5EMLA

Crystal structure of prmt5:mep50 with compound 10 and sam
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 203
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emlA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emlA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emlA02
4ER0A 3I53A 4PNEA 3G8BA 5KS2A 1G8SA 3LBYA 1L1EA 1XXLA 3P97A 3PT9A 5EIFA 3AYTA 3PS9A 4EKIA 4ZB0A 1RJFA 3AJDA 4EAYA 5CVDA 1QTWA 3M0HA 3UVAA 3MTEA 3SVZA 1A0EA 3O4FA 4DM3A 1EG2A 1BC5A 3OZSA 2IDJA 3VYWA 3BKWA 3HP7A 3V97A 3QXBA 5KQRA 2QULA 1HMYA 5EGSA 3KR2A 1R00A 1XCJA 5C1IA 2ZIGA 4A6EA 4AZTA 5IKMA 4DA4A 4PIMA 3UA4A 3CVOA 3FUVA 5DLYA 5GIPE 10MHA 2IDKA 3P2KA 4OX9Y 1XDSA 1U2ZA 1G6Q1 2VDWA 1P1CA 3FPGA 4XUDA 3BKXA 5ICCA 4DCGA 4DCMA 3TFWA 3PFGA 4F84A 2UYCA 1VPTA 3BXOA 3KQMA 4Z2YA 2VDUE 5K0LA 2AOUA 2DULA 2UYQA 5DT2A 4PYJA 4M37A 4WXHA 4OQDA 3ITYA 1VBFA 2B3TA 3GJYA 3HA3A 7MHTA 3KQWA 1G38A 5EMMA 4RTMA 3NWBA 1PJZA 3KQYA 3FTFA 4YTUA 3M6UA 4AZWA 2I57A 3XIMA 1UWVA 1X1BA 5EEGA 2R3SA 2PKWA 3CWHA 5DXAA 5DSTA 1JQDA 3M6WA 3LMZA 3EGIA 4RYLA 3FTEA 5LQKA 5EEHA 2B78A 2B25A 4PINA 2EJTA 4GJJA 4FT2A 1N2XA 3BUSA 3CJQA 3JWJA 2IH4A 2FK7A 4RTRA 1Q0SA 4E2WA 4YUZA 3N4AA 4R05A 5HOQA 3NWEA 3BT7A 4HG2A 5CVEA 1MHTA 3EGVA 2Z6UA 4XKMA 2ONYA 4ER6A 3NDIA 3DMGA 2DPMA 4QTUB 1K77A 5CVUA 3DOUA 5E9JA 4YUVA 4RV9A 4DVOA 4IV8A 4P7JA 4ZB5A 3Q87B 4YV1A 4FGZA 3KQPA 1JSXA 1TPYA 2XYVA 4QDWA 3A7EA 3HCAA 1RI3A 3C0SA 3NDJA 4MHTA 3NTVA 3UJCA 3QYSA 4P7GA 3KKZA 4PCLA 1SG9A 2HK0A 2ZIFA 5DM1A 4MIKA 5F2KA 9XIMA 4BLVA 1JTEA 1UIRA 3KCLA 3ITVA 2QYOA 1NT2A 4FSXA 3KPWA 5P8WA 1IY9A 3OFJA 4PCAA 3TM4A 1XYBA 4E2ZA 5FA5A 2AOXA 2CMGA 2PSSA 3GRYA 1XDZA 5FULA 2PY6A 3QZAA 2GUBA 1DE5A 2X7WA 3EVFA 4CWAA 3HVJA 1Y8CA 1XVAA 2G71A 3JU2A 3ID6C 3T7RA 5E8RA 4K3ZA 1RI5A 4R6XA 1KPIA 5AVNA 5K0EA 3LPMA 1XLGA 1ZGAA 1XINA 1P39A 4C05A 1NW8A 4X60A 2XVAA 4FT4A 3P9IA 5U4XA 5T64A 1JTFA 2ZULA 2QW5A 1KYZA 2WA1A 3FUXA 1OR8A 2EJUA 1NV8A 3PX3A 5EQJB 2HR1A 2CWWA 3VC1A 5DX0A 2PXXA 1JG4A 3BWWA 1P1BA 5LQUA 5CVJA 1YUBA 3IV6A 4Q7IA 4YTSA 3I64A 3A25A 1NW3A 3G2OA 3C3YA 3GRZA 1X1DA 3NVMB 3BGDA 3FPHA 4HTFA 5K05A 4PYOA 1L9KA 4RTOA 3GRVA 3UU0A 4OBXA 5K0BA 4BY9E 4K1GA 3P2IA 4KIGA 4GOMD 4DF3A 2ZZMA 5E1DA 1R6AA 4HGYA 3FTDA 2FPOA 1XYCA 3AALA 2H00A 2O57A 2UZ4A 3HA7A 3Q7EA 4HTFB 5K8VA 3XINA 2P3QA 3M70A 5F2OA 3TQSA 3GWZA 1G55A 5HIKA 1D2CA 1VQ1A 4XISA 2IP2A 2QE6A 3EVCA 4C07A 2ADMA 3M0MA 4AZSA 4UOEA 1YZHA 3VYLA 1QUMA 4MTLA 5B7YA 4QE4A 3HM2A 3OU6A 5H02A 3ANXA 2OKCA 4E30A 1RI2A 4E70A 5JUWA 3K6RA 1RI4A 3M0LA 3MGGA 4HC4A 5DM0A 3DTNA 2Z6AA 1I9GA 2AOTA 3P14A 3P8ZA 1F3LA 1AF7A 1X1CA 1AQIA 3VNLA 4CTKA 2OB1A 1PRYA 5CVVA 2ZZNA 5EC8A 1MNZA 2O05A 3UA3A 1L3IA 3LCVB 3BWYA 4YTRA 3HVHA 2BR4A 4DQ0A 1BHJA 5B7ZA 3C0LA 5M5BA 2P35A 2ESRA 2JG3A 1XIEA 4BLWA 1L3BA 1KYWA 5FUBA 4E2YA 5EMLA 5KQSA 1XICA 5CUQA 3DLCA 4RTQA 3OE5A 2P1DA 3OZRA 2NP7A 4XUEA 4YTTA 1ZKDA 2GAFA 3R24A 1RI1A 2PT6A 2Q02A 2YQZA 2XIMA 2ZBPA 3DMFA 4PYKA 2NXJA 5E9QA 1XLEA 1YX1A 2G72A 3ERCA 3MHTA 4PYNA 2ZBQA 3P9CA 3SX0A 1VL5A 3IHTA 5EG5A 4C03A 5D1NA 4HH4A 4IKPA 4X41A 5XIMA 2O06A 3EGEA 1UFKA 1DIDA 1NW5A 3GGDA 1TZ9A 1XLCA 4OVXA 1M6EX 4EKGA 5K0GA 3DR5A 1XIFA 3NGFA 2IBTA 1AQJA 3DXXA 2C7PA 3DH0A 3TR6A 3ITXA 4YTQA 4EK9A 3C0KA 2PX8A 1D8WA 3A4TA 5KYGA 3SGLA 3G88A 3BANA 2GPYA 2HK1A 2VS1A 3FYCA 4E2XA 4MWZA 1VP3A 4JXJA 4XCXA 4GUAA 2H11A 3E7PA 5EHGA 1VP9A 4RVFA 3EVDA 5EHIA 3KPVA 3KQVA 4C4AA 3NJRA 3REOA 3QC0A 3I58A 5T6BA 2QRVA 4YMHA 4YUWA 2PBFA 4QPNA 3GO4A 1ZQ9A 3GRRA 3HCBA 2FK8A 3DXZA 4OA8A 4C06A 4LNCA 3LGAA 3TPZA 2IH5A 2FHPA 2XBMA 3KQTA 3PLAE 1I6NA 4GC5A 1FPQA 3GU3A 5K09A 3M6XA 3U81A 2NP6A 3THSA 1XCLA 3PB3A 3IUDA 2QM3A 5BW5A 2WK1A 2ZTHA 4YV0A 4V0QA 1JG2A 2IH2A 5LQRA 4OA5A 1QZZA 3MAGA 1IXKA 3GCZA 4B17A 3BGIA 4RVDA 5FHQA 5K0FA 5XINA 3FPFA 3KBWA 3M0YA 2B2CA 1A0DA 2IPXA 2PT9A 3EPPA 4IV0A 1I1NA 4GEKA 3VSEA 4RX1A 4RTPA 3OU7A 3I5UA 3I9FA 3HVKA 3O31A 3PVCA 3B3JA 6XIAA 1EAMA 2AZTA 1XLHA 1WZNA 3TM5A 2O0LA 3MCZA 4YMGA 5CCXA 3FRIA 5DRTA 2N47A 3TLJA 1SQGA 1D2GA 3SSOA 3KCJA 1XIGA 2C7RA 5DTRA 1O9HA 4GQBA 3HCFA 1R74A 1SUSA 3E23A 3KWSA 1KHHA 5DSXA 6XIMA 3KPJA 2BH2A 2FCAA 2GH1A 1RJEA 2EG5A 3GRUA 2PLWA 3KPYA 5E1OA 4DMGA 3SM3A 4PGLA 1G8AA 2V7EA 1XIDA 1XYLA 2ZVRA 3L23A 2K4MA 2GLKA 3CNYA 1TW3A 2PXAA 4NECA 3UWPA 5K01A 3FRHA 3AY0A 4E32A 4GOOD 5CM2Z 1EIZA 4KDCA 5EOVA 3CGGA 5JR3A 4K6MA 3IEIA 4ZB2A 2FYTA 2UYOA 4FZVA 4W4QA 1O54A 2YXDA 3KQQA 2OZVA 2YTZA 3G2PA 3B89A 3DX5A 2QRVB 3GNLA 2AOTB 2AOUB 3LKDA 5DM2A 3TOSA 2ZBRA 1NKVA 1JG3A 4HGXA 3CQHA 3BZBA 3CQJA 4ZBCA 3KQSA 4ISCA 2ZWAA 5EIWA 1G60A 4QQNA 3JWGA 1EQAA 3UJ6A 5ICGA 3CBGA 3PFHA 4GOND 1KR5A 3M0VA 2NYUA 1S5MA 2HMYB 5CD1A 3G5TA 4ZTBA 5K0NA 5IH3A 5C9ZA 1YZ3A 2AVNA 2IGTA 2AN3A 4FR0A 4FS8A 2OO3A 1SQFA 4L7VA 5EPEA 1EJ0A 3LDUA 5HIMA 3UJDA 5BP7A 4RTSA 3EVZA 1V39A 3AXTA 1KPGA 2P8JA 4HGZA 2ONZA 4ATNA 2BM8A 1MUWA 3OZTA 4M7RA 5DPMA 1P91A 3UZUA 3X0DA 3CKKA 4KVZA 5HFJA 3AAMA 3FTCA 5K0CA 4DKJA 5CIYA 2GA9A 1FBNA 3LHDA 3UJ7A 3DUWA 1IM8A 4QQKA 1X1AA 4PONA 1A0CA 1FP1D 3AXSA 4EQZA 3G89A 1Q0TA 4EVIA 3MQ2A 