5EMLA

Crystal structure of prmt5:mep50 with compound 10 and sam
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
625
structure length
625
Chain Sequence
b'RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein arginine N-methyltransferase 5
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
total genus 203
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5emlA03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5emlA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5emlA02
4E2XA 1FP2A 1S5NA 3KQOA 4BLUA 4YTUA 3FVMA 3BANA 3CBGA 1VIDA 3M6WA 2OXTA 3GRZA 2CWWA 3LSTA 1NBHA 5U4XA 3FPGA 3OCJA 3MAGA 5EQJB 5K0BA 1JG3A 3A4TA 4LWPA 4EKIA 3L8DA 5ICCA 2JHCA 3GU3A 4GOLD 4E2WA 3M6XA 3B89A 2B25A 3ITYA 6XIMA 3HCDA 4QDJA 3JWIA 1AF7A 3A7EA 3R6TA 1DUSA 2UYQA 2XVMA 4QDWA 1SG9A 1O9GA 4MTLA 4WVLA 4Z2YA 5C0OE 3AAMA 3CQHA 3PVCA 4ER5A 1DCTA 4IKPA 4YTSA 3KBSA 5C1IA 5KVAA 5FUBA 3BGDA 2O07A 3BZGA 3OZRA 1QT1A 1I6NA 2ZW9A 1XYCA 5DRYA 3JU2A 2NQ9A 3GJYA 3P71T 5EHIA 3QOXA 3UJ8A 4YUZA 3RODA 5LQRA 2HWKA 1YFJA 5EG5A 1TZ9A 2R6ZA 3XIMA 4GBED 4AZSA 1Z3CA 4DCGA 3P9CA 5CCXA 2NXCA 2AVDA 3FRIA 5EMJA 3G7UA 1BKYA 2ZZKA 5GWXA 5P8WA 3TM5A 4B17A 1XDSA 5IKMA 5K0JA 4OX9Y 3KWSA 3C3YA 2ONZA 3LGAA 3OFJA 1YF3A 3I64A 2NQHA 3VNLA 3NWBA 1XLBA 3FPJA 3DMHA 4HGXA 2P8JA 2ZFUA 1SQFA 3ELUA 3OBEA 5B80A 1IM8A 5DTRA 1AQJA 4OVXA 4YV1A 2VDWA 3IYLW 1VPTA 3HCBA 2LD4A 1XYAA 4PIMA 5T6BA 3TFWA 2IH2A 5DWQA 1MHTA 3CQKA 2AZTA 2DPMA 2ZVJA 4XUCA 3UJAA 3G5TA 3UJ7A 3O31A 4O29A 4YUYA 2YTZA 5EPEA 5GM1A 2A14A 2XISA 4XKMA 1JG2A 5HOQA 1JR4A 3OU2A 3G2PA 3D2LA 4X63A 4GJIA 3DX5A 1EQAA 4F84A 5KQSA 2UYCA 2BR4A 4BLVA 5LR6A 2BM9A 1M6YA 3PLAE 2P3OA 2Q02A 3HEMA 3LPMA 4HHLA 3VNJA 1VP9A 3ELWA 3GRUA 4R6XA 4CKEA 4HC4A 3HA7A 1XTPA 4FZVA 5K09A 3ER8A 1R6AA 2ZIEA 2HR1A 1VLMA 3EMDA 4HGZA 2BR5A 2OB2A 5FADA 1TW3A 1XIBA 1NW8A 1T43A 4Y2HA 2NXJA 1EIZA 3EPPA 3UFBA 1D8WA 5B7YA 1XLCA 3IV6A 1H1DA 4FSDA 4YV0A 3DR5A 3LKDA 5DSTA 3C0SA 1B42A 5DX1A 8XIMA 3KQWA 3SVZA 1NW5A 4PCAA 1RJEA 5XINA 4MQ4A 1UWVA 5FHQA 5F2KA 1ORHA 3C6MA 4R6WA 2QE6A 3M0YA 1AQIA 1MNZA 4E32A 4C03A 5LQCA 3LDUA 3CJQA 5CUQA 5EC8A 