5EMLA

Crystal structure of prmt5:mep50 with compound 10 and sam
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 203
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emlA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emlA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emlA02
3AWIA 4M7RA 4ATNA 5GINE 3P9NA 4QDJA 1KPHA 5EEHA 3SGLA 4RTNA 3IYLW 4HNOA 3EVDA 5HZMA 5DXJA 4FSXA 1XJ5A 1EQAA 3G5LA 4PIPA 4RVDA 3HCCA 2NXNA 3UJAA 5B1SA 4LWPA 1U2ZA 4PCLA 4C05A 3GIWA 4V0RA 5M5BA 3R9XB 2GH1A 1SVUA 5E1MA 1MUWA 3OPNA 3CVOA 3SSOA 4FSDA 3AALA 2J6VA 5T6BA 4RVHA 5DSXA 3A7DA 3ORHA 2ZCJA 2IH2A 5HIMA 2Y1WA 3NMUF 4OVXA 1VLMA 3LKZA 5EOVA 3GRUA 5CD1A 4Q7IA 4DQ0A 4PGGA 2IFTA 4X60A 2ERCA 8XIMA 2QUNA 5FULA 1P1BA 2OB1A 3FTDA 4R8SA 5E8RA 2QUMA 4G56A 2Z6QA 1K77A 2AOXA 3QZAA 5TNVA 4XUDA 5HIIA 3KPWA 1WZNA 2JG3A 3E23A 3R24A 1I1NA 2LD4A 2HWKA 3DTNA 2IPXA 3LCVB 3M0HA 5K0LA 3G8AA 4BLUA 4RTLA 5XIAA 2OU4A 1ZQ9A 5DSTA 1VE3A 2ZIEA 3DOUA 2PV0A 1NBIA 4GF5A 3I53A 3PS9A 3ELDA 2HTEA 3TLJA 1I9GA 1B42A 2QYOA 3EGEA 4X41A 3EGVA 5LQNA 1NBHA 4R8RA 4ER7A 4ZTBA 1KPGA 4EAYA 1UWVA 1VP3A 3EVGA 1A0CA 5E9JA 3WSTA 3GCZA 3UXIA 4PONA 4RTSA 3EEOA 4OA5A 3S68A 5LQUA 1FPQA 3G89A 5T64A 2FPOA 3BZJA 2FK7A 4QTUB 1NKVA 1XLLA 5KQRA 4RVGA 3HNRA 3ID6C 3REOA 2P8JA 1NV8A 3KQSA 3ER9A 1DXIA 1HMYA 3M4XA 2JJQA 2OO3A 3A4TA 3BKXA 3UWPA 1KHHA 1YF3A 9XIMA 2ZIFA 5CVUA 2NXJA 3LCUA 1R8YA 4DCMA 3Q87B 4DZRA 2Z6UA 4ZB5A 4KW2A 1EIZA 1RI1A 1Z3CA 3G5TA 3M33A 3LL7A 3OE4A 3I5UA 3P9KA 4KDRA 4R6WA 1Q0SA 3HCBA 4DMGA 5DM2A 3MGGA 3VC1A 4YUXA 4YTUA 1XLGA 2G8NA 1DIDA 5BW5A 1XIHA 3FUWA 3KQMA 3M6VA 1XXLA 1XVAA 3TM4A 2JHAA 2UYCA 3UJDA 4OQDA 4RX1A 3WQOA 3KPYA 2N47A 4H0NA 4BLVA 4YUYA 1I60A 3KQVA 2YXDA 3KHKA 1G60A 5H1WA 1RJFA 3A26A 4YTRA 3HA3A 5FHRA 2R3SA 5CCXA 5IH3A 2O05A 1G6Q1 1N2XA 3XIMA 2WA2A 2ZTHA 1JQ3A 5C9ZA 3AXTA 3TMAA 2I6GA 5FUBA 1QAOA 3HVHA 2FK8A 1S5NA 3LDFA 3P2IA 2ZBPA 4ER3A 3KBNA 1XLHA 3PVCA 3SX0A 3BWYA 1RJDA 4GJIA 2B9EA 2JHPA 4BLWA 4CKBA 5XIMA 5DX8A 1ORIA 3KQPA 3RW9A 1X1CA 4M36A 4KVZA 3DLIA 2G71A 4GOOD 5GP1A 4UOEA 1XLMA 3KCLA 2QW5A 4K3ZA 4GC9A 5F2NA 3O4FA 5K0BA 3GU3A 3T7SA 2PXCA 3KR9A 3FUXA 1XDSA 5CIYA 3BGIA 4GOMD 4PYLA 3ITVA 3BZBA 1QT1A 5CVVA 3FYDA 1NW3A 3OU7A 3V97A 3MQ2A 2H11A 3UBTA 1O9HA 1X19A 1XLKA 4M38A 3V8VA 4PFHA 5CVDA 3SXJA 3SMQA 1GW9A 2GPYA 4E2XA 1NT2A 3NVMB 4OQEA 4MIKA 1XYLA 3SSMA 3VYLA 1QANA 5FA8A 1ZGAA 3O31A 1D8WA 3QOWA 3KBVA 1SUIA 3I64A 3PLAE 4L7VA 5AVHA 3IV6A 3AYVA 2EJTA 4OBWA 5EHGA 4A8NA 2P40A 5E1OA 5K03A 4JXJA 3KQOA 4BP1A 5FA5A 2I57A 2UYOA 2ONZA 5AVNA 3P6LA 4QEEA 2GB4A 2OXTA 5MHTA 1XIFA 5K0JA 5LR6A 2IIPA 3ER8A 3IEIA 4A6EA 1EAMA 3KTCA 3UVAA 5DPMA 1NE2A 4QVKA 3LSTA 4R05A 1JG1A 1DE5A 1XCJA 5EGSA 3BKWA 3OZTA 2CWWA 3SVZA 4EQZA 2VP3A 3NJRA 3LDUA 1F38A 4X63A 2QRVA 3CBGA 2QY6A 3KU1A 7XIMA 2P7HA 2OZVA 1Y8CA 2YR0A 4XUEA 1XIDA 2AN5A 4C03A 1QTWA 1NW5A 1XYCA 1VBFA 3EPPA 3UJ6A 3B3GA 4DM3A 1RI2A 2B2CA 4YV2A 4EACA 4C04A 4QQNA 3AAMA 2GA9A 3FRHA 3K6RA 3PFGA 3T7TA 2B3TA 4HSGA 4RTQA 1AQJA 3CQJA 3FTFA 4XSLA 2NQ9A 2X7WA 3R6TA 3B3JA 5K0FA 4CKCA 2A14A 3G2OA 2V7EA 4PYIA 4GQBA 3CWHA 2OY0A 3KR0A 4DA4A 1BOOA 4MHTA 2H1RA 1EJ0A 2Q41A 2ORED 3T7RA 3UJ8A 3HCFA 4LWOA 2ZULA 4RTMA 1G55A 3G8BA 1H1DA 3KPJA 4LECA 4GC5A 3KBWA 5EHIA 3MHTA 3NTVA 4C4AA 1XIJA 4QDWA 1L3IA 3ITXA 1V39A 4Y30A 1VPTA 1ZG3A 2O07A 3KQQA 4AZSA 3IUHA 4ER5A 3PFHA 3C3PA 2PXAA 5B7ZA 1VL5A 3GDHA 3MCZA 3FPHA 3PX3A 2QM3A 1N7JA 2EX4A 1O54A 3OZSA 1I4WA 1XDZA 2VDWA 3SM3A 2AOTA 3HA5A 4X61A 1DE6A 3CNYA 2YVLA 3DUWA 2YTZA 2O06A 2CMGA 3GRYA 1BXCA 1XDUA 1MNZA 1JG3A 2PT6A 2ZZKA 3OFJA 1A0DA 3P97A 4FGZA 4HC4A 4KWCA 4QDKA 2OYRA 1ZGJA 1D2GA 3TKAA 2P1DA 2WK1A 3GNLA 4FP9A 3AYTA 2HNKA 3BT7A 1NW6A 3G2QA 4YUVA 4ZBCA 5E8JA 1JR4A 4WVLA 2AOUB 3BANA 2GLKA 2PWPA 5H6HA 3I58A 4AX8A 3NVKI 5F2OA 2BM8A 2ZVRA 5C0OE 5FWDA 1O9GA 3HVJA 5DM0A 3UJBA 1NW8A 3HA7A 4QVGA 5DXAA 2O0LA 4YTSA 3BWMA 5EPEA 3SSNA 4QPPA 3KBMA 3UFBA 4GOND 4ER0A 4HGXA 2UYQA 2ZBRA 1QAQA 5E1DA 3T0IA 2I56A 3CJRA 3DXZA 3IUIA 1UFKA 3ELWA 2IP2A 4XUCA 4EK9A 2YUIA 3KPVA 9MHTA 3GO4A 3ANXA 5BXYA 2QRVB 4P7FA 4KIFA 1X1BA 2EG5A 2PX4A 1JTFA 1F3LA 1R00A 4A6DA 3RIEA 5ICEA 4GEKA 4AUKA 5JR3A 2IBTA 7MHTA 1XIEA 1XLAA 2YXLA 3KKZA 2OB2A 4QEHA 1DUSA 4EVIA 5EMLA 4W4QA 4AZTA 1RJGA 3DX5A 3K0BA 1O1HA 4F84A 3LECA 2UYHA 1RI4A 2BR5A 3LBYA 3DBNA 5LSAA 4M37A 1MJFA 1M6EX 4GLEA 2VDVE 2YX1A 1G38A 3FPGA 5K09A 2G72A 2PVCA 2IDKA 2ZIGA 4Y2HA 3GNXA 1QYRA 3TC3A 2ADMA 4XISA 2ZSUA 2CKDA 3EMBA 3G2PA 3GWZA 2CMHA 1QAMA 4A8RA 2B78A 5FQNA 3A27A 4F86A 2NYUA 1XLIA 2IDJA 4Z2YA 1R6AA 3EVBA 3XISA 5FADA 3THSA 4QTTB 5DRYA 5E2BA 3M70A 3E05A 2NQJA 4BP3A 4IKPA 5EIFA 3FZGA 5G02A 3OU6A 5FCDA 1R18A 3KPUA 3L8DA 5CVEA 5EMJA 1X1DA 5DTRA 4C08A 3VNIA 4RTKA 3MAGA 4OBXA 3OU2A 5CM2Z 1D2CA 4US6A 3EVAA 4PGLA 1PRYA 4YMHA 1Q0TA 3D2LA 3FUTA 1P1CA 3ME5A 1NW7A 5EG5A 5EVJA 3BWBA 2FRXA 2IGTA 2AOUA 4YTQA 2E5WA 3BUSA 3JWJA 4PINA 1OR8A 2XIMA 4CTKA 5LQCA 1SQFA 3FTCA 4RTRA 3LBFA 3U0HA 1G8SA 1RJEA 2Y1XA 1XINA 4A8LA 1L3CA 1SG9A 3JWIA 1A0EA 3QXBA 4XCXA 4ER6A 5ICCA 2GS9A 3EVZA 4WXHA 2IH4A 