3ORHA 1BXCA 4PGHA 2BM9A 1N7JA 2AOWA 2EFJA 2FRXA 1XDUA 2ZVJA 4KWCA 5ICFA 2AR0A 5FQNA 5GWXA 5HIIA 3KR9A 5CCBA 3DXYA 3BZGA 1QYRA 8XIAA 4IWNA 2JHPA 1O1HA 3OBEA 3FZGA 1DL5A 4A8NA 3EVGA 2PVCA 3QOXA 5FHRA 1ZGJA 3KR1A 3WSTA 1FJXA 4XIAA 2G70A 1DXIA 2I56A 5B80A 2I62A 1XIIA 3KBMA 4X1OA 1XLDA 1QT1A 4P58A 2Y1XA 8XIMA 3F4KA 3CQIA 2PX5A 3CCFA 3G8AA 3LECA 3SR4A 4A8RA 5EMKA 4F86A 2AS0A 4YUXA 1S5NA 2OXTA 2I6GA 3ELUA 2UYHA 3VNIA 1DUSA 5TNVA 3ME5A 3TMAA 1KXZA 2ORED 2I7CA 3MB5A 4QEHA 1XLLA 4HHLA 1NW6A 2AVDA 2HTEA 2HWKA 5I7GA 4X61A 5G02A 1EJ6A 2P7IA 3RODA 4YV2A 3ER9A 3KCOA 2PV0A 3HCCA 2GLUA 3MCTA 4WVLA 3DBNA 3LX6A 3DMHA 1R18A 3LCCA 4PYLA 4KRGA 4U7PB 3CJRA 1VIDA 2KW5A 5GIOE 3E05A 1XLAA 3KHKA 2G0WA 1Z3CA 2PX4A 4MQ4A 2IIPA 4C04A 4P7KA 5DM4A 3G2MA 4OQEA 1WG8A 2OYRA 5E9WA 5XIAA 2QUNA 4GBED 5HEKA 3GXOA 3K0BA 1QAMA 4Y30A 3MTIA 3OPNA 3RW9A 3S68A 3PTAA 1YF3A 3QV2A 1QAOA 1SUIA 2ERCA 1O9GA 2JHAA 4AZVA 2C7QA 5EKUA 4CKBA 5FWDA 2GVEA 5DXJA 1N7IA 2YUIA 3R3HA 3M4XA 5E2BA 3CJTA 5EZSA 3NMUF 4R8RA 2P3LA 3GNXA 3SMQA 4U7TB 1NE2A 5GP1A 3JWIA 3TKAA 3ITTA 2GYIA 4PYIA 3NW9A 2CKDA 2ZLBA 4QEEA 5E8JA 4EACA 4FSDA 4PFHA 1QAQA 2XISA 2P41A 3KR0A 3OU2A 3B5IA 1SKMA 4A6DA 2BR5A 2JJQA 3M6VA 4HRAA 1NBHA 5K03A 4CTJA 4KDRA 4QE1A 3IUIA 1JSZA 2PWYA 1M6YA 4BP1A 4QTTB 4RSRA 4CKEA 3FPJA 5GM2A 5LQNA 2NNWB 4RTKA 4E31A 2IFTA 3U3HA 1NW7A 5DX1A 4QVKA 1JQ3A 2YXLA 1VE3A 3MERA 2ZIEA 4M38A 4GOLD 5C0OE 1XLFA 4LWPA 3C0QA 3T7SA 2BR3A 3BDKA 2XVMA 3H2BA 5EVJA 3UJ8A 3T7TA 1OADA 3BWMA 4HHMA 3VNKA 1H1DA 2AOVA 2G8NA 2HNKA 4R8SA 5HIJA 3VC2A 3UJAA 3VNJA 4DUOA 3KBVA 2HCVA 4GLEA 1B42A 1KPHA 2NXCA 3FYDA 1R8XA 3G2QA 2ZZKA 4PYQA 5DTMA 4RTJA 1GW9A 1T43A 2OB2A 4C08A 3B3FA 2P3OA 1XIMA 3HNRA 4PIPA 3UXIA 1YB2A 2AN5A 4E33A 4AUKA 3CC8A 4Y2HA 3ELDA 1L3CA 3HA5A 1KP9A 1NBIA 2YR0A 2OBFA 3C3PA 1VLMA 2C7OA 1X19A 4RTLA 5J8LA 3FVMA 1WXWA 2P7HA 3QOWA 4XUCA 5B1SA 2JH9A 2ZSUA 1MJFA 2ZFUA 5FQOA 4O29A 3SXJA 4ER3A 3ELWA 3TRKA 2XYQA 5BW4A 4G56A 4XSLA 3VNMA 2OY0A 3EVBA 3G7UA 3P9KA 3KQOA 3PX2A 1I4WA 5ERGB 1CLKA 1XIHA 2NQJA 1WS6A 3P71T 5FCDA 4AX8A 2G1PA 5DRYA 4F85A 5EZQA 4US6A 2E5WA 3KBNA 5AVHA 3LKZA 2A14A 5DTQA 3R9XB 3CQKA 3DP7A 4RVHA 2AN4A 3P2EA 2ZW9A 4R6WA 5HILA 3E8SA 2XYRA 3SSNA 1JR4A 5F2NA 5KVAA 2EX4A 3HVIA 4QDPA 5ICEA 5LR6A 4A8IA 2NXEA 2Q41A 3C6KA 4P7FA 2X7VA 3A27A 3WQOA 3C6MA 3FUTA 5E1MA 4KW2A 3L8DA 4HSGA 3UFBA 4J4KA 3HTXA 1BKYA 4E3VA 2B9EA 2CMHA 3D2LA 4PWYA 4HNOA 5EKXA 5K0JA 3OE4A 2Z6QA 3EMDA 2F8LA 2IBSA 3ER8A 1TW2A 3SSMA 4YUYA 2I9KA 5MHTA 1XLBA 2J6VA 3AWIA 1WXXA 1XP3A 3V8VA 2YXEA 1BOOA 4LWOA 2VDVE 3EMBA 3KPUA 4PYMA 5HZMA 1KIAA 3LL7A 4QVGA 2QUMA 3EEYA 2PXCA 3IYLW 5FTWA 5T67A 1RJDA 4X63A 3ITOA 1XLJA 2R6ZA 4QDJA 1XYMA 1WY7A 3BWBA 2OPBA 1DCTA 3KTCA 3DLIA 3U0HA 2NQ9A 5FADA 4GJIA 2GS9A 1XLKA 1RJGA 2JHCA 3JWHA 1XJ5A 2VP3A 2BZGA 3FPEA 3DULA 4A8LA 4OBWA 4DZRA 5LQJA 1XYAA 5LSAA 4H0NA 3TC3A 3T0IA 4V0RA 4ER5A 3GDHA 4CXMA 3AYVA 4GF5A 4LECA 5E1BA 1DIEA 7XIMA 4LG1A 3UBTA 4KIFA 2G4JA 2NQHA 1NV9A 2PGXA 3R0QA 1INLA 3LDFA 3IUHA 3HEMA 4CKCA 3B3GA 3ELYA 3LSTA 4QPPA 1M0EA 2WA2A 3HCDA 3KU1A 5H1WA 5D1HA 3BGVA 2XINA 3BWCA 1ORHA 3LCUA 5BXYA 2ZWVA 1ZHFA 1FP2A 4BLUA 4XSMA 5FA8A 5LQAA 1XISA 3OCJA 1XIBA 2ZCJA 3FUWA 2Y1WA 2VZ9A 1ORIA 1JQEA 2PWPA 3R6TA 1SVUA 3BZJA 3G5LA 3ITLA 5E2AA 1DE6A 5DWQA 3LBFA 3O7WA 3TKYA 1F38A 9XIAA 1ZG3A 2O07A 3A7DA 4POOA 2HV9A 3EVEA 3XISA 3FUUA 3THRA 2LD4A 3LDGA 4M36A 2QY6A 2V74B 2NXNA 3A26A 3UJ9A 3TVAA 3HCEA 4RWZA 3RIEA 2PX2A 1XTPA 4FP9A 4RTNA 3NVKI 4KW7A 3P9NA 4RVGA 3M0XA 3P6LA 2ZDSA 4ER7A 9MHTA 5GOZA 5EMJA 2H1RA 3M33A 5LQCA 2OU4A 3KBJA 4PGGA 1R8YA 2JH8A 1D2HA 2YVLA 1JG1A 2CL5A 4GC9A 1YFLA 3EEOA 1QANA 5H6HA 8MHTA 2GB4A 4QDKA 3KBSA 4BP3A 1BXBA 1HNNA 4XIMA 3GIWA 1XLMA 1XLIA 5FWAA 3UJBA 2YX1A 2P40A 5GM1A 5DX8A 1XIJA 3OFKA 2PJDA 3B7PA 3EVAA 4EMSA 1AV6A 1YFJA 4QE5A 5GINE 1I60A
chains in the Genus database with same CATH superfamily
1EA9C 3GKAA 2NM0A 1MJGA 3OMLA 3IGUA 4V2XA 3MN1A 4U8HA 2M6LA 1L7AA 2C31A 3UYIA 4P4NA 1MXSA 4JN6B 3PCTA 3MKCA 4QA9A 1W5EA 4UKDA 2PUGA 3LLXA 4GHWA 1S2LA 5ICCA 5AHLA 5KUTA 1F3XA 1XG4A 3KTSA 3R3WA 1Y6GA 1VIWA 1X97A 4IGMA 1PNTA 2QN1A 4QC2A 4PF1A 2JFHA 3R9WA 2OEJA 1JFFB 3M6WA 5DXAA 3TTUA 4EVQA 1C1DA 2V6FA 3PHHA 2P30A 1NUPA 4H77A 3PBVA 1QCYA 2ZS7A 2C5AA 3DB1A 4DX3A 2WTEA 3A6JA 4N65A 3STVA 5HWSA 4ZEPA 2ZI5A 3OF3A 3ARTA 3WZLA 1GTRA 3K0KA 1TC2A 1U1DA 1MCZA 3TNYA 3ZWNA 3RLVA 4Z08A 1XZCA 1G7RA 2FEMA 3DE4X 1G6CA 1P0PA 3CX6A 4JI3B 4JHXA 1XLGA 1SNYA 1UCFA 3E2IA 1Y33E 4G25A 3DMDA 3BQ9A 4F4FA 3FE2A 2XXJA 1SBNE 5LNUA 2VWQA 1QHYA 1T8SA 2E5CA 1XRFA 4ROSA 4YO7A 1ELSA 3MWAA 1UOKA 4C3OB 1KI9A 1H4VB 1DPFA 1GDTA 2H1WA 3VYLA 5ABFA 3WWEA 1B0IA 3HBFA 2QV4A 1FMCA 2D3WA 4M8IA 1AZ1A 2AR9A 3HFRA 2FIQA 1FXWF 1KQFA 3ESQA 1EFAA 2NACA 3GU9A 2REOA 1VJCA 3MBDA 3KJIA 5I8WA 1Z34A 4C22A 5B6PA 4PZZA 4IHJB 4K68A 1V4NA 1MO6A 3E0WA 1QPRA 3VPGA 3C8HA 2A9RA 3D0KA 3D2CA 3RRZA 4ALIA 3TFXA 3RK0A 3ZY3A 2O5EA 3ONNA 1XEXA 2VT7A 2XCUA 1E6UA 1VL2A 3UH0A 3NM6B 3ZGZA 2X23A 5LA0A 5ESRA 1JV2B 5EHIA 3E3NA 3A4VA 3QBVA 4AMZA 4BEBA 2CW5A 5JZVA 