3T7SA 2P1DA 3E23A 4XSMA 4HTFA 3CQIA 3GO4A 1XLIA 1SVUA 1KYZA 3LKZA 4KWCA 5K0FA 3EEOA 2OKCA 4FT4A 2UYHA 4MHTA 4HG2A 4R05A 3VSEA 1SUSA 7MHTA 3FTCA 4PGGA 3C3PA 3DXZA 5K8VA 5AVHA 1XIGA 1NV9A 4H0NA 4HGYA 4QE5A 3DXXA 5K01A 3KCJA 5HIMA 4DMGA 4ZB0A 2GS9A 2QYOA 3K6RA 2UZ4A 2P41A 3KTCA 5EEGA 3KQPA 5E8JA 3L23A 2QM3A 3G88A 1RI4A 1XIFA 4L7VA 3UJ6A 2N47A 4PYKA 4PYMA 3UA3A 4HHMA 4EVIA 4QEEA 3R24A 4E31A 4XCXA 1TW2A 3GGDA 2NQJA 3VNKA 2ZVRA 2G70A 2G0WA 4PYIA 2V74B 4RTPA 2AOWA 1X1DA 1XDZA 5K0GA 3P6LA 1I60A 2PV0A 3P14A 5J8LA 3NJRA 2WA1A 4GEKA 1XLAA 1O1HA 5DX8A 3N4AA 2O05A 2PT9A 3G2QA 4PYJA 4V0RA 3ER9A 4ATNA 3TPZA 3EVAA 3G8BA 3NTVA 4RTLA 3KCLA 1L9KA 2QW5A 4PFHA 1M6EX 4XIMA 1RJGA 3DLCA 3EVZA 3GRRA 3TM4A 2YXLA 5EZSA 5DLYA 3QOWA 5LQKA 2YXEA 2OY0A 3EVCA 2GB4A 1QUMA 5CVJA 3VYLA 5DM0A 2HTEA 3UJCA 2Z6UA 2CMHA 3EVDA 1JTEA 3FYDA 3OZTA 4RTOA 5EKUA 1YUBA 4QVGA 2HK0A 1XLMA 3KBVA 4DF3A 1BXCA 3NDIA 3M0HA 4RTNA 2XBMA 1Q0TA 4U7PB 2XVAA 3DMFA 1DIDA 2P3LA 3T7RA 3UZUA 3PT9A 4M38A 4ZB5A 3MCZA 2AOUA 2IGTA 4FGZA 5EEHA 2YXDA 3HCEA 5B1SA 3C0LA 2FK7A 5CVUA 3VYWA 9MHTA 3PTAA 4P7GA 2CKDA 1WS6A 2H00A 2ZBPA 4RTKA 1KPIA 4HH4A 3SR4A 5GIPE 3QXBA 4GC5A 4QE1A 4PYOA 5JUWA 3GCZA 2JHAA 4OQEA 3WSTA 3FPEA 2ZIFA 4Q7IA 4RYLA 5AVNA 3VNMA 1L1EA 4C05A 3ITVA 4QDPA 2PGXA 2QRVA 3PFHA 2ORED 5CM2Z 2OYRA 3MHTA 4PGHA 1KR5A 3CVOA 2C7PA 5BW5A 3NMUF 4E2YA 2ZZMA 1XLLA 3CKKA 4BP1A 1G38A 5CVDA 2ADMA 2GA9A 4C06A 3BUSA 2H11A 2FCAA 3FYCA 3KPYA 3M70A 3OFKA 1V39A 5H6HA 3FUVA 2HCVA 2GVEA 1Q0SA 1R8XA 1XJ5A 3JWJA 3P2KA 1G6Q1 1R18A 3LCCA 3OU7A 3Q7EA 3HVKA 1G8SA 3AYTA 1EAMA 2YQZA 3HVJA 4M7RA 4QTUB 3EVEA 3KQSA 3OPNA 2AOUB 3I53A 5K0EA 5E9JA 5HEKA 1RI2A 3LECA 4HTFB 3BGIA 3P9KA 3KQQA 5LQNA 4A6EA 5H1WA 4QTTB 4P7FA 5GM2A 1XCJA 2Y1XA 1QTWA 4AX8A 7XIMA 2HMYB 4P7KA 5IH3A 3IUHA 4QVKA 4JXJA 4A6DA 3FPHA 3HM2A 5E1BA 4EKGA 4HRAA 4UOEA 5DXJA 1XLGA 3A27A 5KS2A 4DKJA 3FTFA 3AYVA 4EMSA 4K3ZA 5DM2A 5LQUA 1JSXA 1DL5A 2NP7A 4DM3A 1XLDA 3MQ2A 5FCDA 4YTRA 1M0EA 2UYOA 5E1OA 2B9EA 2VDUE 5EKXA 3EMBA 4QDKA 4PINA 5BP7A 2C7RA 5K05A 1RI1A 3CNYA 4KDCA 3M0XA 4DCMA 4AZTA 3E8SA 2HNKA 3NW9A 3LDGA 3NGFA 3E7PA 3BKWA 4AUKA 2YUIA 