2BZGA 2ONYA 4IV8A 3MB5A 3O7WA 4O29A 4J4KA 2NQHA 4XIMA 1YX1A 2G1PA 2BR3A 2PSSA 3BXOA 5HIJA 4RTJA 3KBJA 4E33A 3M0VA 3CQIA 4FT2A 3X0DA 4QE4A 3Q7EA 3PTAA 5DTMA 3VNMA 3B5IA 4E2WA 4YUZA 3MCTA 2ZVJA 4ZB0A 3TR6A 4DKJA 3NGFA 3C0SA 3QOXA 3NWEA 2IBSA 1SQGA 4C06A 2XINA 2PKWA 3FUUA 1DL5A 1EG2A 3VYWA 1QUMA 3KWSA 3VNLA 3FPEA 2C7QA 3EGIA 3AY0A 1XLBA 1QZZA 1BC5A 3LHDA 2NP7A 4FZVA 1HNNA 5J8LA 1JTEA 1L9KA 2GYIA 3IHTA 5U4XA 5CVJA 3HCDA 4QQKA 4QE5A 5KS2A 6XIAA 4PGHA 3LMZA 5CCBA 1YZ3A 4LG1A 4GUAA 4PYQA 3HEMA 3VSEA 3UA4A 2G0WA 2XVMA 1BXBA 4A8IA 5K0EA 2XISA 3CQKA 1WXXA 2PXXA 1JG2A 2HCVA 3PB3A 1XCLA 2ZW9A 3N4AA 1WXWA 2ZDSA 2JH8A 5F2KA 5LQJA 2Q02A 3GJYA 3R3HA 4FT4A 4IWNA 5FHQA 1YZHA 3KQYA 2BR4A 3CJTA 5GM1A 1D2HA 3GRZA 5C1IA 3VC2A 3M0MA 5D1NA 1ZKDA 2P7IA 5HILA 4RWZA 4XIAA 1ORHA 2K4MA 4F85A 3UA3A 4HHLA 2AR0A 3ITTA 2AVDA 3OFKA 4PYNA 5DX0A 5FTWA 1YFLA 3C6KA 2DPMA 4GBED 1AV6A 1T43A 3KCOA 2PLWA 1TPYA 3HTXA 3XINA 3AJDA 1IXKA 4HH4A 4E2ZA 2ZBQA 2OPBA 4K6MA 1L1EA 2PWYA 1NV9A 3HCAA 2AOWA 3OE5A 4YV1A 3PX2A 4P7GA 4E3VA 3CGGA 3OZRA 4MQ4A 1XLFA 1VP9A 2YXEA 3BWCA 3BWWA 2PBFA 3ITLA 2C7PA 3FPJA 2AVNA 2PGXA 2YQZA 3DMFA 4YMGA 2UZ4A 10MHA 1WG8A 1AQIA 3CQHA 1L3BA 4NECA 3HM2A 4E30A 2HK1A 3KCJA 3BGDA 4KDCA 2F8LA 5DX1A 1PJZA 5LQAA 5ICFA 5B80A 4RYLA 5I7GA 3CCFA 1JG4A 4KIGA 3EMDA 5BP7A 4QE1A 1JQEA 4OX9Y 5T67A 3CKKA 1S5MA 3KQTA 2QULA 3OBEA 4R6XA 5K0CA 1YUBA 2AS0A 4PWYA 3ITOA 2I7CA 3DLCA 2P3OA 1RI3A 2B25A 1FP1D 1N7IA 2GVEA 1ZHFA 1TW2A 2GLUA 2OBFA 5EMMA 2ZFUA 5EKUA 3B7PA 3JWGA 5DM4A 1TW3A 1VIDA 5XINA 3M0XA 2ZWVA 3HCEA 5K0GA 1XYAA 1XLDA 4E70A 4DF3A 1SUSA 1XIBA 4LNCA 6XIMA 2HV9A 3AXSA 3MTEA 4HGZA 5DRTA 1WY7A 3BZGA 3VNKA 4EKIA 2FCAA 4BY9E 2R6ZA 3M6WA 4U7TB 2CL5A 3M0LA 4PCAA 5E9WA 5HIKA 2EFJA 3TKYA 4CTJA 1JSXA 2PX5A 2PT9A 3A25A 3FRIA 4MTLA 5EKXA 5LQKA 3UZUA 2BM9A 4YUWA 3JWHA 1IM8A 3DXYA 3TVAA 3TOSA 4E31A 1XP3A 5EZSA 4POOA 4KRGA 1R74A 5GOZA 2VZ9A 3U81A 4PYJA 1MHTA 2Z6AA 4P7JA 4DVOA 2ESRA 3EEYA 3MTIA 4PNEA 4RTOA 3DULA 2VS1A 4U7PB 1BHJA 4FS8A 5GWXA 5GM2A 5K01A 2AOTB 2P41A 3F4KA 2AZTA 2P3LA 1JQDA 2PX2A 5IKMA 4MWZA 3G2MA 2ZLBA 4IV0A 4GJJA 5GIOE 3THRA 4C07A 4PIMA 5EQJB 5LQRA 2XBMA 3TRKA 3G7UA 1SKMA 4HTFB 8MHTA 3IUDA 2NNWB 3KBSA 2XYVA 5K0NA 3NW9A 3QYSA 3P8ZA 3UJ9A 5GIPE 5DWQA 4PYKA 3KQWA 2NXCA 1BKYA 4QPNA 2O57A 4EMSA 5HFJA 5HOQA 5ERGB 1G8AA 3GRVA 1XLJA 2FHPA 3FPFA 4OA8A 2FYTA 5KYGA 3ERCA 4XKMA 2PJDA 2AOVA 5D1HA 2C7RA 1I6NA 2P35A 3ELUA 4YV0A 3M6UA 4CXMA 3LPMA 5DTQA 3A7EA 3C3YA 3OCJA 3B89A 2G70A 3C6MA 3PT9A 4ZB2A 1XIGA 2H00A 1VQ1A 2KW5A 2XYQA 3UJCA 2HK0A 2XYRA 4KW7A 3ITYA 1M6YA 3TPZA 4EKGA 5FQOA 4K1GA 1UIRA 3CC8A 2OKCA 1DIEA 3C0QA 3C0KA 3H2BA 3LGAA 4QDPA 3P9CA 4HRAA 4HTFA 5K05A 4DUOA 1FJXA 4V0QA 2GAFA 2NXEA 5DLYA 2GUBA 4ISCA 1KR5A 3EVCA 1R8XA 2AN3A 4CWAA 5BW4A 3E8SA 2PX8A 4HG2A 9XIAA 5E9QA 3C0LA 2WA1A 2I9KA 2X7VA 4GOLD 3UU0A 4AZVA 5B7YA 3SR4A 4AZWA 4P58A 1XYMA 1YB2A 3G88A 3GXOA 3CJQA 4RSRA 3TQSA 3UJ7A 4PYMA 1FBNA 3DP7A 1TZ9A 2AN4A 1KYWA 1XYBA 1XICA 1XIIA 4YTTA 1KXZA 2JH9A 2VDUE 3MERA 8XIAA 1KIAA 3QC0A 4P7KA 2ZWAA 3DH0A 3TFWA 2C7OA 2DULA 3M6XA 3KR1A 3KR2A 5E2AA 2PY6A 3I9FA 3EVFA 5EZQA 1XLEA 1WS6A 1FP2A 4XSMA 3P14A 3FVMA 3JU2A 1OADA 3FUVA 3B3FA 4DCGA 3NWBA 4E32A 5FWAA 1AF7A 3NDJA 5K8VA 3E7PA 3QV2A 5E1BA 5DT2A 3RODA 2P3QA 2JHCA 3DXXA 3FYCA 4E2YA 5EIWA 5KVAA 4RTPA 2G4JA 1KYZA 4RVFA 4CKEA 1KP9A 5JUWA 2QE6A 1X1AA 5H02A 3TM5A 1DCTA 1XLCA 2HR1A 4B17A 3HVKA 3P2EA 3FTEA 3P9IA 1XISA 3P2KA 3LKDA 2I62A 3DMGA 4HGYA 5P8WA 1YFJA 1JSZA 4X1OA 4RV9A 3HP7A 2ZZNA 3L23A 5HEKA 3NDIA 3GGDA 2EJUA 3M0YA 5CUQA 1P39A 3P71T 3BGVA 5EEGA 3VNJA 3U3HA 3BDKA 1RI5A 4PYOA 3ELYA 4HHMA 2IH5A 1INLA 2V74B 1IY9A 1P91A 3GRRA 2BH2A 2ZZMA 1XIMA 3HVIA 3R0QA 3LCCA 5EMKA 2XVAA 1CLKA 1EJ6A 3DMHA 4FR0A 5DM1A 3EVEA 1M0EA 2HMYB 3LDGA 5EC8A 5ICGA 1XTPA 2NP6A 5KQSA 3LX6A 1KPIA 3DR5A
chains in the Genus database with same CATH superfamily
5K8LA 5DYTA 5KQPA 3LENA 4PC7A 2WWVD 1B3ZA 1B57A 1N8IA 3VGJA 5I9MA 4CM1A 3FIUA 3RAGA 3O1IC 3P8JA 1M1NA 1KM1A 1R7AA 1HQKA 3MHFA 1C80A 4DIMA 3TW6A 1S5TA 3FTDA 1B8OA 2XT6A 1FFYA 2AL1A 5A4IS 5BCAA 3P27A 1I1NA 3EFEA 4MWAD 5BWLA 4H7HA 2GK7A 2A6NA 3EX7C 1BEZA 3V5NA 2AI3A 2PE5A 1CJSA 4BCCA 2ZAYA 4Z54A 1F5NA 4QSFA 1WLSA 1Z35A 1GPAA 4EIVA 3W4RA 1P6UA 3BGJA 2FHCA 4G3XA 4U2YA 4RHEA 3PZBA 1M6HA 4LRXA 4JY9A 4WA7A 4HUQA 2Z4SA 1BPLB 5AVVA 3N05A 1CLXA 3T7DA 3HZ3A 2W6CX 2OR2A 2B9EA 5FKJA 2WW5A 3W3AD 1DBQA 3WGTA 4M0DA 3TBKA 1O6IA 2XQGA 5L7YA 4KEVA 4FF7A 3VIPA 1YRQA 4RELA 2CGEA 3BE7A 1DEAA 4HA4A 2IIPA 4YRDA 3KTCA 3S42A 2VWSA 3CNBA 1LQAA 2F6UA 2OODA 5AHKA 4H04A 3MWYW 4MCJA 2O0KA 1OXMA 5FBVB 3HTWA 3UJ6A 4H4IA 4BV8A 4J3NA 3OA3A 5EP4A 1I2CA 1GPJA 3F4CA 4DA4A 5BT8A 4BFXA 3UXKA 2DBZA 2OOSA 2Y4NA 1ZG3A 3SQSA 5I9BA 1GAJA 2DVTA 2FP4B 4PPGA 4MW1A 3EAGA 4NBRA 2B36A 2XGOA 3OFJA 3OP2A 1QIHA 1DBPA 2IXDA 1LQTA 2ZR0A 4M29A 3OT1B 2FLIA 3NSNA 1N6PA 2BHSA 2J9ZA 3ZU4A 1RTKA 3MCAA 3PSVA 3B38A 1KH1A 3UPBA 2UZ3A 2DLDA 5AVSA 2A92A 3A4AA 5DI9A 3GG7A 3OIDA 2IODA 5KVQA 1LBHA 4KZKA 2EG5A 4Q3KA 5A5DA 1L8XA 2VQTA 1KFLA 1DLJA 3GQBA 