 2YW4A 2A9RA 5FOWA 1ZOIA 2V54A 3U9IA 1WJGA 1IBRA 2G5CA 4ENSA 4MDHA 1ATZA 1X9GA 4Y1GA 1JHPA 2J7KA 2VQ3A 2YFKA 5J4LA 5C3MA 3U57A 1JGTA 4GUHA 2FSHA 5AZ1A 3OPVA 3DAPA 3AXXA 1RBLA 2VDWA 3QW2A 1OOEA 5D7BA 3ZGLA 1KVUA 1NXPA 3PR2A 4LY9A 5KKNB 1IR1A 2DEPA 2HROA 4HWSA 1T4CB 2ZWMA 3CBWA 3C7KA 5CJPA 4NDNE 3IPRA 4GISA 4AX6A 4F6RA 1JTVA 3TJLA 4CF4A 3LJKA 1V7PC 4KGLA 5CGQA 3QRWA 3BJSA 1DQYA 3AW8A 4BBZA 4RS4A 1JZ6A 2GJ4A 3FFXA 4WN3A 4NAHA 1X7YA 1PBNA 3JRXA 2PDYA 5DHFA 1W88B 3G9TA 3X1YA 3CGGA 2LLEA 3AJ8A 5CBIA 4EGAA 4WUTA 1U3DA 2XMQA 3LN3A 2G80A 5D2XA 3IELA 1F0YA 4ALJA 2PTXA 2HN9A 1YDGA 5BCAA 3K6SA 4PRWA 1Y8ZA 2ZR9A 3L12A 4FPXA 3MPGA 4EGJA 3SLGA 4BU1A 2XVLA 4JLDA 4RTLA 2W6ZA 1K6EA 3M64A 4QC2A 4JEMA 4YAIA 1PGOA 6LDHA 1MH1A 3PE6A 2FEWB 4Q9AA 1KIAA 2IYUA 1LORA 3DWGA 4MLZA 3OHMA 5EP1A 3T2OA 2GD6A 2FGZA 4C4TA 1UMCB 2M32A 3CWQA 2HRCA 5LMUB 2VZVA 1T9KA 3DSRA 5DTRA 2XOKD 3WIVA 3JYOA 3L5MA 2C0CA 4PPGA 1RQEA 2JF6A 5DNYB 1MJ5A 3AK4A 1UD6A 4TTPA 4H6RA 3HRIA 3LCLA 2BVTA 3SZRA 4FI4A 2IYNA 2Y85A 1PZ0A 2QEQA 3BE4A 1B1AA 1WSAA 3EX3A 1F0NA 2ATSA 4WY0B 3HADA 1T6ZA 1FLNA 4BWVA 3UFYA 3E22B 2JVJA 4JT4A 3ZZ0A 2TODA 1BEUB 3NM1A 3MHGA 1J4AA 1XG3A 3PTMA 1B3ZA 2AMYA 2Y0BA 1UJ6A 2QAFA 5FNVF 3NM4A 1SVDA 3UA4A 2YJTD 4A82A 3E7WA 4XYLA 4TXNA 4HNHA 4JBWA 2O8CB 3M3HA 4DUOA 2WCGA 2QJJA 1RK6A 3D4LA 4L8GA 1IY2A 5CCXA 5D86A 3N1AA 1U7TA 5CM2Z 3RV4A 1A7AA 4C0BA 1OI2A 1Q8AA 3PULA 5K45A 2H57A 5AHLA 3I3DA 1JIQA 2HV8A 4Z4IA 4UC5A 4KI0A 4TOIA 1PJ2A 3V4FA 3D6FA 2OECA 1RYNA 1ZIOA 3JQ6A 3KOUA 1MC1A 1W2VA 1EUZA 2IQDA 1MQAA 4MZYA 4ZXLA 2VDWB 4RMIA 1JQXA 5CVUA 3EXG1 4LXYA 3PR2B 3IDQA 4O15A 2OWDA 1DAMA 3IESA 2ACSA 2PDHA 2F43A 4QE4A 3OCUA 3A2NA 1ZOLA 3FEMA 4OFCA 3D8BA 4QLLA 4YCLA 2NUAA 4URZR 2LKCA 5DNAA 3VGDA 1Y98A 5MKGA 