2FYTA 1X1CA 2EJTA 5KQRA 2ESRA 3UJDA 3AWIA 4U7TB 5CIYA 2ERCA 3FZGA 1KP9A 1NT2A 4LNCA 4FSXA 1UIRA 4FT2A 2Z6AA 2FRXA 2B2CA 2P7IA 5E9WA 2ZDSA 5FWAA 1D2GA 5E9QA 1KYWA 4RWZA 4E2ZA 8MHTA 4G56A 3P9IA 5JR3A 3UBTA 1WXXA 5BXYA 4GLEA 4K1GA 5DTQA 3AXSA 3F4KA 3NVKI 5DPMA 5CCBA 4C08A 2ZLBA 4YMGA 3KR1A 2GUBA 4XIAA 1O9HA 4XUDA 4HNOA 3LMZA 2QY6A 3BZJA 2ZSUA 3IUIA 2IDJA 3KQYA 4P58A 3HVIA 4XSLA 2E5WA 1S5MA 2JH9A 2PXAA 3DP7A 5XIMA 2I9KA 3ME5A 5CD1A 1QANA 4KRGA 3S68A 3FTDA 4F86A 5DRTA 5HZMA 3HA3A 5EOVA 5E2BA 3TRKA 4OQDA 3ITTA 3KQMA 5E1MA 4BP3A 1G8AA 4CWAA 4POOA 4A8IA 1JQDA 3AALA 4YTQA 1WZNA 2B78A 1NE2A 2YR0A 3KU1A 2YVLA 1N2XA 3HCFA 4GF5A 3KHKA 2XIMA 3HP7A 3KBNA 1U2ZA 3U3HA 2OZVA 3B7PA 3ORHA 2PX4A 2WK1A 4ER7A 3C0QA 3HA5A 4OBWA 1IXKA 3SX0A 5K0NA 5GP1A 4GOND 2CMGA 1XIDA 5FA5A 3XISA 3AY0A 3P2EA 2C7OA 2G72A 1XIEA 2VDVE 3ITLA 3PX3A 4QQNA 2VP3A 2VS1A 3LHDA 2EG5A 5D1HA 5EZQA 3U81A 3UJ9A 1MUWA 4RTQA 2EX4A 3B5IA 3NWEA 2GAFA 1XCLA 1XYBA 2WA2A 3BZBA 5HIIA 4RX1A 1ZGJA 3M4XA 3BWBA 5DT2A 1F38A 3SXJA 4CKCA 4EK9A 2EFJA 2GLKA 4YUWA 1HMYA 4C04A 3TQSA 4EAYA 2ZBQA 3OU6A 3KPJA 3QV2A 4E30A 1XLJA 3GXOA 1WY7A 1D2HA 3MTIA 4M36A 3NVMB 3P2IA 3ITXA 1KPHA 2AR0A 4OBXA 5E1DA 3TLJA 4YMHA 2B3TA 4AZWA 2OBFA 4KVZA 5K03A 3MERA 2AOTB 5H02A 1QAOA 3GRYA 3I58A 4XUEA 5C9ZA 5GOZA 3VC2A 3E05A 3KCOA 3I9FA 5DTMA 1AV6A 1F3LA 4YTTA 1JG1A 3M0VA 1OADA 1EJ6A 4LG1A 4PNEA 5LQJA 3XINA 1XVAA 4GQBA 1MJFA 2PX2A 4RTMA 5FHRA 1ZHFA 4YV2A 1YFLA 2ZCJA 4IWNA 3MTEA 2BH2A 2PXXA 1DE5A 3M0MA 4OA8A 1DIEA 3KR2A 2X7VA 3HTXA 1G60A 2AN4A 4KDRA 4NECA 4PONA 2FPOA 2H1RA 5EGSA 4X41A 3KQTA 1YZHA 4E3VA 5CVVA 3UA4A 3CWHA 3B3GA 1NW3A 3EGEA 3G2MA 1RI3A 5FA8A 4CTJA 1XISA 2XINA 2HK1A 4XISA 1JSZA 1ZGAA 4KIFA 4KW7A 3KBMA 2XYRA 3NDJA 5F2OA 5BW4A 2FHPA 4QE4A 2GYIA 4QPPA 1EG2A 5ICEA 3M0LA 5M5BA 4MIKA 1YZ3A 1R74A 3G2OA 1XP3A 1IY9A 3M6UA 3G5LA 2X7WA 4GOMD 1NBIA 1WG8A 2ONYA 3DBNA 1XLHA 3I5UA 2QRVB 2I57A 3KBJA 1XXLA 6XIAA 3A25A 3SSMA 4US6A 2DULA 4RTRA 1FP1D 4A8LA 4C4AA 2JHPA 3BGVA 3GIWA 3R3HA 2R3SA 2G8NA 3G8AA 3B3JA 5E2AA 2XYVA 1RI5A 1ZQ9A 3KR0A 4GC9A 9XIAA 3C0KA 1FBNA 3DXYA 4PWYA 2AVNA 5ERGB 5EMLA 2ZULA 3MCTA 