4KH2A 4I1OA 1QB7A 2OHOA 4FXSA 4PH6A 3Q15C 3RVRA 1GCAA 1WDLA 2PKCA 1O6FA 5CCEA 1JEJA 5IULC 1YWGO 5LP6A 3KSUA 2WFMA 3EVBA 4G1NA 2XQIA 3E05A 1NC3A 4EYEA 4KGDA 3AUOA 3KYJB 4ERGA 4X92A 2WWWA 3PZUA 1H7OA 1F9CA 4US6A 1A4MA 1GQOA 3LHIA 1TB4A 5EVJA 3OVMA 1Z75A 3Q6IA 5IYZF 5F4SA 3WLIA 2VZSA 3VNRA 2PPGA 2CE7A 4OKIA 3CH0A 1TMGE 5TE9A 1PX2A 1OTYA 3CNNA 3MMWA 2VA8A 2QT9A 4IJMA 4NE2A 4PYQA 1JEAA 2O7QA 1IPEA 1U31A 3KQYA 4IDOA 5D33A 1WSBA 2COKA 5DW0A 5JJ5A 3SVLA 2NQ8A 4NU5A 1XD1A 5DX0A 3BCRA 4DLNA 2DPMA 4R68A 1AV6A 3B60A 5JZBA 2BOEX 3G1DA 2G6TA 4AU1A 1XVUA 5GMOA 1WB5A 1SZRA 3GU1A 2W00A 3U3DA 1M2GA 4INFA 3KLMX 4CKQA 5B12A 4P8VA 3W2LA 3JATB 1W0KD 4A8PA 4E1AA 3IS4A 1FP1D 1ZX1A 4HPHA 3L66A 3FKSA 4P83A 1NJFA 5JHGB 1I1XA 3T2PA 4BB5A 4WY0A 5B3JC 3V0UA 1QIJA 2AIRA 1NVKA 3QLVA 1OWMA 3K5WA 1YV9A 1R74A 1OFIA 3K9BA 4CM4A 2GRJA 1ORDA 1LNQA 2EKPA 2BUBA 4PHTA 4L4MA 3WLQA 5AUNB 4L0CA 2O2CA 3PGMA 2ZB8A 2J7PD 4N5NA 4C6EA 3QV9A 3RF9A 2BMVA 2J41A 3SAJA 1G0CA 2GDQA 3HDVA 3MS2A 2FHPA 7REQB 4EB0A 4F92B 2RH5A 4CL2A 3E0XA 4KXNA 2CNNA 5DV9A 3IEKA 1IQ8A 2AX4A 5M7EA 3EVCA 1CQZA 3EA3A 4JUCA 3TW7A 4NPHA 2FMXA 4DO6A 1LJYA 1MRQA 3GTXA 4B0OA 4Q47A 2HJHA 3PX7A 1T25A 1V3LA 3RS2A 1BA3A 1OGSA 1BWLA 1F2UB 3TXYA 4DCGA 5BP7A 4DOMA 3KJHA 5G1TA 2XIBA 3LUHA 4QHTA 3G17A 2XBMA 3OKPA 1CRPA 4ADSA 1V1MB 3M0YA 4AEEA 3THYA 1GT8A 4IGHA 1I51A 4B6QA 2ZWYA 4W5OA 3ZQUA 3TLKA 5I3JA 4WEVX 4ATNA 5DEZA 2WBGA 1RKQA 3KUUA 4DMCA 2NXNA 3TGLA 4KFOA 1DXEA 3SN6A 2ZOXA 4GC3A 1QAPA 4UNLA 4AJPA 1WBHA 4TKUB 4Q4AB 1XH0A 1QHHA 3NL5A 4V0OA 2QTTA 1P0DA 2OO5C 4R8SA 1I6LA 1J99A 4U8HA 3LLUA 1TRDA 3JRKA 5G4EA 1QHFA 3DLPX 5E6UA 2XVNA 3GEGA 6ADHA 1M66A 2VHYA 3L1HA 1BFKA 1U3UA 1NXQA 4HA1A 1FPQA 1QIFA 5DCBA 4Q6XA 3VMMA 3C7CB 3CW2A 3R20A 3VNUA 1EOMA 3GXDA 1JVSA 1Z3CA 4Q15A 3VK5A 4H3SA 3RMEA 1D2AA 4L6IA 2EJBA 1O5TA 5CFRA 1T0HB 1LI5A 4OL9A 2YXDA 3VKCA 1GQQA 4GXNA 2PUVA 3THUA 5IYZB 4UU8A 1Z5ZA 4GJIA 3BXPA 1SU8A 2OORC 2GCNA 4AD5A 4QEDA 3BZBA 1TA9A 1XH2A 1J9GA 4RZHA 4GI5A 3H53A 1CQPA 2EL7A 3CEPB 3ETCA 4MR8A 3R7LA 1Y34E 5AVHA 3VE9A 4GVGA 4UVIA 3AUXA 3KHTA 2FU5C 2VWQA 3QQPA 2QROA 4LSWA 3LH5A 5JMTA 1KEKA 2XVXA 2FDSA 2FFQA 4EG7A 1ECPA 1FUYA 4H9GA 3RSQA 3K6RA 5DNAA 2KE5A 1U8UA 2VH2A 4LCSA 4JX8A 3G13A 2PV7A 1XIJA 3K2BA 3KTSA 4HPGA 3PFHA 5IAJA 2ZJ3A 4AH7A 3P4YA 1FFRA 1N2EA 1Z4JA 4JL8A 3WNDA 2X4LA 4DV3B 3W6UA 2QUZA 4NE9A 3U49A 3WYAA 5LBIA 3G23A 2IS2A 2WKLA 3O8AA 4HK7A 3RJMA 3HEBA 4UBMA 6GPBA 2GYYA 3PZQA 4CW7A 4LY0A 3A1WA 3CUYA 2ZYSA 4D3SA 1UZHA 2FW0A 3CLTC 3JAKA 1DT3A 3K96A 4HAXA 3R3WA 1O94A 4GOND 3N11A 1R8JA 5D02A 5FADA 3DHWC 3EZXA 5IARA 1A5SA 2RHOA 4IKEA 2ATVA 4RTKA 1EM6A 2J6HA 2UZ1A 1P9NA 4FONA 3MUOA 2N46A 3Q2OA 2XECA 2WIJA 1IHUA 2BKLA 1SWWA 2PUFA 1M01A 3C5WP 3WDSA 4OJKA 4XAPA 1D7OA 2OENG 2JGDA 2R25B 3UCCA 1S8FA 3BPSA 4BWLA 3Q10A 5J23A 4LV6A 4GZ3A 3BB1A 3ZGNA 3RPEA 1TTIA 1JALA 4O8RA 4IS3A 1JNDA 2VTBB 3DV2A 4EKYA 2WF8A 5K4GA 3VMNA 2Y63A 3CV1A 1P2DA 4FDTA 5IJ9B 4PGFA 4YO7A 4JP2A 1JDBB 5A69A 3WGGA 4E5KA 4QXMA 3HMQA 4WUVA 4BJ6A 1LYXA 4HA3A 4B5VA 1JS1X 1PJ2A 2JIRA 1C8VB 2XSBA 3AEUA 1XCMA 3BH4A 3VBEA 2X1UA 2FPPB 1CUJA 3INRA 4Q4HA 4UQAA 3GVXA 4QICA 1SCDA 3H11B 4Q9AA 1II0A 1YK1A 2HK1A 2VQ6A 1KLYA 1KKUA 3AGQA 3EY4A 2Y92A 1PW5A 4BNXA 4RS3A 3WSVA 1GPDG 3BD8A 3TEMA 1SUSA 3K09A 4YQEA 121PA 2UZIR 2H0QA 3TR9A 3M0LA 5BYWA 4J9UE 4K36A 3FRIA 5WRFA 1DTNA 3FA2A 1PZEA 4MROA 5EJ6A 1KR1A 1ES9A 3QXXA 1CTNA 1FU7A 3B9PA 1KC3A 1OH8A 2QMHA 2I22A 4DUWA 1CGUA 2VX4A 1OJ7A 2Y6VA 5FNVF 4UTJA 2TYSB 3NHUA 4EJ6A 1CZUA 2IOFA 4ZL1A 4MB5A 2QX7A 3IUBA 3ZY3A 3TZKA 3RUAA 3O90A 5J2TB 4ZYUA 1WOBA 4GWEA 2RC5A 2IVZA 1KJWA 2X0JA 2B8EA 4L8GA 4JHXA 1E2LA 5TJHA 1UEXC 1ZPTA 2P10A 4K0RA 1A88A 5CX1B 1ZAHA 2E1PA 2PUGA 3AVYA 2C88A 5DEOA 3CONA 1BYIA 3O5AA 1PEYA 4GBDA 3R23A 3UH0A 1OADA 4F3KA 3FYCA 4J1OA 3ZWQA 1AXRA 3ZOZA 4ZC1A 1G5TA 1RSCA 5TRTA 4C0QC 1SHUX 4XBKA 2VNAA 5ENDA 4GZ7A 3SB0A 4EVRA 4M98A 1ZY9A 2CFTA 5I78A 1ECGA 4RH0A 1RRPA 1J23A 3S2JA 1KZGB 1GTJ1 2OKOA 1Q21A 2WFZA 1NM5A 4W5ZA 4FWBA 5T64A 3TPFA 1G9HA 3T5BA 4K05A 4GNRA 2ZXEA 1RVDA 2B4TO 2OT0A 1PJTA 2F8MA 5KTOA 1CEQA 3BAJA 1CGTA 4R51A 4BNLA 1NLFA 4BS0A 5AW6A 4JV5B 2QF7A 1VBHA 2HFKA 2CLIB 3WIDA 1W1PA 3FAXA 4V39A 3OZFA 4UM5A 4X41A 3CUJA 3STFA 1E6CA 4HEQA 4S3AA 2BVDA 4DJEC 2YXXA 4UE2A 2XCIA 3RARA 2INZA 4BWGA 5L3QA 4I4TF 3NQEA 1CQIA 1IMJA 2YOHA 1XU9A 4L16A 1FH8A 1EIZA 2D1QA 3GLFA 1JG7A 2PGFA 1GNVA 1AQMA 3H2FA 2C3MA 2HS6A 2DT1A 2Z04A 1XTBA 3R11A 4EW3A 5BQXA 3P2YA 2VYND 3FLAA 3CPHA 1NNEA 5DDIP 1SOUA 1IZ0A 3A6ZA 3ZR5A 1RWKA 3A31A 3TE7A 4N5DA 2VSQA 2J9YA 1Z16A 1SKYE 1BWKA 2JFXA 1Q95A 2KQUA 4NARA 4DV0B 2J9XB 4E13A 1KM0A 3AFGA 2PG3A 3O6VA 1JI0A 3N74A 5JCJD 2LKCA 3GHHA 3SVZA 4P3YA 1D3GA 1TQHA 1YASA 3IEXA 4GLOA 4DKJA 3QENA 3HGTA 4GIAA 3U0VA 4YV2A 3FDZA 3V32A 2F4VB 1RAHA 5KBYA 5J3JA 1RM0A 3BTUA 1PWLA 1TA3B 3N2CA 3H97A 2AFIA 1GZ7A 4JYAB 1IL0A 3CSUA 1Z4LA 4ER5A 3HZHA 1UWKA 5HAOA 2TMDA 5G5IA 4UUBA 4JHMA 5FNZA 2G97A 4C6FA 3P26A 3CHVA 3BT7A 3CUKA 1E62A 3USCS 2A7PA 1BKDR 4QVGA 3YASA 3DFNA 3WBWA 4WZBE 4H8HA 2Y77A 4TZ0A 1P1MA 