3F47A 4PY2A 3IMCA 4WZAE 2IWRA 5HNKA 1QTNA 4JDUA 4L7ZA 2ACRA 4R1SA 3OPXA 4D71A 3BIFA 1E6EA 5F5LA 4R1QA 1NXOA 3RVRA 1Q4WA 2DFNA 2PM8A 5LCXA 1G20B 4MVCA 1XS2A 2OFWA 3CEJA 2ZE0A 4ZB2A 1DTSA 2RBKA 4OL9A 1K03A 4Q3BA 3IIIA 3MOIA 5ESWA 4YI5A 3MW8A 1T8XA 5AXBA 3G2NA 4QTZA 5EJ9A 2R6FA 4YAIA 5L4NA 1AA9A 1GT6A 4JX6A 1QI3A 4QHSA 2CLOB 1JJVA 5JWRA 2YWXA 1XWFA 3K15A 1AH0A 1GQNA 3TOZA 3GLFE 3VA7A 2VJYA 2ZJ4A 3URAA 1ZCFA 4JDPA 1PWXA 2BFMA 3EC7A 3VDNB 3JQ7A 2IY7A 5EUQB 4KLAA 4EPXA 4C6FA 5ICFA 4ZOCA 2SCUB 3OOJA 4C5AA 5CLWA 4D98A 2HI0A 1TTTA 4JKMA 5FESA 1ANKA 3C5CA 5E3IA 3TLZA 4JAVC 2F1KA 3PBGA 3JASB 3C6CA 2AS0A 3W73A 4R0VA 1NDWA 1C7SA 3O8NA 1DKNA 5FNVB 2HH9A 3WQEA 1V5EA 3H23A 4OKIA 4UQDA 4B92A 3PFIA 2DP3A 2WHLA 5E6RA 2WIDA 3W5SA 2HJHA 4GY1A 2ZRMA 1SPQA 1NOFA 2CUZA 3S68A 4WKNA 2VO1A 5D9PA 5M2QA 4HWRA 2R1NA 1R0SA 4CVWA 4MG4A 4J75A 4KMMA 2GPBA 2JF6A 2WIAA 1PJBA 4RW3A 1DLJA 2IEYA 3EULA 3P20A 5CJPA 2C8KA 4REQA 3M5CA 4NAVA 1KBZA 1JG9A 3OOQA 5SYAA 4HNAA 1E55A 3W05A 3NWOA 1ST2A 1LDCA 2OT3B 1H3FA 1R8XA 3OHIA 1GW9A 4NE7A 4WY0A 3O05A 1H9AA 3FHOA 3GGSA 4V1CA 3QOWA 4B3ZA 2V68A 2X7XA 2H9AB 4EI7A 3RS9A 1DDOA 2PDFA 1E79A 2IYFA 4I5GA 3WTCA 4AC9A 3UWZA 2ZW9A 2C2WA 4W8GA 4P7FA 2XIIA 3CRNA 5JDIC 3X2EA 4LXGA 3VJRA 4RC9A 3FTFA 3W0KA 3V00A 4E6PA 4AYSA 5HZMA 1W9PA 1MPXA 1I51A 1RZUA 3QVLA 5C52B 2HB6A 3TMKA 4CKBB 4L9XA 7MDHA 1UH5A 3M89A 5ILQA 4MGEA 5C9UA 4L7QA 1Q6EA 3U3DA 2HWYA 1EFUA 2R79A 5IOBA 4F8EA 2CFFA 2XKJE 5DWQA 3WH9A 4W5UA 4AC7C 2HV9A 3GLFB 3H1TA 2ZUEA 3MJRA 2H0QA 1TJPA 4FXFA 4OOUA 2YVLA 1F14A 1Z0UA 4KO1S 4BP3A 2BSAA 2QTTA 4EGJA 2IX9A 3BAFA 1BXGB 3WJYA 1GAXA 2RGRA 1PW7A 5LLTA 1LF0A 3G0GA 2VHCA 2VYCA 1UZ4A 3BIOA 1U28A 4FYKA 4MTVA 4G67A 4WGXA 2A0NA 3H1BA 4CN1A 5JRDS 4U31A 3UENA 3EEZA 2BONA 1W91A 2PVSA 1GVQA 2AQHA 2PDPA 2DR3A 4XJVA 5K6RA 3B1FA 3WD2A 3AEZA 5BNKA 1ZPDA 1IY1A 4UU7A 4X0EA 3R1ZA 2EJTA 1ZENA 4ZO6A 4WDWA 2G0AA 4DLXA 4RTRA 2XMCA 3I2IA 1KXJA 1C8BA 3RS7A 3TNJA 2Z6UA 1PS0A 1PZNA 5AI0A 5E4TA 1PN3A 3UANA 1PIGA 3DTTA 3OPYB 2QCEA 1S3SA 2O48X 1MRAA 4GI9A 3ABIA 3WXBA 2P50A 3LGDA 2E87A 2CMGA 4HJWA 1FXWA 4G9PA 2GA8A 2CW6A 5IT0A 5T4BA 5T9BG 3N5CA 3NFRA 3GCWA 3WKCA 1E0UA 1PZHA 4A10A 3WJ1A 2IXGA 1X1DA 4C0XA 1JKFA 2G3YA 4LYAA 1K9FA 1QPOA 1N7KA 1OX5A 4JS3A 4OMCA 3MKKA 5K8VA 1UW9A 3TBFA 4OEHA 5AYZA 2J7PA 3MGGA 3MPOA 3QEMA 2JF7A 1SHUX 1M1BA 4ZIRB 3NT4A 2PFHA 4PCPA 2WFZA 4RPHA 4BNZA 1GOWA 3HM9A 4GLBA 3LLSA 5CB4F 1Y8RA 4RTQA 1SM9A 2P1DA 1M7BA 1A8SA 3LI0A 1T8YA 4KPYA 1P73A 1FDYA 1WHSB 3G6KA 4OXRA 4QUIA 2D23A 4DMRA 2ATVA 2VDPB 1Q7BA 1Y8ZA 4V2IA 3Q9LA 3GLSA 2BFCA 5IT4A 4E0CA 3RAGA 5F64A 2R8XA 2BVDA 3DZKA 3NBXX 4AUNA 5C70A 4LVAA 1QIMA 2BSQA 1AHNA 1SR8A 2Q3BA 4M1QA 2VEFA 1GVYA 4PC7A 4LNCA 1GUFA 4Z0SA 2IZ6A 2OX4A 1QI5A 1L7EA 1DXHA 1GO2A 4ND4A 4P3KA 4JJIA 4MEAA 4AHPA 3E84A 2QZRA 3K0AB 2JA2A 2JFWA 5EN4A 3CWOX 2B83A 1XZJA 1VKFA 1YQ2A 3MMUA 3GU3A 3QVMA 4E6MA 4F91B 1GQSA 2VYND 1RU3A 2QGYA 2HVNA 2X4GA 4EGCB 4DV1B 4RXUA 4P84A 1QHEA 1OIVA 3FD8A 5FBWB 4HGXA 3W2TA 4UQ9A 2H4XA 5CFOA 3FYTA 3A4IA 4CUZA 5JMUA 5FL3A 1DLIA 6TAAA 5D3ZA 2OD2A 3QVVA 1V6UA 1E58A 3HRIA 3OKCA 4EM6A 1K9EA 1A7KA 2ZTLA 5HZKA 2ATMA 4QQKA 4ZVQA 2X76A 4OJNA 2GN9A 5GJCA 3E0QA 5DHSA 1QLWA 3TR0A 3QXSA 4WZ6A 5FHRA 5G0WA 1SN7A 3HEAA 1VZ2A 1NNI1 3KJHA 1OFUA 4HB3A 3GU1A 1EX1A 5DW0A 2DW7A 4HZ8A 4QSHA 5T3UA 1BQ3A 1XTKA 4IH3A 3M9WA 2YB1A 2WF6A 3KP0A 3YPIA 3HP1A 3BTOA 2P9QA 1K3UA 1W49A 1BTCA 1ZIDA 3FZNA 4F9JA 4BKNA 3F73A 2ZXFA 1V25A 2GJKA 1DG1G 3RHSA 3SMVA 3T9EA 1P0DA 3MP3A 3SJNA 2ISFA 1SIBE 1A8IA 1XU9A 3A3KA 3D1JA 4HZUA 4UDYX 2AXEA 2PH7A 1K6MA 3ULKA 2YCEA 4BVAA 5I9IA 2QVCA 3THCA 3FSTA 4GLEA 4D9CA 3A22A 1EUQA 2D5IA 2HU2A 5E38A 5IRPA 1D4AA 3DLTA 1GVSA 3SJZA 4J2PA 4LYPA 1KEUA 3D8NA 1JHQA 4DYDA 2A14A 3PSWA 3P2EA 5A7HA 2OECA 1FP4B 4O2BA 3CLRC 1WUIS 2GJAA 2WE8A 3BK0A 1R7RA 5FBHA 1E3EA 2ZR8A 3EZFA 1VZWA 1NVKA 2PLAA 1YI0A 2WHKA 4UNRA 1UBUS 4Z1BA 5JC1A 4H2HA 4UAUA 4GSLA 3CPSA 4XIJA 1VLZA 3QKUA 4HBGA 2BGGA 4H15A 1YNOA 3L06A 3OAAD 4A5OA 5C7OO 1TIBA 3VDMA 2IQIA 4MDHA 1PNOA 3MIIA 4UNKA 2NVDA 4KNYA 3NMUF 3LAWA 3EXFB 5I06A 2W2MA 3SIXA 2O56A 1JYXA 3R10A 3WZMA 1X7ZA 1Q7GA 1DJXA 2JATA 4JX9A 3F9IA 2QY6A 3NVKI 2JLAA 5IAOA 3VVBA 1MDLA 3K73O 3N8DA 2BEWB 1PKXA 2DZUA 4X54A 2FU5C 4RM3A 4PO3X 5DEZA 1CDDA 4BGEA 3I53A 1E4EB 1WXFA 1EFZA 4GE0A 4XQ6A 4E08A 5DELA 1X92A 4L0QA 2P4QA 4K2SA 3WLOA 3MS2A 3WSWA 4NS1A 3MMNA 2ALRA 1KRWA 1R38A 3G02A 2WOQA 4RZUA 4F79A 3FLBA 5A1JA 1V08A 2FH6A 4KFPA 2R1TB 3AU6A 4JLVA 1X1BA 4B15A 4GKBA 1UD2A 3ABXA 3G2HA 5A2AA 2V6BA 1DO2A 4Q9NA 2NUTB 4IWYA 1QTIA 3L0GA 2C4UA 4EHHA 4A1OA 5U9CA 1ICEA 2MSLA 4L51A 1UINA 4UQEA 1Y65A 3VVMA 2E4VA 4ZI3A 2YA0A 5G3YA 1ITCA 4GZ6A 1UQUA 2DFTA 4GY0A 4LOIA 3U2QA 1OXVA 3QKRB 1T2NA 3A05A 4RDVA 1MEIA 2F6UA 2VRNA 3K7EA 5AKZA 2FZCA 3GNSA 2WA1A 1FBTA 1GGKA 1LQTA 5DKFA 4DJFD 3WQDA 1WDWB 3OJFA 3GPIA 5CB4A 1NFPA 4LJ8A 2JIEA 4J94A 3PD7A 4JQ3A 3T5GA 1UWLA 2FPOA 3K2IA 5ALNA 1N0UA 1OFBA 4Z4QA 1Z83A 2HTFA 1DINA 3VGJA 3PDUA 4NCHA 3Q45A 3A32A 3R5KA 4QDTA 4IIFA 1UKOA 2V3DA 1Q2RA 2V96A 1OW3B 2PRJA 2XUGA 