3V8VA 2NP6A 1RJFA 2OB1A 2QUNA 4A8NA 3P9NA 4RVGA 3LX6A 5T67A 5T64A 3FUUA 3P8ZA 4IV8A 3ITOA 3TR6A 3RIEA 3JWGA 4MWZA 5MHTA 3THSA 5KYGA 3ID6C 1A0EA 3GRVA 4ISCA 3HCAA 5DXAA 2O0LA 3C6KA 3CJTA 10MHA 5E8RA 2PY6A 4LWOA 1KXZA 4LECA 4RSRA 3ELYA 3LCUA 4DQ0A 3IHTA 2ZZNA 3ERCA 3SGLA 2P7HA 2KW5A 2PT6A 3KBWA 5B7ZA 3TKAA 4KW2A 4DUOA 2IP2A 3QC0A 3CQJA 2PWPA 4FP9A 4R8SA 3K0BA 5CVEA 5FTWA 4QPNA 3EVBA 2OU4A 1BXBA 3SMQA 2NYUA 5FQOA 1SUIA 1QYRA 4RVHA 4ZBCA 2YX1A 2I62A 5DM1A 4CKBA 2XYQA 2PVCA 2ZTHA 4FS8A 4P7JA 2O57A 2C7QA 5EMMA 1P1BA 3KR9A 1XDUA 3EEYA 5GIOE 2IH5A 4PCLA 4PYQA 4DVOA 2EJUA 2G1PA 3TKYA 3TVAA 2P35A 2NXNA 1FJXA 3UJBA 1VE3A 5FQNA 1XYMA 1KHHA 3O7WA 8XIAA 4RTJA 1YX1A 1X1BA 5D1NA 5F2NA 1PJZA 1JTFA 3O4FA 4YUVA 1X1AA 2AS0A 2Y1WA 2AOVA 5FWDA 2ZBRA 4EACA 4GJJA 3EGVA 2PWYA 3GNLA 5DSXA 5EIFA 3AXTA 1QAMA 3LL7A 5EIWA 4EQZA 3LBYA 1XIHA 3LCVB 1A0DA 2Z6QA 3ELDA 5EHGA 2BR3A 5ICFA 1L3CA 1VL5A 4QEHA 3VNIA 1BOOA 1QZZA 3KPUA 4OA5A 4CXMA 2GH1A 1Y8CA 3AJDA 3BXOA 3BWMA 4WXHA 4J4KA 1RJDA 1VBFA 2BM8A 3DMGA 3T7TA 2IH4A 4ER3A 3EVFA 3PS9A 3SSNA 1JQEA 3U0HA 1JQ3A 1KIAA 4PIPA 2V7EA 1YB2A 3EGIA 1XIMA 1SKMA 3H2BA 1WXWA 2JG3A 1P91A 3FUWA 1O54A 3KKZA 1BC5A 3GNXA 3IUDA 1VQ1A 3UWPA 1QAQA 5HIKA 4RVDA 1GW9A 5I7GA 2IIPA 3B3FA 2I7CA 4DZRA 3CCFA 3MGGA 2I6GA 3BDKA 3OE5A 3PFGA 3UXIA 5HILA 3LDFA 3SSOA 3WQOA 4X61A 1KPGA 3EVGA 1XLKA 1XIIA 3X0DA 2ZIGA 3HNRA 3T0IA 3SM3A 1I9GA 3DH0A 2AN5A 4YUXA 1CLKA 1DE6A 3UU0A 1TPYA 3KPVA 3R9XB 2J6VA 3M33A 2PJDA 2JJQA 2PKWA 2AOXA 2IFTA 1X19A 2GLUA 4ZB2A 4CTKA 1OR8A 2IBTA 3Q87B 3OZSA 1I1NA 1G55A 3TC3A 2AOTA 2PXCA 4HSGA 4GOOD 3DULA 1VP3A 3DUWA 4BLWA 4C07A 1R00A 4F85A 2VZ9A 1XLEA 3QYSA 1A0CA 3QZAA 1XLFA 5DM4A 1PRYA 3GDHA 2PX8A 5HFJA 2OO3A 2ZWAA 5LQAA 2K4MA 3KPWA 4RV9A 4A8RA 2P3QA 3HVHA 2O06A 4AZVA 4X60A 1XIJA 2PBFA 4ER0A 3LBFA 1HNNA 5K0CA 4ER6A 1NV8A 3ANXA 2G71A 2NXEA 3IEIA 4E33A 1NW7A 2F8LA 3BT7A 2BZGA 1ORIA 5ICGA 3FUTA 3FTEA 1XICA 5EVJA 3JWHA 3V97A 3RW9A 3PX2A 1I4WA 3G89A 4KIGA 4RTSA 2I56A 3M6VA 3BWWA 1R8YA 2ZWVA 4BY9E 2Q41A 2IDKA 2NNWB 2PX5A 3GWZA 5TNVA 1INLA 4QQKA 1UFKA 3CGGA 3CJRA 3A26A 5HIJA 4IV0A 2IPXA 3TMAA 5XIAA 4DA4A 4E70A 