3ANXA 3MUFA 3MCMA 1KO8A 4IM7A 4CHGA 1GG5A 4AWSA 1TJNA 2YXLA 2A1TR 3VD4A 3U9LA 2VI0A 4DIOA 3HCOA 1RI4A 3W78A 1MJFA 4LE1A 4OHZA 1KA9H 4H7CA 2CLKA 1UD2A 3SN0A 1YBAA 3U1BA 2WMFA 1OX4A 1FY2A 5A5EA 2YY7A 2C3PA 5A3HA 4RPQA 1TIKA 4DNQA 3ZZUA 5CSSA 4FEAA 1GT91 2LGJA 5DNYB 2RAGA 4CVWA 1HL8A 3WQBA 4XE5A 1SO4A 1XXHA 4GSKA 4MVJG 1ZHAA 2BPOA 1E6XM 2CL6X 1FDUA 4PLTA 2QEZA 3C0SA 5EP2A 3K70C 1NATA 4YAWA 2CJWA 4QE5A 2ZX8A 5KS2A 5FEUA 1VXOA 2PVSA 1O5QA 4CCZA 4ZZIA 2D5CA 4GG9A 4DM2A 1D1QA 4N3NA 4AFNA 4OKDA 3G0CA 3ORFA 3WDJA 4RKRA 4CQAA 3QG1A 1J9YA 5CEFA 1YB4A 3AJ8A 2V0TA 4DMMA 3L7YA 3HG5A 3TD2A 5CA0A 1AH4A 5HPCA 1PJZA 4IX9A 3W77A 4WCFB 1FK8A 3G0HA 1KB3A 1OFOA 3FFXA 3TD6A 2GLUA 3NDYA 3B7PA 1PNTA 1DQYA 2HV9A 3II6X 1IIGA 4OGWA 4YMWA 2JLWA 4PCAA 3K5XA 5CJ2A 4R53A 5EKXA 3DLAA 1QR7A 3PFMA 1YADA 2VC6A 1VJ1A 2ZK7A 4R8KA 2ZBTA 3IQEA 3PXEA 5IBXC 3ADPA 5JIWA 3PE6A 3D8SA 1NY5A 2SCUB 2QUIA 1Z6XA 2JLRA 3X1YA 4ZALA 1XTTA 3P8ZA 3ONDA 3ARZA 2ICAA 1J5PA 4KEAA 3ERCA 1GVYA 2J9XA 3TSWA 3INNA 4CQJA 4YP7A 2V8ZA 2CXPA 4CNOA 5DP1A 1C9KA 1SCJA 1DXHA 2OM6A 3TNJA 3VOAA 1EBUA 1YXDA 3I6BA 2P0IA 2L69A 3A3OA 4OGLA 3A4YA 4BBJA 2UVPA 3KR1A 1K5HA 2QV5A 2PLJA 3JU2A 1X1ZA 4E32A 3AP3A 3WQVA 3VZDA 4ZQCA 4J43A 1XD8A 3AZRA 3K2IA 5EZ6B 1HO1A 1RK6A 1CX9B 4DCOA 3C4UA 3W8DA 3AEXA 4UPVA 4LY8A 3URKA 3RAEC 2WMHA 2RHDA 5BV2P 3OT4A 3GFQA 4KPLA 4HNOA 4BMNA 5KTSA 2AK2A 4NQZA 3B8TA 4V1CI 3LK7A 2I76A 3JD0A 1IF2A 2BT4A 3PQ4A 5H80A 4MRAA 5C8DA 2FB9A 3T12A 1FWAC 2ZI6A 3KD3A 1L5WA 4FMDB 3ZWTA 2J0QA 3Q5EA 4G5QA 1DXOA 3PBVA 2G83A 5G4LA 2P1ZA 3PQ5A 4ZCTA 1VE3A 4BCEA 4OMUA 4MWOA 4ER7A 1KGUA 4RIFA 4C1NA 4YRKA 3ZJKA 1VGAA 2PRMA 4MY8A 3K15A 4K86A 2VFIA 3TO5A 2ZJFA 4CTOA 2V5VA 3GW3A 4FCCA 4JODA 2LXNA 4TTPA 4YRIA 3OZCA 1UMKA 4LNUA 4KHZA 4ECEA 4L1WA 3MSCA 2YIHA 2XVKA 1R30A 4WKPA 1LJUA 3EX2A 3EH2A 2P4SA 3MMZA 3V9PA 3JQDA 3EX6A 3KHUA 3EWXA 3ARPA 3NIFB 1U7XA 4ENRA 1KV5A 1RPZA 5HM8A 1EXVA 3TPCA 1GKPA 5C5DA 2H4WA 5KNCH 1V8DA 4B8YA 3PR3A 2PHZA 2G4VA 4NU0A 2ZVDA 4CR7A 4GUIA 1XRLA 4Q66C 5BXPA 2SHKA 3MSYA 2J0EA 3AOEA 1YZTA 3Q37A 1R6DA 1YR2A 2PLKA 4KMSA 4FDMA 4HSHA 1C30B 4KIWA 4OTZA 5JMPA 3KC2A 4KERA 2PVPA 1G5PA 5JZ9A 2XMSA 3KSAC 2AQIA 4ENVA 5LA6A 2D6FA 4QUEA 3T1QA 3BL6A 4LECA 1TQ4A 5KMGA 2CXEA 2WWFA 4X1KB 1QDSA 4YXFA 3DZIA 1PE0A 4F3RA 1M74A 1Z5VA 1Z5NA 3FZYA 3L8HA 4Q8OA 1YQUA 5CG0A 1WZCA 4V15A 3N2BA 1OC7A 5IBQA 1PTAA 5A62A 1Z3NA 3H21A 2HA7A 3T0IA 4BNDB 5CLHA 3V7FA 1JUDA 1VJTA 2NV6A 4NICA 1A9SA 5A0VA 1JIQA 4LYDA 3AEUB 1W7AA 2ZSHA 2JCYA 4AZ0B 1MQRA 3WO1A 5HANA 3WLFA 1G0NA 5LVAA 3GB6A 5AR1A 3E22A 4RDHA 2J85A 2NYUA 4ARZB 3VVCA 1ZZMA 2PB1A 2JE8A 3CIVA 3LUJA 2XYGA 1NH6A 1WHTB 4PO9A 3UWZA 5FUWA 4B47A 3NH9A 4M22A 1NVDA 2YCIX 1JAHA 4N03A 3O38A 5JRJA 1TA0A 1OFHA 4ER6A 3DZ8A 1M1YB 1EVLA 3A6HA 1SG0A 5HJEA 4RK1A 4C6JA 3T6CA 1S2TA 5DTMA 2Q3DA 3NGFA 4GG1A 3F6RA 3NWEA 2FYMA 2R11A 1JF8A 3FS2A 2GEVA 3AY0A 5HSGA 3G2LA 4DIUA 4BBZA 1YS4A 4BFAA 2NV1A 2ENWA 5T8KA 3RC9A 3GDFA 4NJMB 4HYVA 1AL8A 1Z8AA 1DC5A 4DAEA 4K9PA 4N12A 1YRYE 2WP8J 3DBRB 1U3VA 2WT4A 1TZKA 3RGTA 1G8HA 1EVZA 1NDWA 1UZ4A 5I7UA 2AK3A 1J11A 2DWOA 5E0KB 1VSBA 3DFPA 3PHHA 4ECAA 2F84A 1U9IC 4WN9A 1ONSA 1CQWA 4FLFA 3ZXUB 4RHYA 1V4VA 3KKLA 2OXIA 1IRIA 2O8VA 3QKEA 4UFNA 4PG7A 1PV2A 3H8JA 1XLDA 5LGZA 1PT8A 5LN1A 3B2QA 5EXXA 4F8YA 4AB4A 5ABEA 1N8TA 3EG9A 4BMZA 5DW3A 4EPXA 1RAEA 4K9MA 3EHEA 1NRIA 3RR2A 2WFLA 4KLAA 4QBGB 2R86A 1X2BA 1TM3E 1GTG1 1EUDB 4OJQA 4BFSA 3VIFA 4EF8A 1FOEB 2ZLBA 3SQDA 4K7VA 1PZ0A 1CPUA 2GETA 1KKOA 5GIPE 4HQ6A 3AF3A 3SC2A 2G63A 1F51E 1GKIA 4S3GA 4RMGA 5A06A 4JD4A 5FJPA 4RANA 2A8YA 4AZ7A 4F56A 1XTKA 4TN1A 4B4WA 3NAMA 2G17A 4DUOA 1MUCA 5JECA 3H54A 4DIKA 4KR6A 5DNEA 5HPYB 4DSZA 1EP2B 4Y9RA 3V4ZA 4RY9A 3OZIA 3VKUA 2QR2A 2V4MA 1G1AA 3ONCA 2OCDA 2YS6A 1XRNA 4JOQA 2VYFA 3W5AA 3TVYA 1BQCA 3TH6A 1JW9B 3H87A 4WOPA 2XOKD 3FDZB 1BVWA 4IJVA 2DOKA 2YBDA 3QU2A 3B9NA 4B3FX 2Z3VA 1DTEA 3T54A 4OYLA 2QGNA 1AW5A 4KUEA 5AQ1A 3WQEA 1M2OA 3FWZA 2J25A 1NRWA 4D82A 4FFNA 1PSWA 5CLWA 3W7OA 3AXKA 4PCTA 1GCUA 1P75A 3KL3A 1FLNA 4D43A 3IT3A 2PN1A 1TAHA 2MNRA 4LUIA 1A47A 5FDFA 4DRZA 1YOVB 3NO3A 1VA4A 2SKCA 4ITUA 3U44A 4O4IA 3I3DA 4L6CA 3CNHA 4EI7A 3OU8A 3NVDA 5DBUA 1GFWA 3PRHA 1CHDA 2HTEA 4Z2LA 1TM7E 4ZPJA 1V3VA 3EPNA 4Y6GB 4A8JC 2J9GA 4PQYA 3ZJYA 3V7NA 4CF3A 1CUVA 4NL4H 5LZ2A 4EHAA 2QJTA 1RPTA 3RVQA 2OO3A 3QUQA 1PBNA 4Y6QA 1DYSA 2V9CA 3T1TA 3QU9A 5CJNA 2ET6A 3UWUA 4CIYA 3EPLA 3IA2A 2Z2AA 3ZLJA 1TJPA 2I67A 4AYSA 4G5DA 2E5CA 3SCRA 4QULA 3TKLA 4FMVA 1B1YA 3AUAA 3RU2A 5JH1A 2C9MA 1G41A 3DKLA 3HKCA 3EOLA 4P5DA 3GSMA 1BFDA 4E7OA 1TELA 5D9OA 1XUOA 1DWJM 1KMNA 4JBIA 3R0KA 2YS7A 2BLNA 2FR8C 3IAFA 1DWQA 1PL0A 2R751 3PPHA 1OA0A 4RCYA 2JFYA 1YJ5A 1UWLA 2XVGA 1VG0B 1KC7A 4QNNA 2FEWB 1NW5A 4DR6B 1GNPA 4D0RA 3OZGA 2XJ7A 2VQUA 1ODCA 2VJXA 2G6BA 3W5DA 4GNVA 1G55A 1NY6A 2HV8A 4E51A 1U9YA 5FA6A 2GFQA 1QPNA 2G3IA 3OIYA 3C6YA 4ASUD 5JT1A 2Y6UA 2J79A 1O54A 1PWMA 4IIYA 4H3HB 4NZMA 4JYPA 5ECVA 1MNZA 2LE0A 2FA9A 1ZK1A 2P1DA 2QN6A 1L7QA 4JJFA 3PJRA 2PSEA 2V03A 2QHXA 3PAJA 4KRFA 1RWMA 4D5EA 5HJ2A 