4LBZA 3URKA 5IJXA 3LYHA 4N49A 1J0BA 1CE8A 1XT6A 4AU0A 4Z2LA 3N17A 1WW3A 3AXKA 3I6TA 2R2GA 1LOQA 3NZRA 1JH8A 3D6FA 4D9HA 3TLGA 4TMWA 4MSSA 4MV3A 3Q7TA 2JHFA 4DLFA 4B5SA 4XA8A 1QOPB 1OT2A 1U1UA 1P48A 1VC4A 4LQ4A 5JCZA 4W8LA 2I2WA 4ERGA 4A82A 1VL0A 1W5OA 1W9UA 4XD7D 1PP4A 1BKSB 3O07A 4W1SA 3M0IA 1A0DA 3EQ6A 1PE1A 6YASA 1Q5MA 3JALA 2OZKA 3BJFA 3L0BA 2GVDC 4IDAA 3IV3A 2FQIA 2NN3C 2VIIA 3O0DA 3URBA 4IHQA 1JDEA 5THQA 2EHHA 3RUHA 1U81A 2UXBB 2C57A 4MWBA 3KQUA 5FL7D 3CB4A 5FNVF 1FX0B 3RTBA 4B5LA 4R3WA 4W4QA 1E51A 4QDMA 1DBWA 4AJLA 4PQEA 3KO8A 4OOFA 1C7TA 1FW6A 3DAHA 4KMOA 2HS8A 2AL1A 1I24A 5FD8A 1VGVA 1NNSA 1OJXA 1MV5A 2VZLA 1EJXC 4CEXC 1FTNA 2H6EA 5CU7A 2OEKA 4NZ9A 4PONA 1EGVA 1HV8A 4DC0A 5HR5A 2AR0A 3HWX1 5TMBA 2P2ZA 4DWSC 4QCFA 1BMFD 1DL5A 5DLPA 5E5CA 2ZSIA 3KE9A 4ARSA 2I56A 1M34B 1X77A 1XLDA 1Z47A 2RHTA 4Q4CA 5JFOA 1UMCA 5BR7A 1H7OA 2IL1A 2HK6A 2O3JA 4X61A 4HDSB 4FB7A 2PODA 1GQQA 2CXRA 1NRIA 4W7IA 4EGAA 4FHZA 4L07A 2H2WA 1FIUA 5J23A 1D3AA 3T41A 3GFBA 1PSWA 1U8ZA 3AR8A 3GXIA 1O57A 5CB6A 5HNUA 5TE9A 4MP3A 4NYUA 1EFDN 4RH1A 4DWDA 1UAGA 1V16B 2OEPA 4BMXA 3T7AA 4AZBA 1UD8A 5DBGA 2JRCA 1Q6GA 3DCJA 2MYNA 5AZ1A 2ZWIA 3N74A 1XRQA 3IKTA 4TLMB 3QY8A 3FZEA 3WFZA 2CC2A 5EP1A 2H4FA 1ODCA 1XEWX 4HDNB 1Z56C 4B87A 2RGNC 4XQCA 2G7MC 4L4PA 1S5PA 1QU2A 1RQNA 2A92A 1XTVA 3PGMA 3SQWA 2NV0A 2LCFA 2RAFA 2V8BA 4CV3A 3SSNA 1J24A 3E12A 4TLLB 3CYFA 4IIXA 1M7GA 1NWTA 4EWJA 2ODWA 3PZUA 3AIQA 4D5GA 1RXSA 4EY4A 3S47A 2TRSA 1PJRA 3D02A 1XD0A 2R6DA 4UDOA 4JROA 1XLKA 2JKZA 3W7MA 1DB3A 3HG5A 4TRNA 3DVRX 1XVUA 3A31A 4G7FA 4C6CA 1ADFA 3I4EA 1CD5A 2C03A 1THMA 2YV3A 1GKUB 1EE1A 4BJHA 3USES 5JAPA 1IATA 2VYOA 5GQBA 1V5IA 1JZ3A 2AHRA 5JANA 1PWYE 1ZJWA 1S5VA 1KVSA 1IB0A 2GD0A 1PKMA 4RE5A 3AR5A 3IAHA 5DCBA 3UQZA 3OPVA 4L3OA 4L65A 4GZEA 1QTWA 1N8TA 1Q6RA 1C0KA 1QIKA 2G67A 3BKWA 3WKBA 5ALJA 4AEEA 1K8XB 3ASVA 4E8GA 4ZU6X 5D5QA 4X1KB 3S4TA 3ZLJA 2OENG 3L7YA 2ZPAA 2ZRIA 1C7QA 3CZQA 2Z43A 3L49A 1NI4A 1NF8A 3F96A 1UFVA 5MHBA 3ESXA 1GKQA 2E4TA 4KEAA 5LYYA 6A3HA 3AYSA 3GR7A 1ZBVA 1N2XA 3NYRA 3ASUA 1RWQA 1RZRD 5CPOA 5HAOA 5BSMA 1TLTA 2Z04A 3EBLA 3HFSA 2OFOA 2W7TA 3KDAA 2I6UA 4LXFA 4RF4A 4ZTXA 2XH0A 5EJ2A 1UC4B 2VTEA 3A4MA 1QYVA 4ZAGA 3CLVA 1XW8A 3VOIA 3OYZA 5F4XA 2NVUA 5TPZA 1NVTA 2GD1O 2HXSA 4X6LA 4YRMA 5D09A 5AVNA 3JARA 2FKAA 2FYMA 2XMZA 4JYFA 3SK0A 3WG9A 1FX0A 2BP1A 3A1NA 2XMDA 1W6TA 1UWAA 1ZZMA 3ZJTA 4M86A 2AC4A 4LAKA 4PUKA 1EBFA 1ECBA 3NQAA 2AQVA 3GHHA 1LSJA 4PN2A 3SC6A 1WAUA 5JHHB 1JXAA 2NZWA 5EGRA 4A21A 1TRIA 1GPUA 1JGTA 3CVXA 2DR0A 3AM3A 1KGUA 5BMWA 2P67A 1F17A 1ZJZA 5LYRA 3GEPA 3UXDA 3D8SA 1C9MA 4AD4A 1ZQ5A 4HAUA 3TEJA 3ERCA 5LNWA 1RD5A 1A5UA 3WX7A 3HKBA 1RLJA 4UTLA 1PKYA 3ZK8A 4QITA 4LRTA 2RB4A 3Q8MA 1KCLA 1US8A 2FG5A 2DQXA 1PX2A 3GEEA 3KL4A 3QC0A 2FSFA 2OXFA 3E5NA 1NJGA 3P9YA 5CZJA 3KDOA 5CA1B 3M49A 3H13A 2Y5EA 4B3KA 2VR2A 2VGIA 1IN4A 1M68A 4ZENA 5CAKA 4RD3A 2VNJA 2WSSA 4C29A 2PTXA 4FMDB 3A6ZA 2AL7A 3H8SA 3JQPA 3HV2A 4MI6A 3QF0A 2I1WA 1FFHA 4WL0A 3R41A 3SFTA 2CZQA 2I2XB 2WANA 3VDGA 1PTKA 3NUGA 3RM3A 3X2FA 2PI6A 4EJSA 4B7UA 4CM1A 1AKVA 4I9NA 2Z08A 1OBHA 4FNTA 3WR5A 1QIJA 1E2GA 3UTDA 4OQYA 3NIYA 2ATXA 2KMLA 5EJ7A 5ABEA 2LDBA 1WO2A 1GPFA 3WQRA 2YV5A 2VYNA 5TR9A 5JAMA 4CEIB 3BK7A 4R7GA 1UXOA 1ZN9A 3W2JA 3ZLHA 3LDUA 3W1MA 3EJWA 3ESYA 3ETCA 1NNLA 2PSFA 4EANA 4LKRA 4YEDA 3U16A 3KJXA 4DCTA 1GTVA 1DBPA 3AERA 2EKLA 4X8OA 3D7LA 5JBDA 3QTBA 3NR2A 2CN1A 2ZRFA 2ABAA 1EL3A 4DWWA 4XQ0A 2B8JA 2R24A 1DIOB 5BN4A 2PDWA 1YRHA 4UM9D 2HTEA 3CQ9A 2PD6A 1NATA 1M6JA 3KIPA 1OGBA 4AZ0A 2ISQA 1HI9A 2FMXA 3M1YA 5XIAA 1NHWA 3I39X 5CH5A 1HZYA 5KTTA 2OWCA 4TQ9A 4P4SB 2W00A 4RWEA 4YJFA 1TEZA 4XCQA 1ISZA 4PSVA 3BSHA 4A0HA 5A5WA 1SR9A 4PC6A 3GUWA 2MTBA 1Y4DE 4C88A 3OZUA 3T9PA 3S2ZA 1K9SA 4PW0A 4RXFA 2Z1NA 4GFIA 2QY9A 1HKKA 3PTZA 2GX6A 3GX1A 1DO8A 3F03K 4YY3B 1T2EA 1OADA 2PG3A 2QRJA 1A5SB 4R8SA 1KA9H 4MR7A 3U49A 3KE8A 1TB4A 2WIKA 1MKYA 5GOTA 4H8UA 4GL4A 3CPJB 3FLAA 2HX1A 2KLBA 1ISRA 1A7UA 4ZQBA 3BXHA 2VFGA 3KS9A 3FTEA 5JSZA 3ZVHA 4US2R 5FV7A 4UTXA 2WM2A 1QPKA 3FMIA 3P2JA 4P0PB 3G9QA 4Q9LA 2NVWA 4W9RA 2G1AA 1G6KA 3SS7X 3I6IA 1KK3A 5KOHB 2W2LD 1SZPA 1MR3F 3LZDA 2ZX7A 3H18A 2EQDA 5GGYA 3LLVA 1OYVA 2YC4C 4ZDJA 1A50A 3BULA 5A0TA 4O59O 4U7FA 3WLLA 4I5DA 2NYVA 4F3NA 4FNQA 5LOVF 2P11A 2FDXA 3CLKA 3HA1A 1NM9A 1UUOA 3HR7A 4OXIA 5DMHA 4QGAA 4Q0MA 3GO2A 2Q9UA 1DC8A 3PR2B 1N6NA 3DC7A 3FDXA 2PH3A 3NTUA 3LBFA 3Q2OA 3GBEA 3UMGA 3MU7A 2EBHX 4AN1A 1JMVA 3JUGA 3CZ5A 3OPMA 1I0BA 3PNVA 4WLCA 2G50A 1Y4AE 3UV3A 4DWSD 3MOSA 4ENUA 1TTPB 3H5IA 5A8PA 1QNQA 2MSKA 2BF4A 4B32A 1CQZA 2CJPA 3OQIA 1U02A 1WTCA 2Q3MA 1BC5A 1KC3A 3ZCUA 1L2TA 3UA4A 3U13A 3ZWPA 2DGAA 4Q82A 1U33A 3ER6A 5AM0A 4XUDA 2G4FA 1A72A 2YOFA 3HCWA 2CYAA 4GWLA 5K0LA 4PZAA 1NFQA 4MVWA 5HQ3B 1DXYA 1KU6A 2IYUA 3A1VA 1IZ9A 2XCIA 1LL7A 4YGYA 2IH4A 3DEKA 5HOQA 4GI6A 2VHVA 3EC2A 1AL8A 3O26A 2SKCA 2I7XA 2GARA 3HYCA 4G1BA 3QWHA 3AHTA 3QI2A 1ADDA 3H84A 4R7ZA 3VO0A 4FN4A 2I55A 4P3XA 1JPHA 1YE4A 1ZICA 5BNZA 4M82A 2P69A 4BAGA 3S55A 4RLSA 1JWLA 3FPHA 3SU8A 5AXAA 