1L3BA 2OPBA 5DX0A 4PYNA 3PB3A 1DXIA 1EJ0A 1NKVA 3CC8A 1BHJA 1NW6A 5K0LA 3VC1A 3A7DA 4K6MA 1L3IA 1P39A 5LSAA 2IBSA 4ZTBA 3REOA 1XYLA 3BKXA 2PLWA 4W4QA 3FRHA 3P97A 3THRA 5FULA 1D2CA 1N7JA 2AN3A 3KQVA 1ZG3A 3UVAA 1P1CA 1ZKDA 1JG4A 2JH8A 4X1OA 3FUXA 5EMKA 3BWYA 4M37A 3BWCA 3DLIA 2QUMA 3R0QA 3FPFA 9XIMA 1SQGA 3OE4A 1XINA 4GUAA 3HCCA 2HV9A 2CL5A 4V0QA 4FR0A 5G02A 4PGLA 1N7IA 4PYLA 5GINE 1FPQA 3MB5A 2FK8A 4R8RA 3TOSA 2G4JA 2P40A 3DTNA 2PSSA 2GPYA 4RVFA 2QULA 3DOUA 1K77A 4Y30A
chains in the Genus database with same CATH superfamily
3E0IA 1GYMA 2F43A 1GGKA 2COEA 4O02B 7REQA 1UDBA 1HDIA 2W4QA 4IJRA 1QZ3A 1RAKA 4RD1A 3NBFA 5KVAA 1HQTA 1ZL1A 3CR7A 1EUCA 2JVKA 4AFYA 2E6UX 1PG5A 2YCBA 3PQDA 4TKLA 1N1EA 1UOEA 3MP4A 1ZDMA 5EJEA 1NH6A 1JU4A 3H2MA 4HRYA 5H68A 2J7PD 2HISA 2FUEA 2IDMA 3AHXA 4Y1RA 4QTGA 5DCDA 3B9NA 2Q4RA 4AG6A 3TRFA 3DX5A 3ES9A 5EHNA 1GZJA 4G1NA 2QJRA 4GT1A 3HSSA 2HR1A 1YYAA 4BKPA 1ZSNA 1EIZA 4N3CA 3GFSA 2WAYA 3ZNPA 5BV2P 4Q33A 3TSCA 4LE0A 3T7KA 4MQ4A 3H2HA 1ODLA 1C81A 4OGWA 4LI3X 1CCWA 2I4LA 1C9MA 4PTDA 3HBLA 3UBPC 3P5BA 3FVDA 3AG6A 3OFNA 1L8PA 2ZUCA 4JHLA 4IGEA 2V7UA 3GFVA 1NOJA 1IT0A 5EAIA 1Z2NX 3BLLA 4GMFA 3WQPA 2H2DA 2XCUA 1BG9A 5A6LA 2XTNA 1ZJ6A 4FGUA 4N5MA 1Z62A 3K0SA 5KNCD 3CLSC 3PZNA 2HA6A 3JX9A 1XOIA 4W5OA 1E6MA 2A94A 4JI7B 4H18A 1YGPA 2PP0A 1Z6XA 2PRIA 4G1EB 4J40A 2OFFA 2ZX6A 4YNGA 1I6MA 1LLDA 3VX0A 2CWDA 4GGPA 4KN6A 4RELA 1G7RA 2ZI5A 1UZHA 1GAEO 2ID8A 1GPLA 3ZJUA 1PJAA 4II7A 3E61A 3CX7A 5CD9A 1B4EA 3G6KA 3I0MA 3AI1A 4C4RA 2AQWA 1NR7A 2UZAA 2AMGA 3LBIA 1HT6A 3LH5A 2DFNA 4C4XA 3RFTA 3S1SA 3L1VA 2O5CA 2V69A 2JFPA 5L40A 3HI4A 1PV4A 3TMQA 2IIVA 1E0AA 5JFOA 8MHTA 3MO7A 4JQ2A 1HRDA 4RHEA 1EK1A 2OR3A 3WO1A 4CQLB 2OCLA 3IQWA 3RC2A 3KD3A 1DDGA 2XY4A 3IUQA 3NV9A 3UG7A 4F6CA 2XGIA 1CUCA 1G2PA 3DCNA 4QJ5B 5JI2E 2UYYA 3NCOA 3PEWA 3SX0A 1RXCA 5T4EA 2VFEA 4AY8A 4QAWA 1EVQA 2X2FA 1C90A 2KLBA 4JYPA 2WM0A 3HU1A 4F0JA 1P0MA 2UVPA 1CFJA 3R79A 4AY5A 1Q6YA 3I0NA 4AP9A 2JAUA 4H9MA 5DO9A 1DAIA 3MT0A 5LOVB 3VA7A 1FSFA 2R85A 3QUSA 2G3NA 2EAUA 4FYJA 3L4JA 4EW1A 3LMYA 2EV9A 4ZCWA 3R9WA 1U8AA 2ZTMA 1SULA 1RWXA 1FDWA 2O2IA 