3IMFA 2IYEA 2OY0A 4WQ6A 2BKXA 1NV9A 2C61A 5M34A 2DC1A 2CXPA 4R8MA 2PUZA 5ECWA 2QHAA 1XN1A 3QKRA 1QVBA 2C4WA 1DSSG 4X9YA 5B1SA 3IS3A 4NP6A 1SPQA 5A3HA 3IJQA 2MYNA 5FFFA 1N6HA 4XISA 3ESQA 8ABPA 1BE8A 4HNCA 2GN0A 1U8XX 4ZYXA 2NU8A 3TNBA 1PW5A 2ICSA 1CBUA 3FN9A 3I42A 2P75A 4M6UA 4DPQA 1RLCL 1VYTA 2PGXA 1H8ED 2OLEA 4FFBB 3GHUA 1GYLA 2OMKA 2NXGA 2QUTA 4W7HA 4WDWA 5F1KA 3ADCA 2PZBA 5FUVA 2H1LA 1WVMA 4LI0A 3OHMB 5M3BA 2ZVPX 3MXOA 1W25A 5BUCA 3A4VA 1Y7TA 2KZHA 3BGJA 2CZ5A 2MU1A 2EGGA 3DT8A 4MQ6A 1EFPA 1DOAA 2Z8YM 1V5GA 1N92A 3C3YA 4F4CA 4UE2A 2FTWA 1P1RA 4GEGA 1V4NA 4X92A 3OLEA 5A8MA 2DFVA 3ASYA 2NOAA 4A2RA 4AVFA 4DM1A 1F5ZA 3LNPA 4M82A 3JW7A 1X77A 4WXYA 3DLCA 4NJHA 2WTNA 1AMYA 3O0DA 1E55A 3T4XA 1UC4A 1NBME 2YIVX 4XSGA 1ZKDA 2D73A 3OI7A 4C7JA 3NFRA 4D8TA 3D3WB 2AR9A 3M0EA 1WB9A 5HK4A 3Q3CA 4HU8A 4ZQFA 4MV8A 1NBAA 1XEWY 1E6WA 1HVQA 3H7RA 2Q1WA 1OGGA 1S5VA 1E60A 2BH2A 3ATYA 1DRKA 3MZNA 2OODA 4YAOA 5FEPA 1XO1A 1CXIA 3WNBA 4XZIA 1ZY2A 4HBZA 3S2UA 3L4EA 1FP6A 1P4HA 1SCIA 1GQRA 3IODA 2YRXA 1QR2A 3KG2A 2CLIA 3SIRA 3KS9A 1OMOA 3G0BA 1S2GA 2DV0A 5GONF 2XNHA 3L1JA 4JBGA 4R51A 2DGAA 1N2SA 4D6PA 4BWLA 1EUCA 1D9ZA 3PPGA 2XVKA 4G8CA 5F1YA 2VOEA 5TT0A 2F43B 2H1IA 3K9BA 5B7ZA 5HIMA 3FNIA 3SJBA 1O95C 4XEUA 3W7KA 4C1NB 2NM0A 1TUIA 2X14A 3UOWA 2I2FA 5HBGA 1OY1A 2OCZA 3BLOA 4GX5A 1XYZA 2B4QA 4U7HA 3PWGA 4RS3A 4R27A 3GFYA 2H1SA 2HKIA 3W2EA 3QKRB 1PTJA 1UPMB 4BGDA 3AM3A 4DXVA 2RAPA 1Q7EA 3VKKA 2Z9CA 3P9XA 4CCEA 3UD6A 3ND5A 4MWDA 2NU8B 3SXJA 1S7GA 4KAXA 4ZVKA 1NUAA 3T7RA 1MV5A 1QZTA 4YH1A 3EAFA 4MVJM 1HX7A 2NWQA 1H23A 2FZEA 4HKTA 1CYGA 5EP3A 1W31A 3S5SA 4DLPA 2JATA 1BWKA 3EAUA 3SDOA 1WXFA 1AHNA 2VNKA 4U9IS 4HOZA 1IAQA 1BVRA 3HQPA 3K1AB 1BGXT 3JS3A 4GWLA 3OOQA 1SCAA 1BTOA 2GASA 