1Y4ZA 1RXCA 2D0GA 3AALA 2O57A 1ZH8A 1RM4A 1UZNA 3TNLA 1ZMBA 3NU1A 3WGHA 2PGEA 3LHSA 4BQFA 4DADA 1CZKA 3OA3A 1LRTA 3HO8A 1N1MA 1JZ8A 1GNTA 4FKZA 4RE6A 4DCUA 3STHA 3T1NA 4XAYA 3D5TA 1HX7A 1SBQA 2F3RA 4HDSA 4JEQA 3UB3A 1GUZA 1CYGA 1O94D 4DE5A 3HJAA 2IEZA 3RU9A 4LUCA 1UOEA 4WXYA 4LF2A 3KSBC 4GZ7A 1E9CA 1EJWC 2NXIA 3FX2A 3O8QA 1TKKA 4O18A 5BMVB 1GKPA 3OFVA 1Q8AA 5TMPA 1TLFA 2WWIA 3KUUA 1E2QA 1JIIA 3H3FA 4MJ7A 1BD3A 4R8VA 4TTGA 2H1LA 4IJRA 2JK0A 1NQKA 3I1FA 4C6IA 2Q6ZA 4GR9A 4HN2A 5F1PA 3HJHA 2W2XA 5FUXA 2C7RA 1HL3A 1SCNE 3COZA 3KPJA 1U3GA 5KCZA 1L4FA 4HDRB 3L67A 2XVXA 5C51B 4XLTA 2Q3OA 1KDVA 4DANA 3KWXA 5FNZA 3EX4A 4HQ0A 3CJPA 1PCKA 3I42A 2DHCA 5H83A 4BQ4A 4HNUA 2I7DA 3QGMA 2R6OA 1BYBA 1YBVA 3WWPA 1FQWA 4OV9A 3K6SB 4YP5A 4EIWA 2G28A 5CD1A 2VA9A 3LEPA 3O38A 4LDPA 4BMYA 1IZCA 2WD9A 3G1UA 3LJKA 3KL0A 4DBLE 5JIBA 1K9TA 1JZ6A 2ODTX 3SF8A 3MWDA 3UG8A 2A4MA 4A8NA 2PVCA 3K35A 3BBPA 2IDMA 3KAKA 4BKPA 3SR4A 3GFZA 3AUOA 3VZQA 4M1BA 1RBYA 1R0XA 3HEBA 3K1YA 3SVTA 2OA0A 2ZATA 3ED1A 1TT5B 5HQMA 2ZM6B 3N2GB 2PD9A 3U4QB 2VFIA 5EHNA 1MU0A 2Q3JA 4IUCS 3UBPC 5HK9A 3R7SA 1ENZA 3G7SA 4HDQB 2ZICA 5JBEA 1PSDA 1KFCB 1ADJA 2GCOA 2NMVA 2CLKA 1QHFA 1MZVA 5C7HA 4CZ2A 2QTZA 1B0ZA 1E2PA 3GLFA 4KKXA 1QJ4A 1ZJ6A 1JYSA 5I01A 2C5GA 1M1YE 4O52A 4LJYA 1TUIA 1AOXA 3F7MA 2OB2A 3COWA 2W67A 4G0ZA 4TSRA 5KPDA 3C3PA 1DKQA 1J33A 3GDLA 4C6TB 2ZI6A 2RHHA 3VR5A 4I50F 1UBFA 5ERGB 5CFPA 4C4PA 1HT3A 2BODX 1E7RA 1NGSA 4A6GA 1YJCA 4CV1A 2GSJA 4HA3A 2DBYA 3WL6A 4IUBS 2OQRA 5FEZA 3OEHD 4KAFA 1XG3A 3FHQA 3ZIZA 4F9EA 5FLYA 1OKKA 4ZWNA 1M66A 2R6GA 4BMDA 1HKUA 4QIUA 4Q5IA 1WVMA 4A05A 2E4WA 3OLZA 1LRQA 4B1FA 2VDQB 1U5JA 4AS2A 1YE3A 3DMRA 2YDYA 4J2HA 4PODA 1SRQA 5E2AA 3W1QA 1P2UA 3TNOA 2ZJOA 2NXNA 4EPKA 5E0CA 2FPIA 3GTHA 3EIHA 9MHTA 4GKJB 1P18A 1PZ1A 2CNLA 1YRQA 2WOOA 4K8HA 2YHIB 1AM4D 4IGKA 3H11B 3MT0A 2ZYRA 4PGAA 3V1KA 4K36A 1CXEA 1TU0A 1WQ1R 3DCIA 2I66A 3HKDA 1R2RA 4KACA 4LXIA 4RNDB 2YL5A 4QOJA 3I01A 2BDQA 3DE5X 1I2DA 2NW6A 1TA3B 3DMNA 4P36A 4C0QC 4REOA 2OE2A 1DJQA 1E0TA 3HIJA 4PR4A 2GEFA 3UGKA 4RYLA 3GJ4A 2G9RA 4BFSA 2VT3A 4INAA 4QYMA 4WZBB 2PUEA 4O63O 4ER6A 2DPMA 3VR4A 3UKOA 4DVOA 1PJ3A 3BGAA 2AJ8A 2UXDB 5IVDA 1I7LA 4EBBA 4HJRA 4R69A 3FJ4A 2GAJA 4KVFA 5IN5A 7ADHA 4BLVA 3Q0EA 1JXJA 1QVWA 4PTDA 3ID6C 3UT5A 4OH7A 4I6VA 2XU2A 2AHOA 5THKA 2GNOA 2VPYA 5HQ3A 1B9BA 3GEDA 1H1LA 1NV8A 4HVLA 2ZUVA 2HHLA 4OLFA 2QGNA 1XX6A 3I65A 3RG6A 1JG4A 4ZYLA 2HSAA 4F4DA 4Y6GA 6ADHA 3NWPA 4U6SA 2IU0A 4NV3A 3RTEA 4MJMA 1ZUHA 4DLWA 3IVGA 1ZGBA 4TVKA 5A5FA 1EIBA 2DTEA 3MS4A 4GX8A 3BZWA 3K8MA 2D5LA 4I4NA 3SLGA 4LHEA 3G8DA 4US5D 1LUCA 5DMNA 5AXCA 3GIQA 4RL6A 1F3LA 2XPKA 1IY8A 2JCBA 2GRAA 4WSJA 3CE9A 2PKCA 1A5OC 2J47A 1CX9B 1IEIA 4JDYA 1YKFA 1G4UR 1JXMA 2EZ8A 2VD9A 3QRHA 4R54A 1TJ1A 1ZRQA 2NQ5A 4UXHA 3GGOA 1ML1A 4OVXA 3WNMA 1NT4A 1AVAA 1XHFA 2JFPA 5I9MA 4IIGA 2ZRGA 4AZCA 3GLGB 4DZAA 3WNNA 2ZPUA 2WJWA 2EFDB 2RFLA 4D9EA 2ZIXB 3O8QB 1GAEO 3TCNA 1WDTA 4M8KA 2QT1A 1KI6A 421PA 1DPGA 4WGGA 4EI8A 4QTYA 2H29A 1T4CB 5YASA 4UNLA 1OREA 3L1IA 3UMSA 3PVCA 2HRDA 4HJFA 3RHFA 3GT4A 3ZDXB 1NVVR 3OCWA 4ROTA 4RXGA 1NLZA 1XJWA 3SJ3A 3VKKA 1FYEA 4GXTA 2I8AA 3C1AA 2ZIDA 4BNMA 4GOOD 4LV4A 1OYOA 1PZGA 2OZVA 3LRKA 2IY9A 2WAMA 3BSGA 2E4AA 2V54A 5D9NA 5EBAA 3OKFA 1GHTA 4XWGA 5CXXA 2PJRA 3TTTA 1JPUA 2YXXA 2WK2A 2YIMA 2HRBA 5J59A 4CEHB 3ANVA 3TZFA 4JJ8A 2WKLA 1U9ZA 4N0QA 1WKBA 4MWAD 1GEGA 3NHPA 1W3HA 1FWDC 3SF8B 2VC5A 2EJBA 5TJ9A 2HQ1A 6CHYA 3MT9A 3MMPA 3OIGA 2P76A 2PJUA 3FYUB 1PK7A 3BM5A 4YV2A 1V3IA 3NTOA 2V45A 3GK3A 3KLPX 1NLFA 2J4DA 2ZE6A 4UMFA 1SJBA 3PR3A 4Q7QA 1S2IA 1Z6PA 4C2BA 2IWHA 2F4VB 1KM0A 3LUCA 1SUIA 4AJOA 4B9ZA 4XWTA 3CXRA 2AI3A 3AERB 3TOCA 3DAQA 1N8KA 1R6BX 2O2IA 5CB8A 4H04A 3ON5A 4TV9F 3AU9A 5JSHA 5HJXA 5BT9A 4XPIB 1W9BM 1I3NA 2DVUA 3AJ8A 2YDXA 3IUIA 1VFUA 3JQFC 3GLHB 4L57A 1MW8X 1I1QB 3MWJA 3HR4A 1MRNA 3RYIB 5EHQA 2DW6A 2FMIA 4TQAA 1KBLA 3COTA 1YDGA 1VM6A 4JBNA 1QH9A 1H1DA 1HFEL 2EKGA 4PSRA 2BGIA 4JIQA 3T9CA 4PYQA 3EEIA 3GFQA 1VLMA 3E5PA 1DBVO 4OUEA 4PAWA 2JGAA 4ER3A 4DNMA 4F2UA 1B5TA 1R8SA 2OLHA 2EP8A 3L0YA 2NQJA 2G83A 1YJQA 5H70A 1AL7A 1P81A 3KBNA 3BS4A 4HOYA 4Q33A 4RJIA 4F5DA 3E3OA 2PZMA 4RUKA 3VZZA 3S1XA 2BGNE 3E0FA 4KB5A 3K8QA 3F97A 1YL5A 2F8LA 4IHAA 4DB4A 3L1VA 4Y2VA 1I0DA 5BROA 4Y7EA 2OZ3A 4BBZA 4GQ0A 4G4JA 4NXSA 3TC3A 5DHFA 3K71B 4XV0A 1OCBA 1INLA 1VI5A 2QT0A 5KZ6A 1UWRA 5CLGA 3FJYA 3S2UA 1XLTC 5WRFA 3OJOA 3ET5A 1O6BA 2Z2JA 1QDLB 4LY0A 2E4UA 3GG0A 2JH8A 4HAVA 1E59A 1GTJ1 4HL6A 4AJ4A 1HNNA 5FWAA 3OVMA 3PJDA 1H4SA 1X8LA 3CH4B 1QMLA 3CL6A 3SCRA 4XARA 3PC7A 1JAEA 1AO0A 3QZ6A 3QY9A 4MW6A 3WZ2A 1W1B1 4X20B 3MUAA 2ODNA 3FAXA 4QRHA 1AD1A 3ZI0A 2BBOA 1RYZA 4IJQA 3PFGA 4I99A 3VR2D 1DT5A 1YR9A 4N1AA 3V7PA 5I47A 3UQNA 3CY6A 3L02A 4GI4A 3GVVA 3AKDA 4N39A 5LOVA 1P2TA 4JGIA 4N4PA 2QW1A 1YU9A 1FTQA 3QHNA 1JR3E 5CVUA 1NP3A 3P81A 3GZNB 4RAOA 1T6MA 3W26A 3PR2A 3NTVA 1DRUA 5DM1A 1Q0RA 3TTWA 3OCZA 3CIOA 3N6JA 2ORWA 1GZVA 4M1KA 4EHFA 1X9GA 2XYPA 2PT7A 4L9YA 5CBPA 4YHGA 3ADBA 1XFDA 3I1YA 3ZLFA 2CWNA 2QL6A 2YBEA 2J4CA 