3GA7A 1A5BB 3BXEA 3F3YA 1ZZEA 1Z13A 4KIFA 5L3ZA 3PC3A 3DGRA 1HZZC 4PC6A 1WB6A 1E9YB 3H05A 3WWZA 4PQEA 3BE8A 1T8UA 3APTA 1QNFA 1UK7A 1SCUA 3E2VA 1XXLA 2PVPA 3CJPA 4DO6A 2ZUWA 1R0ZA 3P2MA 3TK7A 2D54A 4E2ZA 5HF5A 3UKOA 5EXSA 4RPPA 2DFPA 3IC5A 3X1XA 2P8SA 5FPTA 5CT9A 2NSLA 1HEIA 1NF3A 5K4XA 4AO7A 3UOAB 3UMRA 4GGHA 1U2GC 3LLCA 1F7VA 1HZJA 4KGDA 2NSYA 4RULA 4FMBB 2HPZA 3WK3A 2HSZA 4KK3A 2XOEA 1J8YF 5BQXA 1ETUA 2X5KO 1RSCA 5AKXA 2Y68A 5AMXA 1VJIA 4PEVA 2IXEA 1BWQA 1L5KA 4BQPA 1LI7A 4RIHA 2OMEA 2HZGA 3PY2A 3R7BA 1DAKA 3F8TA 4KJZA 1OHHA 1ME9A 3GFBA 2GWHA 2PL5A 5CPOA 3FKQA 1UH4A 2AOXA 4J0DA 2OSXA 1OGSA 4CQCA 4C07A 2FX3A 1VSQA 3HYNA 4HI0E 3HVHA 4B6GA 1MIOA 2Q2QA 6ALDA 3BIWA 1YO6A 3QRHA 1X7DA 7AT1A 2ZC8A 4RTSA 1KOJA 2GO7A 2Q9AA 4AD0A 4QXAA 3EIEA 3ZHSA 4ALNA 5IRCD 3A7DA 4XARA 3TEJA 3TQPA 2Y6VA 4F1KA 3GY0A 4GP9A 2IXBA 2N9UA 3B1KA 4B3FX 4MKXA 2F00A 2O5VA 5FPSA 3WJ7A 2I6FA 5HATA 2Z29A 4HY3A 2PDAA 4XM1A 4DSZA 1GWNA 2ID4A 2QUZA 5JOQA 2GVGA 2QT0A 1JT2A 4P3PA 1YA6A 1ETHA 3I6IA 1EE1A 1NOKA 3GAFA 3I92A 5K5EA 3T4CA 5EG5A 1TGYA 3BBPA 3IMKA 5BQ3A 3H19A 3JW8A 1J09A 3B70A 2VKTA 2C1XA 4GZ7A 2A35A 3RIXA 4J4BA 4B32A 1ZHHA 4H2CA 3EUEA 2GZ3A 4DBWA 5HOQA 3H5WA 1RJQA 1EQAA 1SD2A 2H63A 4FBLA 4QXOA 2N75A 1H6BA 5MN6A 3T3MB 4A5OA 1S7GA 3CASA 3DWIA 4RNJA 2OO0A 1CY1A 1Q17A 1M67A 1JGTA 4EF9A 4JUCA 1SBTA 1WMSA 4PCAA 2XJ7A 1D7OA 1FXWF 4XSMA 1EIWA 1H2EA 1E8MA 3U31A 5T26A 5KYXA 1UDRA 2WSRA 3TIGA 3R0IA 2SCUA 4NG3A 1ZCBA 5JAIA 4J4TA 4MW1A 3S2EA 2OECA 2Z1DA 1KFEA 3HJBA 4MR7A 1B0UA 4WFQA 4WIAA 1YA8A 3RV4A 3AG5A 3ITGA 3GZAA 2H2FA 3VINA 4R69A 2FLKA 1I1OA 3F8WA 2BTQB 4ZHQB 1LROA 2XNKA 4X84A 4L75A 3L0BA 4BFWA 4DI8A 3KVMA 1OVDA 3AEKB 1SG6A 1YB6A 4ENQA 4NE7A 5DWVA 2NW6A 4F0HA 2CDCA 1KIMA 2EGGA 4QXQA 1OFTA 2AX4A 4FFWA 4HHPA 4Q8NA 1CZUA 5I7AA 5LA6F 4Z42C 3RFUA 3ENVA 3PNPA 4A35A 3CHDA 5BW5A 4HDKA 4HBKA 1DWOA 5A05A 1XDLA 5IT5A 4N01A 4PUDA 3L6DA 1ISXA 1CUSA 3G1VA 2IY7A 3A12A 3PXCX 5CEJA 1CJMA 1UP6A 1P6UA 2A8YA 4Y9SA 3GBSA 1WXJA 2PT7A 4KLCA 2TMDA 3I1JA 1NU6A 2BHLA 5T7BA 1R3QA 3MKKA 4WZ6A 2WB5A 1W8DA 3VKCA 4FSXA 4PHGA 2RKBA 5A9TA 1E3JA 1JXJA 2JEZA 1JYWA 1LJYA 