3ZM8A 2HK8A 1C7ZA 3AMDA 5JNUA 2YIMA 3UIEA 1NNSA 2WZBA 5C3UA 1BXZA 5K6AC 3U5YA 1TM5E 3WQCA 1TM2A 3I37X 3A27A 1HF6A 2IDJA 3XISA 4WSJA 4RV3A 4X2RA 4G1VA 2J4FA 2O2XA 2P9BA 2YIVX 3FZGA 5FCDA 5JSHA 2UBPC 4ZEWA 4KO1S 2BOGX 3LBOA 3VOHA 1NURA 3QBUA 1V45E 1YI0A 4P2BA 4O4JA 3KYDA 2ECKA 1TJ0A 5KQMA 2GS9A 1LV7A 1MEIA 2NLIA 4OLJA 4NCJA 5J1SB 4R2WA 4UOZA 4CCSA 1TWDA 4TM7A 4RK6A 1CP2A 3H65A 4W8GA 4RHTA 2XDQA 3PGLA 2PTXA 4JWTA 4LDNA 3HWSA 1E0WA 4GCAA 5LL6P 3CO8A 4CMEC 5C8YA 1XCPA 3NX4A 3ZY6A 3PHBE 1NA5A 5GJBA 2GSJA 3UV7A 3U4QB 4M0MA 5ALIA 2Y7GA 5JH7F 2VTVA 5ICFA 5B80A 1JFFB 5A0FA 1S5MA 1OTXA 5EJ2A 4ZTZB 3ZCRA 2BMFA 4MXDA 4NF2A 3EDOA 1JFSA 1YRWA 3NG3A 2Y0DA 1EC7A 2ZWVA 4K88A 1MXGA 4H9YA 4WK4B 5H16A 1JMVA 4G1BA 4B7AA 3Q40A 4U6SA 1UWSA 2DY1A 2Z27A 4ZU1X 3ER6A 3RNLA 1GGEA 3C4JA 2QUHA 4E5SA 1ECQA 3CR8A 5ED0A 3UYLA 4EHIA 3PG8A 4IIDA 3BK1A 3EG5A 5GWXA 1BCRA 3GDGA 3NWRA 1XTIA 3LNPA 5A1JA 1N36B 4YT2A 4C4RA 1EWTA 4KMOA 4J27A 1PNQA 1DC3A 1IGSA 1XBYA 1AH2A 4ENLA 4A4DA 5IP5A 2FHBA 1K4MA 5FOTA 5BOSB 2H2FA 4K2AA 4GGMX 4Q8TA 1Q6DA 1E20A 1KERA 5I4BA 3LFHA 2W6IA 2PLNA 3VIOA 3GUWA 1V6AA 4AP5A 3BQ6A 4GOLD 1E2MA 1DIBA 3RK0A 2BGMA 1EJVC 1POWA 3L1VA 3RYIB 4RY2A 5G2OA 1RP8A 4OL0A 5LB4A 4J2HA 3RF6A 1SEPA 1YCDA 1FNDA 3VC7A 2G4JA 2J7PA 3TW4A 3CK5A 3TM5A 1A50B 3I6MA 5CAEB 2ZBDA 3ETLA 1U99A 4LBZA 1R8QA 3C3XA 3BGVA 4AO8A 5SY9A 2CNOA 1P4GA 1NHWA 2V7VA 1H42A 4R5EA 1JHMA 1UDBA 1XTPA 1W8DA 3SSZA 4S38A 4PLFA 2Y24A 1AUPA 3QU4A 4OI2A 2G4FA 1WXZA 3JARA 1O95C 3KS9A 3BWDD 3G3MA 3FVQA 4NU6A 2JKAA 1NNI1 3TIFA 4FFPA 4FF5A 1V0LA 3IRVA 3QE2A 4PG8A 3SLGA 5JZSA 1E0UA 4O1MA 3SOPA 2OYMA 4PEVA 1ZU8A 5ECUA 1VRWA 4KN6A 3CPUA 3A6FA 1H62A 1Z69A 5HIIA 1B2LA 3M0HA 1JUBA 1KK0A 3R41A 1K9DA 2J09A 4CM7A 1W59A 3HRHA 5ABHA 4H7FA 4DY6A 1Z73A 1E3IA 2AZXA 1Y81A 4DLUA 2FK7A 4KQJA 4Q9IA 1A8HA 3D8BA 1KRBC 2JJQA 1E4EB 1PIIA 2Q4EA 3UERA 2ZIFA 4BWYA 3AR4A 3ZVHB 3ZQJA 1W88B 3HCBA 4TLCA 4WFQA 1QO7A 3VZCA 4WXYB 4BVKA 2N47A 1L7BA 4MRNA 2WKQA 2GZHA 2BHTA 1BQ3A 4S2BA 1C5KA 4Q3BA 3KCLA 3LHTA 3L8ZA 4JTGA 5F2NA 2CFOA 4GOMD 1QCZA 1G4AE 3KT0A 4ME6A 1FSSA 5F3RA 2Z5LA 3E1SA 4TKUA 3BMQB 4Q5IA 1JFRA 1DQRA 1FLAA 1GLNA 2GOKA 4E1VA 1Z15A 1V02A 2DLNA 1CYDA 5C46F 1GRNA 2R7MA 4WIAA 3S5SA 4RZBA 2G76A 2WSLA 3NJRA 1OZFA 3I83A 3KZNA 1IXPA 2VPPA 1U3CA 2B2CA 3D6FA 1V9LA 3VOTA 3G2OA 1CI1A 4JB3A 4C88A 4AHQA 1P48A 1FYVA 3NTYA 2PQMA 4D2JA 4LBUA 4XD7D 2HWYA 2I3AA 1LTDA 5DK6A 1PZGA 4EVSA 2VYVD 3O95A 4LAOA 1OI2A 1O95D 2D2VA 1UFRA 2D7CA 4L3WA 2WHJA 1ZPDA 2BKUA 3GVCA 3GAKA 5EPEA 3HA7A 4L85A 4A2CA 1YOBA 3CL8A 3IUIA 3N3BC 3VV2A 3Q3HA 5BSGA 4MAVA 1EYEA 1WB4A 1S3TC 4ZRDA 3AY3A 4F5DA 4GISA 4HN9A 4RKEA 2VPZA 2WMOB 4CKYA 4IXMA 4EPRA 4MLZA 2J0SA 2W90A 4EFMA 1CTQA 1JKFA 1HVQA 5FQNA 5IDIA 3IGHX 2VQSA 2JA2A 2XCOA 2EKQA 4N65A 3PTLA 1H7NA 5DTRA 3S8YA 4B75A 1V35A 1UR9A 1II8B 3KW3A 3AI0A 4HWTA 4A36A 5KNDD 2I1LA 1ZUD1 5ICCA 1OLSB 3U80A 3RRBA 1V8EA 2F1IA 4RTJA 4GACA 3JVIA 3CQIA 1SKQA 1IQUA 3BIXA 2E8ZA 4R0MA 4DV4B 5AJWA 4DRYA 3BSHA 5LA6F 3G0DA 4MGGA 4EB6B 3KVNA 4KXLA 1JQAA 1RCOB 1UD8A 3I1FA 1N75A 3CM0A 2ZUWA 5F2KA 1KMHB 1RC1A 4ZAWA 5FHQA 1H4PA 4HB4A 4BS9A 5G1NA 1FWFC 5C1PA 3TJLA 5JBIA 4H7EA 1TPYA 4DV7B 2QTAA 1PFYA 4LVAA 3HHEA 4YL2A 1E40A 3MC5A 4PMDA 1GZDA 3WQ5A 4NCNA 2GARA 2PKQP 4D42A 1MEJA 3ROEA 1KZYC 1TPWA 4FMCB 1DAPA 3OWHA 4Q4DA 5KTMA 1UZLA 5JSZB 4GUJA 3DFQA 1GA4A 4O4VA 2DFKB 2BC9A 1TUBA 4ZYVA 2KPOA 1XIBA 3HO6A 1CV2A 2CK3A 2Y5EA 2OAEA 3GF4A 1DIOB 1FVPA 3OLZA 4CD4A 4XTRA 1BHSA 3OLGA 5IW8A 1UXHA 4DT1A 4GU5A 4JTIA 3CT7A 4QYWA 2OOKA 2XGSA 3UG3A 1OG6A 4URWR 5CC6A 2C4TA 3QYQA 5M5DA 1W36B 2ERYA 4M0XA 2I6QA 2C2XA 4OQMA 1AZ2A 2OCZA 2CNLA 3COYA 3GKFA 1KI6A 2YVAA 2BSQA 4ZYWA 3H2EA 2ZRPA 4TO8A 1KF0A 3R7AA 1BQEA 3AR2A 1IN1A 1DJHA 3PJDA 4Y2RA 1G4SA 3FTPA 3C3BA 4HDRA 4MM1A 1JGTA 1UMYA 2QTMA 3DAQA 1X1SA 4QE3A 3W5VA 4AZWA 2AEJA 2A1UA 1A4RA 4FOUA 4K1LA 2RJHA 5F78A 4XX0B 3N04A 2QW0X 1XX6A 2JATA 1U0TA 4Q6WA 3CPJB 2WKWA 1J01A 4WUTA 1L4KA 4ARIA 1D0VA 4ENPA 3KXLA 2X0FA 4CKEA 2VT7A 4O08A 2WC3A 4Y0NA 2VBFA 1KIMA 3PVZA 1JIXA 3GDLA 3DAYA 2R62A 1J8MF 4W8BA 5A6MA 4HS4A 2DJXA 2FMIA 3MFQA 2P5UA 3PC8A 2VYVA 2N1BA 4L9ZA 4HVXA 1XAIA 1K8XB 1VHWA 3THCA 5CLIA 1ME8A 1NU6A 2QUNA 2RGCA 4EFKA 4R9SA 2XNCA 1PS9A 3HM7A 2IYRA 2ZRZA 4WOQA 3WDLA 2JAWA 4V03A 5FOXA 5I3ZA 1VBUA 3PS9A 8ATCA 4G84A 3VGBA 1NEYA 3ZCQA 1DHKA 1TV7A 3NEVA 2PZKA 3HJFA 1ADFA 1L6GA 3WDHA 3ZJUA 2Q1SA 4BNGA 2D59A 3BD9A 2CZQA 4R1LA 1R2QA 5JD6A 4BTVA 1M3UA 3I5UA 4H1WA 3MKKA 1GG8A 4Y1EA 1QFYA 3KDAA 3VNBA 1E1CA 4IMEA 2GYVA 5F1OA 3RYHB 5HWMA 2C61A 4DADA 2WMIA 1A76A 1R3VA 3VX1A 4Q48A 4Q4OA 4TS9A 4ZQHA 1YC5A 4LY4A 1QG4A 3IURA 2GPYA 3M3HA 3O4GA 3ECSA 4WASA 3B05A 3K13A 2QJOA 2J5RA 4TQ9A 3UR5A 1E5JA 1U5HA 5AW4A 3HXOA 4AG5A 5KOIA 2YJTD 3BDVA 5LMCA 3ND9A 3WTBA 1PV1A 5AJHA 3F5JA 5GZ3A 3U7GA 1HT2E 1USVA 1MVYA 4GSLA 2ZC1A 3VDRA 3FYUB 3LNMA 1F3TA 4FNQA 2YDYA 3DE4X 4RSHA 3HA5A 4RUBA 2MYPA 1RC8A 2BGIA 5HIMA 3RM8A 1S6YA 2PCLA 2II6A 5AZ0A 2XXBA 2OECA 3VO9A 4YT4A 2BHZA 3ZE1B 1I7DA 1US8A 1UJQA 2EAUA 3KBMA 4JFUA 3TRIA 4Y6PA 4LY3A 4JXCA 