5AW2A 2Z26A 4JMLA 4NAFB 3ETNA 1A4IA 4Q7IA 1EX6A 1MAAA 3E3LA 1COWA 3QNUA 4UQBA 2Q1TA 5K2OA 5F2OA 3AP3A 3NALA 1VE9A 1GORA 1PJQA 3CO0S 4R41A 3H83A 5JUWA 1X42A 1ITZA 4ZT5A 3WBJA 1IK4A 4L76A 4QLLA 3AIUA 4BMVA 1LM1A 2MT9A 3WLKX 4M7WA 4B83A 1IZZA 3WD0A 4KIRA 4G7EA 1JWAB 5IKXA 2WVTA 2RGEA 1LTKA 2O4UX 3DHFA 3L4BA 4Z0JA 2BGTA 3HY4A 5BUSA 4BQ2A 3HH8A 4ZHSA 2HBRA 3IHTA 5TIMA 4MA4A 1V5WA 5XIMA 1LBMA 3K9WA 3B9DA 1I4EB 2VDNB 4GR4A 4RVOA 1D8WA 1IE3A 2GPYA 3WAGA 4EG0A 2WTAA 4HU4A 2G5CA 4P4SA 5AUNB 4GI3A 3NQEA 3OLGA 1RS0A 2FPRA 4EEXA 4CM8A 3ONBA 1DG9A 4LJRA 4JOCA 2Z4SA 1NDVA 1Z6XA 2D4AA 2PMDA 3O63A 4DELA 3HU3A 2FEPA 3WIUA 4LF8B 4W88A 3NORA 4NK5A 5HUQA 4FFNA 2ZGVA 3CV1A 3AMCA 2A0WA 1S89A 2J31A 3DFHA 3FHLA 3C24A 1EGAA 5A8GA 4UXIA 1F8IA 3X43A 1XHLA 4L6CA 3FDGA 4RENA 5E1OA 5IZCC 3N2XA 5DOVA 2WF9A 3G49A 4P5PA 1A9ZA 1ZP6A 4II2A 4X2PA 4K6MA 4RD6A 1NR5A 3WUBA 3WGZA 1E92A 3WZ0E 2VNHA 3PUZA 5AK3A 5EIWA 4OQVA 3N9SA 1FP8A 3KFTA 2QUHA 3HUEA 4B5KA 2HMYB 2QDXA 1E9YB 3DFZA 3DCNA 1GZHB 5HIMA 4FB5A 1M1YB 4KZKA 2GNPA 3GDRA 3GIDA 1TCCA 3LP5A 1XZFA 4CMBA 5E4FA 4IJWA 1DBQA 3SY1A 3AZOA 4XIAA 5DP1A 3ZGNA 3NG1A 2D24A 4JWTA 3UHFA 2V7WA 4O54A 1OY1A 3LECA 2P0AA 3MINA 2GEBA 2D73A 4DUYB 3N59A 4ZSUA 4CGZA 4LNUB 5H59A 3CLHA 1WZLA 3LUJA 2RK4A 4XB1A 5AM3A 2K7FA 2P2YA 1Z0JA 3R3HA 3CPGA 1CLUA 4HNQA 3SBFA 4QJ3A 5IDXA 3JSAA 1BMDA 2MOKA 2ZJYA 4MNMA 3MBFA 4NCBA 6PTDA 2NNWB 4KGXA 5K0ZA 2BYTA 3FN9A 3IULA 2MIIA 1UJQA 2W27A 4FWBA 3FNIA 1MUMA 3WUGA 2ICSA 3K0EA 1IMOA 3GG9A 4R9SA 3HB7A 4M21A 4A6XA 3CK5A 5JEDA 1LUCB 1YS4A 2OMEA 2DZVA 4F3RA 3LX9A 2EX4A 2DQSA 2V6GA 2CLKB 3H2FA 2JK2A 2BASA 5LDHA 1PR1A 4R81A 4B3DA 2RJNA 3DT9A 3LUKA 1I32A 2JFOA 1VPDA 2BHLA 5C5YA 4IEIA 4LAUA 2V4UA 1QHGA 4XRGA 1RQLA 4YXWD 5C2GA 1VPQA 1JZ2A 3FBGA 3QYAA 4N7JA 5CDGA 2BGNA 2J9XA 4UD6A 1VE7A 3HWWA 1OGIA 4KXVA 5A05A 2Y76A 4F7DA 4UTKA 4WACA 3MGKA 1MW2A 4JC8A 3GDKA 3LDAA 5JDIA 1ISVA 3TW6A 1SUDA 5TT0A 2RGGA 1R4AA 1L6YA 3BH6A 5F2LA 1CZ1A 3EEOA 1T10A 3GUGA 4HMDA 2WSLA 5HKAA 4QPJC 1VCNA 4GFDA 2AMXA 1CQPA 5JS1A 2X4IA 3ABSA 4F0RA 5EIFA 2HJVA 5D7NA 4J3FA 4R2WA 3HFYA 2NX1A 1OI2A 3FY4A 4AZ7A 2QS9A 5JASA 5CK5A 1U5VA 1LDNA 2C07A 5H0IA 2VDWA 4EF8A 3DWGA 4OQZA 3TYCA 1DAPA 2QL5A 3L0CA 4BVHA 1SOVA 2B78A 1M67A 4QX4A 4RR4A 1L9WA 4HA1A 1O0SA 3RS2A 5JS2A 3W8DA 4DUZB 1JSXA 1YR1A 5JPCA 2EKDA 1KQGA 5I78A 4FIDA 4PSUA 1V7PC 3D8TA 5DN6D 1JJIA 2ZKMX 4DIEA 2O4CA 2FGBA 5LNSA 1BXZA 4FYPA 5C35A 3VH2A 4KS0A 4QVIA 3DQQA 3MJEA 2ERYA 1VKZA 5F7OA 2YNMD 1W8DA 5AOAA 5BN3A 2XUPA 4XD6A 3HO1A 2CSXA 4PZ0A 5E6RB 5D2VA 2P2LA 2CNKA 4DKXA 4R2XA 3AWNA 4X7MA 4Y18A 3S5UA 4Q01A 1QFEA 4W7UA 3FNQA 1V8EA 1JU4A 3OIDA 3PBYA 1A0OA 3MGCA 4DV5B 2FUG1 1OINA 4KQ1A 4M1ZA 2GTPA 3T4WA 3W70A 3X2SA 3WK1A 3BWEA 1G4EA 1KFBA 2RB5A 4WTOA 1NPDA 3DEYX 3LUTA 2V82A 5AW8A 2CZCA 2XQJA 3H99A 5ALDA 3BTNA 1YCGA 4MLJA 5AVKA 1MAUA 1WWKA 1JVNA 1U3TA 3NUQA 3COSA 3DBHB 1U30A 1W3KA 2WHPB 4B6FA 4AVOA 2M1XA 3AEQB 1JQXA 5FPPA 3PWZA 3VZRA 4B84A 1OXTA 1LZOA 1NP6A 1V41E 1T9ZA 4MRSA 4L8LA 5I24A 4CDGA 4JB2A 1H2EA 5G1MA 5XINA 1I33A 4H7EA 4Y6GB 2B30A 4RTPA 3BERA 1HGXA 3GWQA 2XNHA 3D81A 1QHSA 1QO0D 4YH1A 3APYA 2G6TA 4C1KA 3CLMA 1ZHHA 3KJQA 2QXYA 4OI1A 2I03A 1FWWA 2B0CA 3NKVA 1Y1QA 4L56A 1XRLA 3HN7A 4QQNA 2J8TA 1KR1A 1Q21A 5G3ZA 4FR6A 4BF9A 1JEYB 1VECA 4JP1A 3KB8A 3VC7A 1KFJA 1V39A 1P2GA 1ZD3A 4KEUA 1HTBA 3BK2A 1WYIA 4FYHA 3UJ7A 3GJTA 5JU6A 5KKCA 2CZFA 4WKOA 4PGHA 3F7NA 1TTPA 1GU0A 3H7UA 3FZGA 8GPBA 4M76B 3W8EA 1V96A 2POTA 2DHDA 4GBDA 2GF9A 4D0NA 1Q6ZA 1HOXA 2O2XA 4ZMRA 4WZHA 1GSAA 2IIPA 3BTUA 2IF2A 3UIEA 4AB1A 1BCSB 4PMVA 2DR2A 2J3KA 3BE7A 1SMAA 3G77A 3K0FA 2F2KA 4NPHA 4AS3A 4LGYA 5L3ZA 4JIEA 2IE8A 4ZMGA 1JIKA 2CFRA 2C15A 3B5IA 3FNFA 2QX6A 2NTJA 2D13A 4PXSA 1TZ7A 4RTKA 1IRXA 2VL4A 5EVJA 5ARDA 4JFWA 3EF0A 3ITDA 4J7CA 1Q92A 2WVVA 3I12A 3G1HA 3SS9X 2VAWA 5CX4A 5FB3A 3PDHA 1VG1A 3WIDA 5FOQA 4PHCA 1DHPA 5BXRA 2ZFUA 2CVFA 1CJCA 2XYQA 2XZPA 2J25A 5D7BA 2HO4A 4Z7QB 4CTOA 1DRKA 3VH4A 1CNMA 4IVPA 3WDSA 3A27A 3WEMA 3EPKA 4S3AA 3NPUA 1NN0A 2G9UA 1FNSA 3ZEIA 1VMAA 3VZBA 4CU6A 5G0UA 2QLBA 4HAXA 3LT1A 3G1FA 5FH9A 3MPGA 1OX6A 3VBCA 5CPMA 3BH0A 4MPDA 1BU8A 1JB9A 2RGLA 4WDXA 1CULC 1U8FO 3R5XA 2GSDA 4JKIA 5HYVA 3UBTA 1TYEB 1VYVA 2CFSA 4K3VA 4RK5A 2VGFA 1WPGA 5CSRA 5K3AA 1HY3A 1THFD 2BGSA 1H2XA 5LGZA 1QO9A 1UMCB 4N8SA 2D2FA 1KORA 2V7TA 2JEYA 2DGDA 2XG9A 1HDGO 1BXBA 1ESCA 3OJWA 3E1KA 3GNDA 3JATB 3VI2A 1PNRA 2IYRA 4JXZA 1L5HA 4L2IB 2DUNA 1Z22A 4IOJA 1Q91A 2J0UB 3W1RA 2PGIA 2G5TA 3IRSA 3PQFA 3FUVA 3LKBA 1Y37A 1FHLA 5H4HA 2HVMA 3MV11 4EPVA 2PYZA 4Z9FA 2KWIA 1TX4B 4INOA 4LRXA 4WXHA 1X8CA 1VG9B 3MUXA 4PBEA 4U33A 3L4JA 1A4XA 2Y2WA 1ZQ1A 3TTXA 3V80A 1JQDA 2ZJ1A 5A8QA 1OOEA 3IE0A 4JOMA 4RPLA 3JQFA 1GSOA 2A2ZA 4BNHA 1CUHA 3FA3A 5JVDB 2UAGA 3STTA 1BCRA 2H5JA 2UDPA 3COVA 4TRMA 4S24A 4EX4A 5BURA 4KODA 2W6NA 2OHGA 3MZNA 1TAGA 3V8MA 3ISJA 4ASUD 4RAQA 3N3MA 3U7EB 2CHQA 5AI9A 2YBVA 2I7VA 3MWFA 1NJFA 1P60A 3KFLA 1WKCA 4DYVA 2X5OA 1UCWA 2V9CA 3HG3A 4FXOA 4TUYB 2FP4A 4PUMA 2EATA 2QN6A 2H8XA 3VU3A 4II7A 4H4CA 2QTAA 4ZN6A 4HEJA 3QITA 