1R1DA 3QEMA 1QNOA 1QANA 1K8RA 2A84A 3MC5A 2CXTA 2EKQA 5IHRA 3CUYA 3TLBA 3KOYA 4MARA 4LZPA 4O0ZA 2GCOB 4MJ3A 4B9AA 4AWEA 2G7MC 5C35A 3OPXA 1W5MA 3L8MA 3VR4H 3BOSA 3K15A 1EBUA 3LV8A 2V7WA 4PMUA 4RXTA 4AQYB 1FL9A 2C0PA 4OUIA 2GYVA 1GPBA 4D74A 3A32A 3VZCA 1ZH0A 2Q8NA 4MGGA 3RPDA 3N87A 3M0KA 1ENUA 2ZCUA 2FZNA 1G4TA 2P9QA 4A16A 4QISA 1JSRA 1TC2A 3CYFA 3KUCA 3LT5A 2JL1A 2HK1A 1P5JA 2J59A 5JNUA 2AHOA 4RK1A 3CSDA 1OCQA 3MQ4A 3DE5X 1DJIA 3OB8A 2FWMX 5BQOA 2W7TA 2B31A 4BASA 4Q93A 1LS1A 2ZE6A 5DLEA 1E73M 4IPNB 1NIPA 3GEDA 2QUTA 2H9YA 1JCYA 1NFQA 1K92A 3EQZA 4S38A 3UWSA 3BAZA 1R66A 2VHJA 1D07A 5K4HA 4TQAA 2PT6A 5JJBA 3TLMA 3V1MA 2XYQA 3W7IA 5GIOE 4AJ4A 1XVLA 4N9WA 4UD6A 5A5GA 3KL2A 1NDZA 5DKFA 3GZ4A 1KM5A 1CR2A 3PNVA 3Q4GA 4XVEA 4O5AA 1P5RA 2IKQA 3C1AA 4YCJA 5AXAA 1T0OA 4E2OA 3DMGA 3GZJA 3DV2A 5G3ZA 3AVTA 3N1AA 1FCUA 2EPLX 2A85A 4KWOA 3FA2A 1ZEMA 3KO8A 2AN9A 2Z5FA 1P4AA 3ARQA 4C22A 4MZ1A 3ZLBA 3L7NA 3IHLA 4QG7A 4DAOA 1KETA 4KEAA 3AGPA 3UBTA 3GDHA 3BJIC 4M1YA 1OZHA 4NATA 4KBXA 1XH0A 2PBFA 3S2ZA 4Q24A 3FUTA 3A05A 3S3GA 5A4MS 9RUBA 2WV8A 3THAA 5BURA 4I08A 4PG8A 4JAWA 1EFUA 4LTMA 1S96A 2HEIA 1I6LA 2YHBA 4TMXA 1PT9A 3B0PA 3MMXA 1S39A 5J2TA 3BUVA 5FWXB 3OO0A 4EMUA 2AWNA 4V1CA 4F2BA 3OLIA 3E9EA 3PHAA 1HF6A 3VDHA 2PMWB 2Y24A 2IOFA 2DEUA 2ZTKA 1AG1O 4BCBA 2BCJQ 2BFFA 2XZPA 1ZNYA 2E2WA 1ZAIA 1AHHA 1QB7A 2CLDX 1I1HA 1E3QA 3BQ5A 3WJZA 1U1GA 3OYZA 3VIIA 3DGFC 3V4PB 4ALJA 4BMNA 4S3JA 3H6OA 1M03A 2DZSA 4ENRA 1I2ZA 3U7EB 1TCUA 4ZVQA 3BOXA 4MKVA 1CULC 4YU1A 3IP7A 4ZVUA 2EBFX 1SVMA 1T4CA 4HDMA 2HRBA 5T6BA 5LA0A 2OAQ1 3MLEA 2I8CA 3PSHA 4QOIA 1XLWA 5ILQA 2OO5C 1DWIM 3O91A 1G6HA 1ZNXA 2XX3A 3ARUA 1XTPA 4QCFA 4QGSA 1O95A 4EUEA 2ZKIA 3C8MA 2XKAA 2HIHA 1EXVA 2XITA 2XQFA 3TTTA 4JKKA 2IUUA 2C1IA 5K0FA 4KWCA 3NTQA 4FT4A 1CJUC 3FTCA 1Z2DA 3ANNA 2ECFA 4CBVA 1KMNA 5BMOA 5BUZA 5CR9A 4DEXA 1EUYA 1SMKA 4IJBA 2G5WA 4Z6KA 3F2VA 4AZ0B 2NQJA 4ZALA 3OO1A 2OKOA 3U3DA 2VURA 1DYSA 2C19A 4EMBA 3GMTA 4ZWNA 3L49A 3DTYA 3N11A 1MJ5A 5KREA 1HV8A 4AP6A 5CA1F 1NVMB 5EP3A 3WEOA 4YP5A 3KBVA 3WLPA 2WAAA 3LHKA 1UEXC 1JZ4A 3HDQA 1GTZA 2CLOA 3ULKA 2UBPC 5ECUA 1BROA 1QO5A 