4K1WA 3SBOA 1A8PA 1C3EA 4HNUA 2Q4BA 1DG3A 1H5NA 1GPMA 3F1LA 4I7VA 1VA5A 3Q3EA 4CLRB 4YMUA 5AUOB 5BORA 4KFUA 4X44A 3SBEA 3ARUA 4CVUA 2PC8A 3QEOA 4YCJA 2E6DA 4FKZA 3WK0A 4Y6LA 3DI1A 4AS1A 1ZOSA 1EFUA 4NILA 2EU8A 2NLOA 3VH3A 4LANA 4FP1A 1WB9A 2LDBA 4XVQA 3GTIA 1E92A 4DFDA 2I2AA 2E5LB 1YLVA 2J59A 5HR5A 4X8OA 2I9UA 2CHGA 4N8DA 4A7PA 3JWIA 1G42A 5JQGA 1MIOB 4HDMA 1CJKC 2I7XA 4TMYA 1KMQA 1LS1A 2HLNA 5EJIA 3R4VA 1Y1QA 1XBXA 2DF8A 3NBZC 5FSDC 4AECA 3DFYA 3STVA 1ZW6A 3ACCA 5HPOA 4LCBA 2Z58A 3F97A 3HEMA 5A1TA 4TMCA 4HMOA 1FX1A 2XWSA 2HNEA 2OLAA 1EYWA 1SKUA 1O0CA 3LUPA 4KOAA 1NQVA 3IUPA 4A3RA 4BFTA 3P0JA 5FPQA 4C6RA 4FGJA 1MEHA 4LPSA 2H16A 4ZDWA 1KFWA 3P52A 3VKKA 3FYYA 5ALZA 4KFCA 2EKLA 3GLUA 3OSUA 1TJPB 2VZ8A 2E5FA 2HUNA 2UVDA 3A14A 1Z5GA 3PYXA 5J4HA 3M4NA 4TL6A 2B37A 1K1DA 4TX6A 1NC1A 1NVTA 4UDOA 1KP3A 3WZ2A 1NE7A 4WJ8A 3QW4B 2WP0A 1S1PA 3W23A 1WDSA 1IU9A 1TV2A 1C9EA 2BJWA 3W1MA 3LOUA 1R64A 5AM3A 5ALNA 3CURA 1I0BA 2W70A 5C81A 1GNLA 1GQNA 5F5XA 2XGIA 4C6MA 1K5PA 4LGMA 4WNYA 1GTVA 3H7AA 1GXSA 2A84A 2BMEA 1OLUA 2RGXA 5LC1A 5DM70 4TX8A 4LOCA 5INTA 3WKCA 3P2JA 4RF3A 5AXBA 4D9EA 2VJPA 2QU7A 3NCOA 3T9FA 2ZJZA 1CE8B 3OM1A 2Q5QA 1RBYA 3NBFA 5TV2A 3UU0A 4TLBA 4OJYA 5DBTA 4DX3A 1AMUA 4KYIB 1C8VA 2JIMA 3IP7A 3LC1O 4HPJB 2HQAA 3DKJA 2PJUA 4GABA 5FOSA 4CNQA 4DHGA 3WK2A 5ALPA 4IIFA 3EIWA 3DOHA 1VE5A 1NOKA 4MR7B 2WHQA 3B51X 2OHGA 2H29A 5T8GA 4OXKA 2CLLA 5BSWA 2QN9A 2IUUA 2QYTA 4DBLC 1UBSA 3LHUA 2P6PA 2AMXA 2R1KA 2E3ZA 1T6BY 5HMLA 2DCMA 1D8AA 5FJOA 3KQPA 3EIEA 2GN1A 5GNXA 4TPKA 5CA1F 4EQ6A 1RYHA 5AVJA 2HBYA 3QRHA 1MGOA 3OZXA 4RLSA 2XNJA 3VD3A 2IYAA 3TRJA 5AKHA 4LYRA 5CA0B 1U0BB 3VNQA 4UBIA 2X1MA 4Z0TA 4ND5A 4RUKA 3KAQA 5BSVA 2RAFA 1FA9A 4DB2A 2I1OA 3H6GA 1QFSA 4U7FA 1L5NA 2QX4A 1KFCA 1N4AA 1Z6YA 2IY9A 1WM1A 3EEOA 1OAKA 4PE8A 3NHMA 2J8ZA 1UXGA 4PGMA 1CUGA 3KQSA 2Z3ZA 1CQXA 3HB5X 2VEKA 3PT5A 4O53A 1GKRA 3T15A 1Q84A 3RE1A 4GWGA 4IH9A 1QI5A 2Q8XA 3BEDA 3JD4A 2R8EA 3MGGA 1LX7A 4DDHA 4FJ2A 3N59A 4RY0A 2WVAA 4E09A 4H0NA 1UC5A 1ADCA 1QAOA 2D7JA 1F20A 3W1AA 2PRKA 1WSDA 4WZBB 3WYFA 1H2EA 1Q19A 3EZ7A 1IZYA 3ITVA 2GTIA 2PTDA 3MQ2A 5JBEA 1G3IA 4TXEA 1K97A 1WQ1R 1LRNA 2EQ5A 2I3DA 2NO7A 3V8NA 1LPAB 2WZIA 3KB1A 1E6QM 1VZWA 2ZM5A 1M8PA 2EZUA 3GUYA 4QOGA 4L73A 2P4QA 1NBOA 3BV7A 3TG8A 1ECEA 3ZFHA 1IBLB 4YLYA 1U4OA 2O0TA 4S0XA 2VUIB 1JG6A 3ED1A 2Y2WA 1JLLB 2A0KA 2FV8A 1G67A 4GVIA 1LL4A 3U9IA 4YJ5A 4PHGA 1Q1NA 3AV0B 4K7JA 3NGXA 3FNGA 2ZX9A 1JPNA 1ULSA 1B0UA 4EUKA 2R7LA 2CHNA 4Z1CA 5HYVA 5JZMA 1ZDMA 4NAVA 3O0TA 2H7YA 1U98A 1FP8A 1PTDA 3KRUA 4LAUA 3FTNA 5HMDA 1TIPA 3H11A 1CF4A 2XSXA 1CXFA 2I65A 3LIIA 4MW9A 3MUEA 1F9EA 3U3MA 1QG0A 3ZDQA 1K3UA 4IEEA 3B82A 5AHRA 5GVSA 2WHEA 1XLUA 2C97A 5LZ7A 3BAKA 5LSAA 3DBNA 1U8EA 1UKTA 4S1FA 4CNSA 1GYRA 2QCNA 4LGYA 4LYJA 2N0SA 4CDNA 3L12A 1KQOA 4K9RA 4MVJE 2E68A 4F6RB 1JEQA 2MT9A 2RARA 2YLLA 1ZM9A 3ZHQA 3ALGA 3R8GA 4OECA 4EYKA 2Q8ZA 3NONA 3KS5A 3I09A 4FDUA 2QAGA 3HADA 2VNSA 2GJXB 1QMPA 3H5IA 2BEKA 3QKUA 1PWYE 4KQHA 3W7EA 2ZXUA 3L5LA 2I14A 3VYWA 4CU6A 2EWWA 3P84A 1J22A 1T24A 4EKNB 2WWCA 5AIAA 1ZIOA 5BW6A 2B34A 1U5BB 3HR4A 1NTRA 1GU1A 5CPQA 1HQTA 2D4HA 2Q21A 3GJYA 1K6WA 3QKIA 1WIWA 3Q12A 2WAMA 2EFHB 4FZIA 1C0IA 2HUPA 1IDOA 1XCFA 3ANMA 1XZIA 1RLDA 4GYPC 1OEPA 2Z1SA 3ICOA 3RHFA 2B4YA 4K8HA 2WTUA 3CZJA 1TD9A 2CYCA 3BWWA 1OA1A 1KBKA 3QTGA 3HKEA 3FCOA 3GG9A 1SXJA 3F7TA 4CEIB 4BNHA 4MUJA 2PQ0A 3HSKA 5FF0A 4UM7A 2EPMX 2OWWA 1W6UA 1W5QA 3PZ9A 1ZHFA 4AMGA 2HB6A 2R2GA 4NK5A 4FALA 3SN1A 4M1YA 2XHYA 3SEAA 1GWNA 3TYEA 3ZX5A 3GUZA 2G82A 4DMKA 4KOEC 1K70A 2VHCA 4QGGA 5CT8A 4BO9A 2VRJA 2Q5LA 5FTNA 1YNYA 5K0TA 2NZVG 3B1XA 5JSKA 1T2DA 2OAQ1 2P41A 1TOAA 2HK9A 1L6IA 1EWQA 2ZZ3A 1JJVA 4NVTA 4G86A 3DHFA 1CXHA 1LLCA 3CH5A 3EDCA 2YWGA 1UPAA 3ZBTA 3L7IA 1QRQA 5A4MS 3W2GA 3TIIA 3LQFA 2X2OA 3UJCA 2O19A 3ITYA 4OXXA 4PRRA 5T4BA 1NQXA 3EZLA 1O97D 4F06A 1GEEA 9XIAA 1WKFA 1YL6A 4W5NA 3VU0A 1A9OA 2OBYA 4YPFA 5LIUX 5AHMA 3OQNA 3L5AA 5JYEA 3N3MA 1FQJA 2V7UA 2ODAA 4CQCA 2UUBB 1OSEA 2VURA 1P6XA 2DJLA 1LOSA 1FTWA 1IRXA 1CZRA 3T95A 5IM5A 3WYCA 2OTCA 2QE6A 3IVMA 3K2GA 5HEKA 4P3NA 1CVLA 2O8CB 2ASHA 4ENTA 1T8XA 3GBEA 3L0KA 4IQJA 5DM1A 2D1YA 3LY5A 1KPIA 4Y2PA 3I34X 3KVVA 5EINA 4RD6A 3KJQA 1NVUQ 4N3CA 1ADDA 2JGAA 3WX0A 4E5DA 5DSXA 4K6GA 2DP3A 2O50A 4MVJF 3AR9A 3T08A 4Y6SA 3SZUA 1NMEA 2I4LA 3KJXA 1UK6A 2CLDX 1IEWA 2W6OA 5J40A 4O5AA 4HMPA 3LCVB 3A4IA 4N3GA 5AC6A 3PNMA 1EUNA 1ZD5A 1G21E 4B5KA 3WKAA 3VDCA 2QYOA 2B98A 2BVNA 4KBYA 3GUVA 3E2PA 1BX1A 5AW3A 1NDZA 4ESOA 5K2MA 4N02A 2PWHA 2BKAA 2YXGA 5DBFA 4WKOA 2YL2A 4DREA 2V3DA 3GW8A 1V3KA 1EIBA 3CT6A 3AH8A 2IY7A 1UPPA 1BU5A 4YXWA 1AJ0A 2IPGA 2WG0A 1NVVR 4EDHA 4WDWA 4Y1GA 4E21A 3TZNA 1GZVA 5CIYA 4CUZA 4AP9A 2R8XA 4KWVA 3O07A 3GTNA 2YJ5A 5EIEA 3ND5A 5K51A 4O33A 2CXOA 3KXDA 3HG4A 2GLTA 3E82A 4P5PA 1ZGAA 1D6SA 3RM4A 3LU2A 1N2JA 2EJTA 5F1PA 2YHAA 4B4OA 2P76A 3D3KA 3SAZA 1NASA 4XAFA 1W35A 3FVTA 1UEJA 1HDCA 1R0BA 5C4MA 4MV6A 4OYHA 1XCJA 3VTFA 4X63A 3H12A 4BEJA 3S1AB 2R5WA 4HU3A 2PD9A 3BMXA 1JHPA 3B3JA 1A5BA 4IL0A 2PCQA 4IQ8A 4DUPA 