1H8EA 1N3LA 4URVR 1G5FA 3CAKA 1B4DA 3T44A 2FLKA 2GVYA 4WJLA 3LXAA 4CGYA 4LPKA 4NBVA 5TGTA 1GFZA 2HSWA 2OORC 2FZDA 2N42A 4MCAA 4QJ1A 5HE9A 5KZDA 4GMDA 5LIRA 3KOXA 8LDHA 2WUDA 3UG4A 1L8PA 2RBEA 1EM8B 2R94A 1W5FA 4Q1BA 1P45A 4HWKA 3FNGA 3W6OA 5TMDA 1MC5A 1QQTA 2IBTA 5HMDA 2CDAA 4DA7A 4AIUA 4J1OA 3P61A 5K5EA 4TS1A 1FP4A 1EWTA 2PL3A 2Y7DA 3PPVA 5EE5B 2JFGA 4ZFNA 4G4GA 2E85A 2PBFA 1UJ6A 3Q9NA 1Y98A 1S1MA 1E63A 4Y1EA 1USGA 4N47A 1VYSX 4AZ0B 2X9VA 1V9CA 1WCXA 2OCLA 1EZWA 3KAJA 5JY1A 4MYUA 1OU0A 1WHSA 4X0NA 1ZGCA 4TLAA 3TIGA 1S7GA 3QFSA 4DQXA 2XTMA 5FTMA 2IPNA 5I48A 4ACBA 2NU8B 4NK4A 4R85A 2Z2BA 3OZDA 5C1DA 3FB1A 3LHFA 2Z2XA 4KO4S 5E9AA 5T9CE 1X74A 1XR3A 4OP2A 5G4LA 1M2KA 3RS8A 1NX6A 2E8YA 1TF2A 4BQNA 3DDHA 1XROA 1WSBA 2RH9B 1U0NA 4MV9A 4P82A 2GA9A 1SVSA 4RZ6A 3LXRA 4MWGA 4DO4A 1E3WA 3VPXA 2Z1WA 1YJ5A 4LJSA 1N5IA 3BMQB 3TLMA 3RQSA 3HYRA 4PZUA 2PE4A 1W9MA 2VH5R 3AVXA 2HPVA 1K5GA 2PUHA 5MKGB 1II0A 1W1ZA 1R9YA 4LHXA 4YCOA 4RKEA 4F66A 4DN1A 4OHBA 2VXOA 4ZO9A 3ER9A 3DMHA 2JI9A 2IUFA 4TQTA 1U2DC 5A3QA 2BY3A 1XRSB 4QRIA 3CPUA 1DKMA 4UAJA 2NT1A 2AF3C 1L5HB 4MVJA 2QVZX 4ZVSA 5AUPB 4D99A 2I6TA 1VYTA 4DLLA 1YWGO 1IONA 4BHTA 4G3XA 3F6PA 1DVRA 3ROQA 4BNNA 5JAHA 1QVZA 2HPHA 3UPBA 3LPOA 4DXKA 1GM5A 2PWYA 3AVWA 1AF4A 3KSMA 4JHZA 3GFFA 4K81B 2I6XA 3ME3A 1IPFA 1MXFA 4EHBA 5GVSA 4WZBE 2FN9A 3FYDA 1QG2A 1RK6A 1Q14A 4L5BA 3BXZA 4A16A 4I4IA 5CAHA 4FFWA 1KJNA 1WXWA 1XTUA 4HNLA 3GP8A 3SQXA 3TRKA 4F7WA 2BY1A 1CRPA 3GXNA 4WPGA 3A1DA 1O95A 3VOCA 2QAGA 1ZNYA 1H2HA 2XCQA 2Q41A 3FDZB 3ZWVA 4UWMA 3OG9A 3QK7A 2WC3A 3TD2A 2BP7A 2G09A 1W9VA 3ZBUA 3OT1B 5HSGA 4HX9A 2RGBA 3HQNA 4I2NA 5DYYA 3JWHA 3KYJB 1TGVA 1IM2A 3SADA 1PEYA 4JFSA 3OZAA 3IT1A 4MRMA 5CAEB 1PYMA 4EK7A 3ITEA 3OPSA 1TKRA 1ORHA 3ZLTA 3O3NB 1MO0A 4Y2UA 1GG0A 1DXOA 1LLDA 4UASA 5AJWA 5J1TB 1DJLA 2VPQA 1WULS 3DL0A 4G01B 4FX7A 2BFNA 1EH9A 4PO1A 2XWSA 1YS7A 4C6PA 1ZK3A 3VHQA 2WWYA 5SICE 3JQDA 1HE3A 1Z33A 1SXJB 3NI2A 2XJ7A 4R1MA 3HK2A 1O1YA 1YK1A 2GJSA 2QZPA 1M7HA 2FX3A 1JHPA 3B8SA 1U2ZA 4AIEA 3NL5A 3IEMA 3NCHA 3L2LA 4DCGA 3IRVA 4G5FA 2GXSA 5KJFA 5K4XA 1MGOA 3G0UA 2B7CA 5I7SA 2O4MA 2HBVA 4HAOA 4BZXA 3E35A 1VCHA 4ZFMA 2F00A 1XU4A 5HTOA 3IJRA 4YMWA 5H3LA 4RFVA 1ZLXA 1O6FA 2ZA1A 3ZD9A 1R37A 4WMLA 4B74A 2GDUA 4HB7A 4G5XA 3T8QA 1B3VA 1G0CA 2CZ5A 4WLEA 4DNXA 5DBFA 3HN2A 1VPLA 1U2YA 3C3AA 4AF6A 2ZIVB 4QUKA 4EA8A 4JYEA 2ZJFA 3QZAA 1RPAA 2IYYA 2B7QA 5CLQA 3RTAA 1DV1A 4CV0A 3KVOA 1F2UA 4YI3A 5JAQA 4OFBA 1U4SA 3FFXA 5LP6B 4RH0A 3RWOA 3WK0A 2LRHA 2QCFA 2FHCA 2XW6A 4MWDA 3R74A 4KBFA 1TJPB 4GGMX 4K37A 3KKNA 3Q7EA 1WCIB 5HUOA 2GGGA 1LKZA 3QXJA 3R1IA 1IQRA 4XPZA 1H2FA 3JATA 3KFXA 3BW4A 3N8KA 3W2KA 1G64A 1KNWA 4I7EA 3N0WA 3K13A 2WZHA 5DM0A 1QYCA 3QTPA 4TVDA 2FMTA 2I9PA 1D3HA 4JXXA 4WY0B 3UYLA 2I22A 4PFKA 1Q65A 1TQ8A 2OOGA 1ZOLA 2XJ9A 5CH3A 1ZHAA 1PNQA 1VLLA 3FBTA 4CM5A 3GJQA 2R7NA 2QVHA 3AETB 2XNJA 4HH4A 4YCDA 1CCWB 3HCPA 5L4SA 4XH9B 3NR0A 3C3JA 4O15A 1A96A 3DKVA 2YWJA 1A9OA 3AUAA 3CH5A 2X6TA 4B8YA 3SNHA 3FSRA 3E22B 1UAAA 1ZALA 5T4FA 3VSEA 4W89A 1WZNA 2NTEA 1WKEA 3QTGA 4FCVA 4ZXLA 4Q3MA 2Q21A 1FFEA 3HCFA 3HJNA 1KHHA 4PMUA 5CNIA 4AYTA 3IAAA 5IFPA 1I13A 3B1VA 3WBAA 1KV5A 4UQCA 3EIUA 1SPXA 4LGVA 5LXTB 1TT5A 3T9AA 3QE2A 3FLEA 2QP3A 1ENUA 1ODSA 3ILVA 4MQFB 2BG5A 5E7QA 4XVRA 1JYFA 3E9DA 2I4TA 1J10A 3VNBA 1IXPA 2YMMA 3Q6IA 1H5NA 1WIWA 5IM5A 1O03A 1E96A 1XGKA 3JQAA 1MX5A 3FCUB 4NG4A 3W77A 3WLHA 5BW6A 4KVAA 4LI0A 5GONB 1QRQA 4IF4A 3NXFA 1ZSNA 3KRTA 3SUWA 4I3GA 1SB9A 1SO5A 3ROZA 2UXCB 1EK6A 2AVDA 3SEZA 4KSBA 2LWIA 5BNFA 3GHRA 3DBNA 1IOLA 1QO5A 3AKEA 2X3YA 2VJDA 4OGGA 1C9JA 4QUEA 4DIDA 2J59A 5JQGB 2EKPA 3A4LA 4X71A 1CUVA 1CWUA 1STOA 3HBLA 2QPXA 3DL7A 2WWTA 1IZJA 2SNIE 3OPYI 2C61A 4PG7A 2HXGA 1BWSA 2OP1A 4MIOA 1EC9A 3PXCX 3KTOA 3NO1A 1JUBA 1NFFA 1UBKS 3F90A 3KBVA 1B6RA 4DJ5X 2QB5A 1KOGA 3GA5A 3GLIB 4JNKA 3NOEA 3MJDA 4ZJZA 3VOSA 2XMBA 2OK7A 3UNDA 4JU8A 1M8JA 1VZ3A 4WFQA 4B75A 1C7IA 1T9BA 4O0ZA 2YDQA 1I4NA 3DP7A 3AFOA 1ISFA 1WUKS 2H1FA 2OV6A 621PA 2Y4NA 5E1MA 4ZOLA 2FPTA 1EP1A 1N2OA 4RDXA 4LIPD 2V0GA 4M1MA 1O94C 2WWFA 2XSAA 4HDNA 4GWEA 4L8YA 1TXGA 2QYGA 1YTUA 2JW5A 4MZ1A 2O2DA 3UICA 2AG1A 3R7AA 5J4LA 5AW4A 3IDAA 4V2UA 3LDFA 4EB6B 1SURA 1JCXA 3TXZA 3WBWA 4IDCA 4BFWA 5JXJA 4ZV9A 2XINA 3WDQA 2RHOA 5KYUA 4U2DA 2O07A 3LNMA 3QBUA 4BJHB 1CQXA 4KGJA 3DHDA 4LYHA 1FQJA 1E2UA 1OZFA 5MGBA 4Q8MA 2GN8A 2JIZA 1J6PA 5GINE 3MTQA 2BFDA 4N0EA 4BNDB 4LQ1A 3SVZA 1KTVA 4GI7A 3QMPA 3D43A 4DS3A 1SXGA 4PVCA 2A5FA 1L8NA 4E6EA 10MHA 1EUCA 5BRPA 4OX9Y 1Q7RA 1N9GA 2YB4A 3OFSA 2UYCA 4F3KA 1D9XA 5JFTA 1YOVB 5JCOA 4LXHA 2PU0A 3VKBA 4DLTA 2G97A 3K96A 2JJYA 4OCZA 8AT1A 2HN9A 2OYCA 5KVSA 1HKIA 2H90A 3DZFA 4HP8A 4LS3A 2C8LA 5EKTA 4EJFA 5IASA 4R1NA 1GHSA 5JYCA 1EYZA 4QPCA 3EQ7A 2AI1A 1VHQA 4GC3A 1GKIA 2PFSA 1SBCA 4ZO4A 3K92A 1JCJA 1UMYA 4Z49A 2DF8A 3DESA 5AR1A 1DE5A 2XTJA 4MUKA 4RYDA 3KTAB 2ZU6A 5GQSA 4M56A 4H83A 2IYEA 1F3TA 4W7WA 3DAOA 5KTYA 4FU0A 2WJZB 4DSUA 1NJ6A 1U1JA 3HV0A 3CSDA 3ZJ4A 3D1VA 1PW5A 1FHVA 2QE6A 4UVEA 3M0MA 2A7QA 2OKGA 1PTAA 3TYZA 4EBFA 