4X2PA 4F60A 3WOVA 3VZBA 5EJMA 3E3MA 1E2DA 4EPKA 4D71A 1J2BA 3QE3A 1GPJA 3C98A 5AOAA 1JPJA 3KKPA 5GONA 4IQJA 2FE1A 5HOSA 3IANA 1E96A 5C1DA 3IDAA 1SWVA 1YC2A 3R2GA 4JC5A 1YLVA 5D8WA 4DQKA 4JJIA 1VKFA 2O6LA 1E1CA 3JD1A 3GXNA 1FWDC 4XIMA 1PG5A 1Z41A 5A4AA 1V35A 1UWUA 1EXDA 1F9EA 3L1UA 3ZEAA 1D09A 2XIQA 2J3QA 5EYPA 5JSHA 3KP1A 3VKAA 3ZLUA 1EL3A 3AFMA 2P9EA 1PVOA 1U65A 3WK7A 2J7GA 3DV0A 4JOQA 2HHAA 3O3CA 4REQB 3FV9A 3F3YA 4OXQA 5CFPA 4UM5A 3GXOA 1O4UA 2NQZA 2P50A 4NYMR 3FPHA 3BJZA 3C8NA 4MGKR 3KSAC 2M2IA 2WMYA 4Q1CA 4DQVA 1NGSA 3CNYA 2OGSA 2CZCA 5KWSA 1RZVA 4MP8A 5HQ3A 1EGHA 2YVAA 5KCZA 1H93A 1KOFA 3HWX1 2OYMA 1J0BA 3G2MA 2D7JA 3U7VA 5FF4A 1DUIA 4OT7A 5CVVA 4BX9A 2JBHA 3IVGA 4K81B 3FI9A 3BVJA 5BRBA 3PZVA 3RNLA 1TM4E 4Y8VA 5IVHA 4RK6A 5CG7A 2C3YA 1N9GB 5IBXA 1ML1A 3ITCA 3GEGA 1ATIA 1KE1A 4DYVA 4KQFA 2PN1A 1TLFA 3IUEA 2V9CA 2WA1A 1JR3D 1CB7A 3MTAA 4JTJA 1DJXA 2EW1A 4WKPA 5BU9A 3V18A 3LQ1A 3GNTA 3UK1A 4NZOA 3D7MA 3COWA 4GUFA 4WJLA 2C3MA 3WRVA 1KMQA 1VMDA 3LT2A 4QQFA 3EVDA 4D97A 2FZCA 3O7UA 2CDAA 2ZT5A 3C0KA 5I7EA 4YMSA 1RQ7A 5I7WA 1YBVA 3T9PA 3B82A 4YRIA 4LECA 4GE8A 3RG2A 4DDVA 1DUVG 2IEIA 2Q8NA 4Y2PA 4LOHA 3UT6A 4BFYA 2WMGA 4PQRA 3R8GA 1OCBA 2Z08A 4W9RA 5DHAA 2GEUA 1CYDA 1CP3A 3LVBA 2WV8A 2OQYA 5EQFA 3S27A 4INFA 5EEHA 1NE7A 3EDEA 3LCGA 2R9RA 5IS2A 4JYDA 4C7KA 2RGAA 5JZSA 2WJGA 3UAVA 1E63A 2W0MA 2G28A 2RGMA 1J0YA 1PP4A 3CB8A 4BO8A 3MMDA 3FOWA 2J8ZA 2R66A 5JJCA 5HNUA 3AJ7A 4RFSA 5IKOA 5K3FB 1I5RA 1FTNA 4GIEA 4AK9A 3F46A 3ROKA 4COOA 1BQCA 1LEHA 2OFFA 1R3RA 1PE1A 1E1CB 4R71A 1U0RA 1WZCA 4C04A 5EE0A 4V0NA 1QPRA 4PIPA 3W8RA 1Z6KA 2HTFA 2Q07A 4HPGA 4ROQA 3VKBA 4AS2A 3ZE9A 4D9GA 5EYPB 2O2XA 3B3DA 1GPKA 3BQ5A 1DWQA 4X22A 3VOIA 3WJAA 3AR4A 2IS7A 3VR2A 3A4YA 5AJHA 1DHPA 