4EY6A 2H1RA 3T7RA 2Y9PB 2XE6A 1C3XA 4WKAA 3W7KA 4ABYA 1QNOA 3CNYA 3GJXC 5E38A 4Q3DA 1P1XA 3FPCA 3T0BA 1HFWA 2ARKA 1MFUA 4Z0NA 4PWZA 3ICWA 3DI0A 4GMEA 4MGHA 2EYUA 2VR4A 2IEBA 3CJPA 1QAQA 2ZT8A 1RVGA 4JNMA 1HDOA 1RR6A 5SZKB 3D9QX 3EZYA 3G02A 3CINA 2AN1A 4ARCA 5F5LA 2YX1A 3ZHZA 3UGKA 2ZJ7A 4M7OA 4R31A 3NM1A 4X93A 4DJED 4EG8A 3TD9A 3CRRA 1A8SA 1GKKA 1GHTA 3QYJA 3RS4A 5BNTA 2MCFA 4CNBA 5LPNA 5CVEA 2V97A 4J6EA 1MFPA 4TMXA 3U5TA 1RHCA 3HM9A 2GN8A 4V24A 2VK2A 3PANA 5AVRA 4I7WA 2Q09A 1T0PA 3I52A 3M0IA 2IIQA 1SMDA 3PFNA 3HUTA 1OM0A 1LPOA 3NDZA 2BM1A 4EA7A 3DEKA 2YYSA 5I5GA 3UAXA 2GFTA 3Q7EA 3BOLA 3WDQA 1ZBKA 5BSTA 3W9ZA 4C87A 1TPZA 2ZR7A 2YQ5A 3QMVA 3ABXA 4QQKA 1E77A 3E0QA 3S9IA 2ZTSA 1SA0B 4V02A 3IO5A 1G7RA 4YAFA 3PB3A 5I3DA 3M5YA 1AJZA 1S2GA 4R81A 1SUPA 1YJBA 1PL8A 4WKFA 2O6LA 3TN4A 2OB3A 4ZO6A 3DBOB 2B7BA 4B9AA 6CHYA 4TLDA 4MNKA 3HG7A 3OEED 2VNKA 4WZZA 2GERA 3AHFA 4UM9B 5TS2A 4E30A 2VUYA 3QPDA 3AF1A 4B3LA 1R0CA 3FBTA 1RJ9A 4R9OA 4DT1B 4DZAA 3HUDA 1DHRA 2YJNA 2BFPA 1YR9A 3TDFA 3A06A 5LIPA 2W42A 4XX6A 4UUAA 1MVOA 4QYMA 3NS7A 4IIHA 2REQA 1B2YA 5E9WA 3PKIA 4LA4A 3L0NA 1THFD 2KZHA 1IM8A 3KG2A 3ZWNA 4RE4A 5KNBH 3WHKA 3LS9A 4ZT2A 4Y96A 5K01A 1P1KA 4EYQA 2DY3A 1SULA 3B9QA 3G18A 1RVKA 3K6KA 1ZJHA 1Q6ZA 4JA2A 4AZ3B 4O12A 2FMHA 3BMWA 3RQIA 3NT2A 1LPSA 2VRWA 4R3WA 3I9V1 4Q4QA 4HRAA 2ON3A 2Z5GA 1OIWA 3L8CA 2F2KA 5HJ5A 3FSGD 2F2TA 3ISVA 2XMZA 1KDZA 4HH0A 1G4TA 2DZTA 3O73A 4M76B 1CR0A 5F3WB 3DAGA 5LNK6 1V5WA 3NI2A 1ESEA 3BTVA 4WQMA 1GZ4A 4HRXA 4HP5A 4S1OA 2F2HA 3EEFA 3SW6A 4AWUA 1TZBA 1XRSB 4L80A 3TLZA 2OX1A 2GKSA 3PJEA 4H0FA 3GPIA 3MS4A 1TZMA 1ZU4A 4KXMA 1MC1A 2ZA3A 3VYSB 5LBUA 5AECA 1NFRA 1GOTA 3D7MA 3E7DA 5BWMA 1QMLA 4MK4A 1A8IA 4N8SA 5ADUS 1ZMRA 4UZFA 2XF8A 3AF2A 4C2TA 2VEFA 4IH3A 4BZWA 5K4ZA 3TW9A 1KKRA 3RF7A 2YZ7A 2VJCA 1DOSA 3WUFA 2DUWA 4FJ0A 3OYZA 1FDWA 1HGWA 2C4WA 1RQEA 4F48A 5C3MA 1LCOA 2H3DA 3DV9A 3K71B 3A9CA 3T0CA 4C60A 3M81A 1E7YA 5HUHA 2GGGA 4PMNA 3RUFA 2XQFA 3ZUPA 5HINA 1DI0A 3H5WA 4PRTA 3O3CA 1CXKA 2E4VA 2OVBA 4HNAB 1T2VA 4IX0A 1CLUA 1BTOA 3L0GA 4GOAA 4ZZ0A 4KIRA 1ZRSA 4J0QA 5JS8A 2P65A 2D74A 3OZAA 1Q6GA 2QG6A 4XARA 4CKBA 2BWJA 2XAUA 2XDFA 1A3CA 4M36A 2GNOA 4B09A 4X9XA 3V55A 1KXQA 3BC1A 4XBJA 1CY1A 2G9NA 4JCCA 1JCMP 3HPZA 1YFKA 2HPVA 3ITDA 1FU4A 1F76A 3GQBB 3KUKA 1J1UA 1B41A 1XSEA 4DWWA 4L1KA 4QVKA 1OYBA 4ADUA 3KO8A 1ODKA 2GCPA 4AMYA 1CY8A 4ZI5A 3BF8A 2ZXAA 1GNTA 1M2WA 1PLLA 3LCMA 4U3AA 4NS1A 3EVTA 4BMXA 1HYGA 2VHUA 1E89A 1EPUA 5CPTA 2BMBA 3LLSA 1B4DA 2HIHA 5I2UA 3GRYA 1VEMA 2V55B 1W30A 2QXTA 5DEIA 3FHCB 1YB6A 4PNHA 3PXBA 1RFGE 2Z95A 5DM0A 1VJIA 2J3HA 4RF2A 2IQ0A 3CB2A 2ZBRA 3ELFA 4DDWA 1KSFX 5HQ3B 3QE0A 1PJ3A 4PRZA 4CQDA 3FMOB 1GEHA 4WXRA 4W85A 4CRWB 3GVQA 1PD0A 4MYUA 3OA0A 4KVAA 4ZJYA 4ZHQF 2IYYA 2Z1NA 3RLIA 3T06B 1VHQA 1R0XA 4EFNA 4Q9DA 1XHGA 3WK5A 3MAGA 5KETA 1Z06A 4MPDA 1Z4KA 3KXPA 3ME3A 1QPZA 2GQ9A 3NM4A 1WCV1 1Y6FA 1QOPA 1ZMTA 1RFLA 4CLRA 4PC3A 4AAYA 1AGNA 4A0FA 1XGZA 3I5XA 3CUFA 5HDQA 4KWOA 4Y2QA 2NVUA 5HIJA 4M0CA 3VNZA 1E7SA 4KE8A 3O8NA 4FMPA 4B3TB 3T1YB 2C77A 1B74A 4YTEA 4M53A 4LXHA 2QUJA 3MJMA 3FHLA 1UUQA 3H6KA 3IDSA 3S83A 3VC2A 1NBWB 1NWHA 3FLUA 4ZAVA 5DCLA 3LGDA 1T9KA 4DYHA 1TM1E 4BBAA 3GS6A 4DO5A 3QELA 3HY4A 1ZXLA 2ZSBA 2H7CA 2HEGA 1EQUA 4YP5A 2I7TA 4AG6A 5BV1A 3GJ0A 1MBZA 4PX3A 3VR5H 3PG9A 3M9XA 4EGAA 4LV5B 1HQCA 2BEUA 4DPQA 3C41J 5ITWA 2EERA 3W5IA 1YNQA 1XK7A 5DRTA 1E9YB 1ZQ5A 3PCXA 4KQFA 2CL5A 4HHHA 3ZK7A 2QN8A 3PNVA 3WUEA 3NYQA 1XCXA 4R41A 4KGJA 4OQZA 4G4IA 4Q9KA 3GRCA 1N2CA 3E9NA 5ULLA 3IXLA 1ZIYA 2WVGA 1QW8A 4EPEC 3IMFA 3ICQB 5PTDA 1UDCA 2FH6A 4I9JA 4MQFA 4URZR 1HRKA 4LSBA 5DBIA 3ZJTA 4W7UA 3FWKA 1J12A 4JA0A 4AISA 1EINA 3J7TA 1R8LA 1J0DA 4B9EA 3EULA 3MJ4A 3DR3A 3SYRA 2VJAA 3JQQA 3CH4B 5FXMA 3R5TA 4M8NE 1IZKA 1J9ZA 1VPXA 3FCPA 1UPCA 1U0GA 2BFEA 4V0LA 1V6XA 3PNPA 4G8BA 2GVZC 4C7OB 1K8XA 2HR1A 1J06A 2GVGA 1YDVA 3W25A 3B1YA 2RB4A 3M0JA 1N5OX 2AJCA 3A4XA 1QNVA 4PYOA 5AI6A 2WMNB 2VTKA 2HW8A 2FW7A 3ALFA 2VDRB 3O8QB 4H7KA 4BWLC 2AR9A 2H8XA 2ZE3A 2VNHA 4OAQA 4PIPA 2HSJA 1SCNE 3ASVA 1BO6A 4RL6A 4C7JA 3E5BA 2YNMD 3FGZA 2GH1A 4EUSA 2X22A 4B0PA 3R75A 3SYTA 3EWYA 3WK1A 1P2UA 1QH1B 1LY1A 1SR8A 4QUHA 3NBAA 3JU3A 4Q33A 3PDWA 1DHTA 4ZQOA 4FIRA 4GMDA 4EAAA 3VU2A 1P45A 4DJDD 1NJ5A 1RP7A 5D8WA 1EUQA 1W44A 2YR1A 3I7QA 2XADA 5HF8A 4RVGA 4CEXC 4ATWA 3BX1A 4ZTXA 2DWPA 2Z30A 3G68A 1E6RA 3IGUA 1KYYA 4FR1A 2E82A 2C5LA 1IJEA 4S3CA 2N3ZA 2BXVA 4FXRA 1XI2A 3DDMA 3TZHA 3TM4A 3HNOA 4KR9A 2FMOA 3AJXA 2HCBA 2OZ3A 2A0UA 4DRSA 2IUFA 1UZNA 3QFCA 4TYMA 3O2QB 3CEHA 3DZDA 4KAAA 5AI5A 5EY5B 4JOMA 3UJRA 2TS1A 4XAGA 3V5FA 1Z0AA 1CR6A 3PLAE 1Y42X 4OK3A 3GBDA 4WEOA 3FYSA 1KOLA 1XPRA 3HYSA 2FW8A 1R3QA 5ES4B 1JG1A 4GPTA 2XVLA 2PSNA 7XIMA 2C98A 3O4JA 4P53A 2PDCA 2N1MA 3ARTA 1WQ3A 1WKCA 3OM8A 2OUIA 1N33B 4ND1A 5L6MB 1VG8A 1CGVA 3OHSX 4NOJA 4NENB 3G82C 4WHMA 4GRSA 1FC0A 2V68A 2IYFA 4KMQA 2GJ9A 2ZIAA 2QF8A 4FOKA 3EC2A 3GDMA 3H5AA 1YGYA 4GE3A 2YRFA 1K7FA 3DBHA 3KL5A 1GNSA 4YUVA 4K6CA 2ADFA 2RKXA 3VR5D 4C4TA 5I7AA 3GQYA 3GA7A 2SBTA 3BHJA 