3M0LA 1LW7A 1QU3A 3R5JA 4RZBA 1RQRA 5AP9A 2BMFA 4AT1A 1RM0A 5CEJA 1HLDA 4BWGA 2XVKA 1U3DA 3W8RA 3BG9A 1L3BA 4JNMA 5D8ZA 1PCXA 4Q4DA 1KJZA 4QISA 2A1UA 2L82A 1OLOA 5C32A 4C20A 3P0IA 2D0PB 2BGLA 2YW9A 2VHXA 1BFKA 2PZGA 5F76A 3LBCA 3NHBA 3TAXA 1TQ4A 4RSHA 1U0SY 4UVHA 1C8XA 3ITCA 2IEBA 4H9XA 1D3GA 4HB4A 5CDYA 3B8DA 1IL0A 3R3SA 3SCPA 1P0QA 2OGTA 3EVDA 2KLHA 2R7LA 3NQBA 4TS3A 4B35A 3DXZA 3TPZA 3IRDA 2H7CA 3OBIA 3MT7A 1IN1A 4M9XA 4Y9MA 1OVDA 1N34B 2HAEA 2TYSB 2PCQA 3SDOA 3W25A 4A03A 1AKNA 4GEKA 4IP4A 3LG2A 2QPSA 2R00A 2BHZA 4TWJA 1TB3A 1W2PA 1NAIA 4B6EA 4TL8A 3GNNA 1F4PA 3E0XA 5IS2A 5H1YA 4Z3KA 5A9RA 2GJLA 2UUCB 2WMFA 3LT0A 1XIDA 1KJQA 2FW6A 2POCA 3RIGA 1GU7A 4PE8A 2JLRA 2LW7A 3CX7A 2J6BA 5A6BD 2CBZA 4YTEA 1YVDA 1TF7A 4LXXA 1TRKA 2FE1A 3W9ZA 1YQWA 4ML4A 1ODUA 4P61A 4FS8A 5EPEA 2X0YA 3VDRA 1ZBCA 3MQTA 2V0TA 3W06A 2FF5A 4ZVOA 5BV8A 1VMDA 1T6ZA 3PSHA 3RLFA 2VEMA 4EQZA 5CFZA 3RR2A 5KNCH 3RAFC 4QQFA 5EXPA 5LL6P 3KX6A 3KR9A 1P77A 4WH0A 4OTKA 1VJ5A 1KNXA 4B82A 3BZUA 4RQBA 2QCDB 4EO4A 3PVSA 1R3QA 2GI4A 5F7XA 3ABQA 1T9DA 3NURA 1J7JA 2HRWA 2ZI7A 4OMDA 1BG6A 4Q7MB 1J2YA 2VFEA 4JNYA 1TMGE 2OYRA 4I81A 5COBA 3PUJA 2J3HA 3TUIC 1ZJ5A 4RLHA 4N7RA 3OT1A 2GCEA 1LBLA 2BBTA 1SJ9A 1YI8A 2HRQA 4H3HB 3IV8A 1JJFA 1YIXA 4H6EA 3LQFA 4MWEA 4AKHA 3MKVA 1WP4A 3TW0A 1YIDA 2MUCA 4HSNA 3BTVA 4HBZA 3FSUA 3L7LA 4PIPA 3ZK9A 1KP9A 4BI5A 4RIIA 5AJYA 3WLNA 1G5RA 5JH7A 1CETA 2WZMA 5GJMA 1P1JA 3UWQA 2D1TA 1MZRA 1Z6TA 4HU3A 1BG9A 1PFQA 1RRCA 1KM1A 5F12A 2XB6A 3NXKA 4ZYTA 1G20E 1YRAA 1BKYA 3DAGA 2JDIA 1IBRA 4ME6A 1R27A 2OG9A 3KLMX 3PJFA 4JIGA 1HDXA 5DN9A 3ITOA 2CLFA 1WY7A 1T8TA 5ALKA 2PK3A 2XWQA 3FK4A 1QK2A 5ELLA 4WCFC 1AQ6A 4V3CA 1EFCA 1VJSA 1L2QA 2E6DA 1YDMA 1CEQA 3C5EA 5BXYA 1XQLA 4QUBA 1J49A 4LSZA 1C0LA 3ABOB 2H3EA 1FNCA 3ZZNA 5AM5A 2DY1A 5F1KA 3V32A 2AMYA 1XC4A 2AYYA 4MKHA 3N6XA 3UG5A 1GA6A 1FP7A 2BBSA 8MHTA 1KI2A 1UFRA 5EYWA 5CGZA 5MF5A 5C0QA 3E3AA 4P7RA 3D6TB 2Y0DA 2EFHB 3NUKA 2D2OA 4CCCA 2PUBA 1X1SA 1IJFA 2IZZA 3NCOA 2PDIA 2J9FB 4RHTA 4YL2A 3B40A 5EFDA 1H6BA 2B5WA 3JAKA 2BLNA 3Q7SA 4KQ9A 4UULA 3HUUA 4F84A 1W5TA 1NP2A 2DH6A 4LVUA 1KDZA 3EIFA 4QLAA 4Q3NA 1MRZA 3BB3A 4YCBA 5DSTA 2NT4A 4LFYA 5IULC 3L04A 4XUGA 1C3OB 3TL2A 3JWJA 3PNMA 1Q19A 3NQGA 2DSUA 5KU1A 2E28A 2JEQA 3QVJA 2DXIA 2YLAA 2X0RA 2WTNA 4K1LA 3FW1A 3GGJA 1EP3A 3A4WA 4FZ5A 1SVMA 3GC5A 4XQ9A 3HVJA 3AROA 1T26A 1B2LA 1RR6A 4OYHA 2AEJA 2VRBA 3GVIA 4DV7B 1HKJA 3R6IA 1SQ6A 3PX3A 1K1DA 4B09A 3GJ0A 3DYBA 5EMNA 1J12A 5LGXA 3NVMB 4WWHA 1EP3B 2DUJA 3BAXA 2WSIA 3KTDA 1C41A 1RJ9B 4KBGA 3B06A 1M74A 2ZRCA 4MI3A 3ARUA 4TTAA 3CUYA 2AT1A 1A77A 1YZNA 3K6RA 2QW8A 5F5NA 3MSXA 1FX1A 4PL1A 5D3QA 4LF5B 3FSJX 4Q03A 3CUEF 1FNMA 4YDSA 5FTLA 1GJWA 1ZOOA 4LJ5A 1MBZA 3WL7A 4XX1A 3H4MA 3V5FA 3IQDB 1WUHS 4UAGA 1XZLA 3OE5A 2DQWA 4A0GA 4RDIA 3T0AA 1P5JA 1Y1RA 5CH8A 1J8DA 3NAGA 3B6IA 3EGEA 3W7KA 3X1YA 1XLVA 1IZKA 3GDBA 3DH0A 1O7AA 1X1TA 3IQGX 4KU4A 4YAUA 1XRJA 2VZSA 2IOYA 1KXVA 1V45E 4AY1A 3UJFA 3C8ZA 3UMJA 4BGUA 1O77A 1NJSA 4JNZA 3UW6A 1LWHA 1MJGM 4E4UA 1CUEA 4LF4B 3RM9A 1JFXA 3RADC 3PK7A 2QGZA 4A92A 4OATA 4EYQA 4LYJA 9LDTA 5FHQA 3GFRA 4H7DA 1RQPA 4IG4A 1I6KA 1KQNA 5HCUA 4GKTA 1EQUA 4L7VA 2VFDA 4IIDA 3OU8A 2H2AA 4ZVVA 1X94A 3IP8A 1P33A 3JASA 1WNOA 4EJSB 3RVPA 3L7BA 2QX8A 3C4UA 5G4KB 2J41A 1JDFA 3TW7A 1OXXK 2JGDB 1S01A 2GVGA 3IEIA 4UUMA 4S1NA 4YVFA 3L4ZA 1TJYA 4BEVA 4OECA 3P7MA 2A86A 4DWJA 3KQSA 2VA8A 3NT5A 3MP4A 1WUJS 3PC2A 3N53A 2CNDA 3F6CA 2CJXA 3OVGA 2QENA 2WMIB 1EJ0A 3KZVA 4HX2A 3QG1A 4FFDA 4DBZA 4MAVA 3M0KA 2BM8A 4P2BA 3GW3A 1I0ZA 3LHDA 3PQCA 4RPJA 4E12A 1A82A 1EJTC 1ML4A 3HE3A 4NBLA 4NNOA 3WJWA 2KX7A 4I1RA 7AT1A 5B80A 3VZSA 4XD7A 3IVCA 2FSHA 2WLSA 1L5NA 3CHCA 4E1AA 4HYEA 1BDJA 1V95A 4MKRA 4R3UC 5DZSA 4ND5A 1O9BA 5IVIA 5BPHA 5L45A 1BSVA 5GIOE 1QK3A 3QW2A 4MO9A 3AP2A 4I55B 2PHZA 5DRCA 3QJGA 4Q02A 2FZKA 4EUHA 2DHEA 3CJTA 1V4YA 2PR7A 3D0OA 3JWIA 4E51A 4TZ0A 1VA5A 2IZ1A 1J9EA 3KNZA 4DVGA 4FJ0A 2GZHA 3UQYS 4X3PA 1AW1A 2ILVA 2UY5A 1B3YA 2C16A 3EDCA 2ZTMA 1EH5A 3ICJA 1R6VA 4ZAFA 3CF2A 3LUBA 2GJXA 2ZK7A 1U0JA 3DFTA 3CL8A 3DFKA 3GUVA 5K6AC 1BWPA 2GGIA 1K3FA 4GH3A 4JL8A 4C1NA 5HF6A 1J5TA 3E0IA 1RC8A 1BW9A 5ENVA 2ZZ4A 5JZBA 4Q4QA 3GTXA 4P8VA 3GH1A 3SHTA 2XYRA 3ETDA 5ICEA 2QCCA 4IX2A 2G9NA 1K8QA 2VENA 1KI6B 2O5VA 2B9EA 3S2FA 4LTNA 4YCSA 5GONA 3DHPA 1XP3A 1ZNWA 3I4FA 1ONBA 5F4WA 2OQYA 4I6EA 3A4YA 2IXTA 4H6VA 4IGFA 2ZUNA 3IJLA 1YUNA 4WV3A 3P9QA 3KSAC 1FWEC 1R88A 1W4LA 1IH8A 1KKMA 1L6IA 2JEOA 1P9LA 3FVWA 2EW2A 3HXMA 3W5UA 4OHWA 4F5WA 5A6LA 2FEAA 5LXXA 5DLCA 3I9V6 2OR3A 4JGBA 1FRVA 1SFRA 1XPGA 1YLVA 1EVJA 1TIPA 2YX0A 3LDGA 1RALA 5DTEA 1T3TA 3T3OA 4CLOB 2PIAA 4ZQCA 4HTAA 1JHOA 1L4GA 4BO1A 3F1QA 3VNYA 2DIEA 4D9NA 3PB2A 4DR6B 4DEVA 1IHPA 4F21A 5IZCA 5IHXA 1VXOA 3MSRA 5BRAA 2IYPA 5E09A 2XGZA 4AG3A 4PMNA 3EWNA 4H0CA 1ES9A 2XCTB 5HQJA 1TO1E 4K6GA 1D0SA 2NUAA 3AEUA 5C4MA 4LZLA 4CD5A 5AKHA 1K6IA 4YXFA 3IQXA 5LMCA 2OHXA 3MWYW 4EYEA 3S2JA 3TZCA 2XUAA 4FK9A 3VX0A 5A04A 3DHUA 3HU1A 3I68A 1MW9X 2VLBA 4ZXPA 4GYPC 2PSJA 5EEGA 3RK4A 2J0VA 1S8N