3TN3A 1G8GA 1E70M 3LKBA 2WZCA 3OECA 4LF2A 3OJEA 1JE1A 1FRFS 3HG4A 5LNSA 3G2QA 3GX9A 1M66A 1Y7HA 3RRNA 3EOUA 2DLNA 5G1MA 4QOHA 3T8YA 1Q66A 4G85A 4IG2A 4ZCMA 1TVCA 5HQ3B 3H9GA 3NDZA 3P20A 2XGSA 2G4LA 3TW9A 4KWOA 4GMEA 1KVSA 3I45A 2CLFB 5B7QA 4O0MA 3IDZA 4LHWA 5G4EA 2A1IA 4PM4A 1BRLA 3MV01 4BCCA 5G3ZA 5IU6A 3TLQA 1FUUA 4MZ1A 1P0BA 4NZYA 3MQTA 4A2CA 1FX0A 2FCAA 4CMBA 5JYBA 2NVAA 5TMEA 1AJZA 2XSXA 4POCA 3P8ZA 3VYUB 2HI0A 3C5EA 2Z2IA 1ORDA 2YY7A 5FJPA 4ROSA 1F8MA 1T8WA 5M5BA 3UQNA 3LA8A 1TAUA 4LVDA 4L4MA 2B35A 2GVDC 2O8NA 4KH2A 4ZPXA 4LUSB 2BFEA 1O94A 1XLGA 4PY2A 1TPWA 4JQ4A 3ZQUA 5KS2A 2VYVA 4OUEA 2ZSJA 2H85A 5FV4A 1XZIA 3LY8A 4QRHA 5BO5A 3FXGA 1RU3A 2H0RA 3EBOA 2O52A 1KWKA 1AK1A 4GUDA 3V1MA 4Q4CA 4XRRA 4MMWA 4E3TA 4QD3A 1TJ2A 4B9ZA 5IX8A 2YXEA 3BKXA 4QUGA 1P9LA 3ONBA 1QHYA 3JWJA 1DIAA 3UWPA 1OINA 2PWZA 1ODKA 1MZPA 1PJLA 2PGIA 3K5IA 3AZPA 4MLRA 1IATA 3VAZA 3UJ3X 4YHGA 3RK4A 2FUG1 1EFDN 4H8UA 2FMOA 3GAYA 3ZKWA 4KCGA 1OZGA 3S47A 3U5UA 1ZMXA 3T7VA 4LBUA 5FJUA 2IXEA 3N28A 2CD7A 3A5VA 3WQEA 3PS7A 4GXMA 1SBTA 5G41A 2B5WA 3OEHD 3UF9A 3LCVB 4EB0A 3B60A 4MK4A 2LDXA 2L0XA 3R3ZA 5ABTA 3DB1A 3VNKA 1SW0A 1QWKA 1E58A 1GY8A 2AI2A 4QHYA 5ESDA 2FX3A 1H4TA 2C15A 5COQA 3WNCA 3FDIA 3GA0A 3ZVNA 1BD3A 1CB0A 3R3XA 5JADA 4EZBA 5AM0A 3U9LA 1G6KA 5AESA 1SBZA 3BLEA 4EW3A 3TYXA 5LQDA 4IG2B 2BFCA 3AHGA 3AHTA 2AUMA 1MX5A 5EMKA 3AOGA 3COPA 4ZVSA 2BM8A 3ZGNA 1U3WA 2B4KA 3H12A 4R1QA 4ZXOA 1C8VB 2BFFA 3UT5B 1Z5ZA 1U1CA 3STTA 4OKNA 4DZIA 5IJ9A 3LQRA 4LY8A 3QTPA 4GQIA 3P2IA 3OX3A 4TMXA 4AN4A 3AYXB 1FX0B 2YZRA 1FFAA 2Z0MA 1WQ4A 1Q84A 1W54A 2EXXA 1E1DA 2XHZA 2OT1A 4NOJA 3GD6A 1BVNP 3NPXA 3TTUA 2B92A 4MQFA 3B9PA 3KVKA 3PUZA 1XJ0A 3DO8A 4BLWA 1YACA 4EUHA 4I66A 5E9QA 2Y1EA 3CUJA 2WJVA 2X8WA 5LZ9A