2YXNA 2BH9A 3SECA 3F5SA 3V4SA 1L7XA 4ZFNA 4Y9MA 4MH0R 4RQUA 1NSJA 2A21A 3W1QA 4Q4JB 4EG3A 5B3LA 3PUXA 1U2GA 4W89A 4MWBA 1V1MA 5AOCA 4FYJA 2GSHA 1E9AA 4DJDC 1II9A 3SHVA 3A6EA 5HVNA 4QDZA 3UCQA 5EA9A 1R0KA 4X2PA 3BW2A 3G9QA 1QRRA 2QNIA 4MQUA 2FEAA 2F17A 3QZUA 1CVIA 4E8DA 5A2CA 4PFJA 3DP9A 4GW3A 5JJCA 4LS1A 2Q6IA 3EYWA 1GM5A 5A8NA 1XKLA 4BK9A 1M6NA 2VGIA 2QEQA 3MT8A 1R7OA 3Q85A 4IWYA 1RMYA 1GU7A 3LUDA 4BQQA 2CXSA 3P0IA 4GI7A 4IJRA 3GP3A 1XZFA 2X7HA 4G97A 3TVDA 1FUIA 1TUFA 2C7QA 1Y6ZA 3DEFA 1MO5A 4YRLA 3LC0A 2IZ5A 1HZJA 3VGHA 1J4AA 1OGBA 3U7VA 2ZDSA 1PT7A 1T6NA 3RC2A 2VX6A 1PDVA 2W6NA 1NLZA 2OYSA 3IJIA 4EDFA 1WX1A 1ORWA 3WH8A 2O55A 1T2EA 3D6VA 3ZYCA 3CV2A 2A7NA 3OFSA 3AICA 1YYAA 1VLLA 3LP8A 5CLFA 2QULA 3QOKA 2H5LA 2ZB7A 5EUQB 3UK7A 3M89A 2ZSEA 1PAMA 4YHEA 4ERNA 2G8ZA 5C31A 3ZSTA 2XB2A 1R3TA 5FCZA 3TE6A 4Q4KA 4TQGA 3PR2A 1V9SA 1MCZA 4ETWA 4MZYA 3HLTA 4DSUA 3VSDA 3N2KA 3NHLA 4HQRA 2XGBA 4JJ6A 5AUPB 3QV7A 5THKA 3V75A 2ZR8A 3PTDA 4I1SA 3ARSA 3GD7A 3L6RA 3MUXA 1R16A 2O3QA 1P5RA 1KORA 3MBFA 3MJYA 4AY7A 1N2IA 5FI5A 2NNWB 3UXMA 2QDHA 3AR6A 1WB6A 3R9XA 3MW7A 4OREX 2VNCA 3L0YA 7PTDA 5D1HA 5I07A 4F40A 1OXXK 4B32A 2KW5A 4W9MC 4C90A 1NI4A 4RJLA 5EWLA 1RHQA 5JJIA 2GQ3A 4MKVA 4C0JA 2PLAA 2PCJA 4M99A 5A0TA 4RZSA 3EA2A 1USIA 3THDA 5LUAA 3L8MA 5BNIA 4B2DD 3VH2A 1ELSA 5LNUA 3QUAA 5CW1A 4RVFA 1IBSA 1J18A 4E15A 2IEZA 3P2KA 4N7MA 2I62A 3TJRA 1Q1QA 3UR7A 3RC7A 4MWAE 2W2KA 3ZWYA 3CZQA 3SLRA 4G9BA 4U6QA 5J04A 1U2PA 1C7QA 1SBCA 3S0CA 5H81A 2H57A 2WSKA 3ENQA 4WVFA 3PXGA 4W8HA 1G8MA 4OUKX 1WZMA 2PNFA 3LNCA 1LG2A 2C1EA 3LUBA 2XUHA 3BS4A 3CMCO 4UU7A 3T7CA 1TTQA 3UBPC 3QBEA 4LF4B 3OOEA 3QKTA 4D4LA 2CLEA 3Q2IA 1OASA 2Z5FA 1UQZA 3Q98A 1NUAA 3DTNA 3ARWA 4WSOA 2QAJA 3HPFA 3V2HA 5E9JA 4CN1A 1ZMBA 4JAVC 4E6EA 2PTWA 1VF8A 2XUQA 4WLUA 3GVGA 3IIXA 1MKYA 1U02A 3W28A 3WHPA 4QG3A 1J21A 4FMDF 1HGXA 1HDXA 3MYPA 1JXMA 4WL0A 2JF6A 2VH1A 1U7UA 1VIWA 4R1NA 4J7CA 3H1PA 4BTEA 3BJFA 3Q6MA 5IDQA 3ETJA 3TUIC 1SBYA 3D6NB 4M1BA 2OFJA 3HCRA 1XDSA 4TV8F 3V8VA 3UWYA 1VIZA 2WTBA 3SF8A 1G291 1PZNA 4GBJA 3UY7A 1H4SA 2FJPA 1HKKA 2B4QA 1S7GA 4BX8A 3RIMA 1WHSB 4XZLX 1ZH4A 2XM1A 3ILYA 1B2RA 4PG5A 2RI6A 2C7VA 5JCOA 3WK7A 4IP4A 1YONA 4IEIA 1CF2O 1NQ6A 2KSQA 1FBAA 2JK1A 5BV7A 4I5RA 1K03A 1BWRA 2MSCB 4IAOA 3KVRA 2JAXA 3ROPA 1K3UB 4ZPXA 2KBEA 1TO2E 1ZK0A 5IN5A 2IOFK 3AUKA 1B3OA 3WMEA 2DR3A 2XJ4A 4CV1A 2C79A 1ULHA 4NAEA 3IARA 4Q05A 4DDVA 4ZBCA 1KM5A 4OFCA 3HZZA 1A69A 3JQFA 2XLBA 2UYQA 2UV8G 1HKJA 2IL1A 2PMWB 2FUG6 3DDOA 5DGDA 3KPVA 4XZ9A 2HNBA 3KZXA 1LJLA 3DERA 1M8KA 5BSRA 3S2MA 1BE8A 1XLAA 5TQLA 4TS3A 5EBAA 3W5UA 1KM3A 1NIJA 3C24A 4F97A 1T10A 4DEFA 4XB1A 3OJ0A 5AYVA 2HWUA 3LRXA 1VMAA 3A1NA 1Z13A 1FS4A 1XV5A 2G8LA 4JUBA 2QCMA 3W7GA 5AW2A 1ITXA 4BO6A 1J8VA 2BN4A 4L4RA 2EGGA 5M1TA 1P3JA 4OBXA 5HGXA 1E4NA 1NJ6A 2HHJA 3QC3A 3BWBA 2QUBA 1H2ZA 4RE0A 1GCGA 3VPSA 3D0RA 4FZ3A 2H2HA 3U2QA 3B5IA 2NTNA 1U1JA 1N3YA 2B92A 5M04A 1TWZA 1O4UA 3TBFA 3D6UA 4C6OA 3PSHA 1HE5A 1JIIA 4HLUA 2F7FA 3LHDA 5EZYB 1MWOA 4NAFB 4ZAYA 5KJ1A 4Q8VA 3WNKA 1UBJS 3RHZA 4ZVSA 1UPTA 4D1YA 2ROQA 4L78A 3NB0A 1SQ0A 3N2ZB 2GAAA 4N4PA 2G77B 4W5QA 3DBIA 4JUAA 1QE5A 2ZFAA 1VBRA 4FJ1A 4KKVA 3UKOA 2GJ8A 2V7QA 3O03A 2C94A 4JJ7A 4LF7B 1SKAA 4AMAA 3HG3A 4DELA 3UCXA 3HCEA 3OQEA 1O3YA 2X2EA 4WKGA 1FKXA 3P0HA 3NHBA 3UKJA 3JY6A 3M6WA 2X8WA 1KZHA 1HDGO 2WIKA 2PUBA 4D92A 4M6QA 1IG3A 2ATEA 3R7BA 4OXNA 4CLHA 3NTXA 4FUTA 4POOA 1KZ1A 4IZHA 4DCVA 3LBHA 5GM2A 3CRMA 3ZWPA 3NT5A 4HDSA 3O2LA 3QVJA 2D54A 3M6FA 5JI3E 3ZUGA 4PYKA 1VI6A 2JCXA 4NI3A 4D0LB 2VWGA 5LYJA 1I6NA 1HE3A 1A9ZA 3IB6A 1AJEA 3O75A 1EI9A 2VWPA 2HPAA 3LWDA 2Y1LA 4MNLA 5AIBA 2EBFX 1C3LA 2BASA 1NXPA 3R5SA 3B3AA 2QCFA 3W8EA 4UD6A 3C0LA 1JD9A 4YWHA 2RGYA 2I3ZA 1HSOA 2PX6A 1SXJB 1XIIA 2VDGA 8XIAA 1U0EA 1PO9A 3TR5A 1DO0A 3DGEC 3RTDA 5FP0A 3NDJA 4QDXA 3VNSA 2ACVA 1HTWA 3KOOA 1KAQA 5HF9A 1K08A 4G8DA 3A32A 1S2VA 1USWA 3KL4A 4RPPA 1JKJB 2XMRA 1OX4B 3I32A 1JZSA 2VNIA 3V4OA 1UZ1A 4ZFCA 3H18A 3N8KA 2RGMA 1EEHA 1YI8A 2O3TA 3B8EA 4PCLA 1TRIA 2Q1UA 3O3MB 2JJ1D 1A4IA 2QIOA 1X80A 2VDKB 1AD2A 3VPBA 4GDFA 4PHCA 4QU0A 3S2NA 2NXWA 4BP8A 2G95A 2RJGA 4J8PA 3LO8A 2G36A 2JCGA 4YIWA 2H6RA 2MR5A 2WNQA 1WTCA 2ZI4A 5JHHB 2LNDA 4UMFA 1A0OA 2JW5A 4OKSA 1NBIA 5ENVA 4ZQGA 1B42A 1BWQA 1GIAA 4KBGA 4GINA 1IMOA 1DFHA 3USES 4MS1A 4ADSG 1U63A 1YDOA 4LY9A 2GJNA 4G0UA 1VLZA 1QHZA 2NZJA 1S2UA 3OCCA 3A1EA 2IHKA 3OG9A 2VH5R 1K6AA 4YVFA 1FWGC 4MNJA 3FETA 4JJEA 3H16A 1Q6RA 2GN0A 3IKJA 3DC0A 5KJEA 2HAEA 2CLMA 4MVJD 1JHAA 1UA7A 5AKEA 4EW2A 5JISA 4XWTA 5IJWA 1F8IA 4EY3A 4ZO4A 2PWGA 5JARA 2R4QA 3X44A 4EUEA 1DC7A 1M7HA 5A4KA 2E48A 2I6SA 3NGJA 4E5YA 1U1GA 2XVPA 4RK7A 2GZAA 4QFUA 4BB9A 3ZVRA 1C1YA 2HKIA 1VDZA 1B0ZA 5D2YA 2WG1A 3ANUA 4LVBA 3BXFA 5CHYA 4H9ZA 1HETA 4KDFA 1AGXA 1DWHM 2DUZA 1HH4A 3T09A 3UOGA 1GTSA 3KQKA 3C8MA 2KWIA 3PVSA 4IX1A 1IFXA 3QR1A 1FJGB 1PDWA 1Y7TA 3DKKA 3WWPA 2JRCA 1VFHA 2OBBA 2JLCA 1OGYA 5CFNA 3C6XA 1EFHA 1QK4A 3PJGA 4QFCA 2GAOA 2WSMA 5FWYA 3KLOA 4J16A 3K31A 3W6MA 1H7WA 1FDYA 1G7CA 4WJXA 2J8FA 1QYWA 3OLY