2VJBA 2YYAA 1W46A 4Q7IA 4M60A 1IHPA 1ZWLA 1TLTA 3KVRA 3AS3A 1LBFA 2E7FA 3N0TA 2V5VA 2ZSDA 2OLJA 3IO3A 2FPTA 2JKYA 3MHGA 2XWPA 2A1UA 4I5IA 3CHFA 4TQUS 4NXSA 3IUHA 3OX2A 3THUA 4EJ6A 2IYNA 5HA7A 4LI0A 5IXYA 4IXDA 1RM0A 4G07A 4A8JA 4GRDA 1UHVA 3RN6A 1G9HA 2MYPA 3RTEA 5KEIA 1GQSA 3W27A 2V4MA 3DJFA 1B76A 3ZGNA 4O4IF 3PHCA 3R2GA 5JH2A 4F45A 1CUEA 1HGYA 2WJDA 1K9DA 2QSJA 2PUJA 3DKRA 3V1NA 3R76A 1M76A 1SIUA 4NH4A 2CLMA 5C4GB 5AHXA 3AVXA 4S24A 1Q0QA 4FLQA 2OCZA 2PGOA 2D6FA 4EVZA 1RHJA 2GGEA 2B9VA 3E9YA 3TLZA 1U2ZA 2OZVA 4JFSA 4ZEVA 1UG6A 3L9CA 3OOSA 3LDAA 4JOSA 2VS1A 4F06A 2VVNA 1X98A 1P75A 4Z1BA 3O1JC 4Y1GA 4MH0R 3ICCA 1G8MA 3L41A 4ATLA 2AR0A 1NSJA 3N18A 4ESOA 1EHNA 2Q1WA 1GQYA 3LGDA 4YUAA 2XAUA 1TKBA 3DLHA 2HREA 4P7OA 4LDNA 4YRCA 5F5NA 4PAGA 2VTKA 1TPH1 2QW1A 2W90A 4Q02A 2ZX9A 2J9YA 5T57A 4MAZA 1KKRA 4S35A 3EJ6A 4OMDA 1PZGA 2EPKX 3NVTA 1JA0A 2V65A 2VCBA 4HDMB 3OOEA 5LNSA 1VHDA 3OT1A 4LJYA 3UGVA 4XQEA 1UZLA 3CJTA 4WTOA 5AXDA 1K1DA 1J1IA 1YL5A 3M82A 1G20E 5KITA 4UUNA 5JATA 2I62A 1F8FA 4FUQA 4FCTA 3UJBA 3B0XA 3LOTA 2YCIX 4YNBA 5DT5A 3AETA 3HJAA 4IIJA 2D06A 3MWEB 3L4YA 2BGTA 1FDJA 1VG8A 3ZDAA 2FPXA 4LVOA 3WSWA 2O2HA 1UZMA 3T7TA 1JQEA 4XPIB 2DPYA 5FR2A 4DAFA 1V4VA 1HRKA 1YDFA 3PHIA 2B0JA 1QPOA 1KKOA 4D8AA 2P5UA 3K0HA 3VR6A 1JR2A 5ABFB 1VA4A 1LLUA 1C1XA 4IIBA 2A78A 4W9TA 4Y2QA 3F5QA 4ALMA 1PYGA 4XWYA 1KK0A 5BMWA 1NV8A 2VHVA 3N2ZB 1LY1A 2HJGA 1XNGA 5JXHA 1F2VA 3R1IA 3ABSA 4OHQA 2XOKA 2RGYA 4RIIA 5EZ5A 3VKUA 4G2TA 3WX0A 4UMDA 2R7NA 1RRMA 3V8PA 4WXRA 2VR5A 4DLWA 3BWCA 2XUAA 4CM1A 1C41A 2CEKA 3I73A 3R5XA 4ACAA 1POXA 2EIXA 3IE1A 5KYYB 5L7YA 3HUEA 3R6DA 2WKGA 1EH5A 4TVKA 4O2AF 1UUOA 1FFWA 1JI1A 1GNXA 5IARA 1H60A 3CAKA 1GVRA 1EFHA 4CLDA 3DB2A 1GY8A 4DIFA 5TD4A 1NN5A 4LQ1A 1BMDA 2VH1A 3D9QX 1W3KA 2G3FA 4KO4S 1KXTA 1PO9A 3HDGA 3N07A 5JD6A 1Z38A 2CT8A 4TS1A 1RPXA 2VOTA 4WGXA 1RJPA 1WSAA 3QRWA 1RZRA 2I2XB 4FPXA 2XE6A 4B6PA 5DMLA 1D3GA 5E5CA 1P7TB 2OO7A 4RFVA 2JCXA 4RZSA 3GW0A 2H1SA 1ACMA 3LPFA 2F38A 2NN3C 3EPPA 4EBFA 3WYNA 4QCEA 4OHXA 3AHDA 3GJ5A 5F2KA 2H9AA 2G0TA 1W1WA 4ZENA 3ZGOA 4JNCA 2QAGB 1AL7A 3GF4A 2FZEA 4G86A 2DX7A 4AZ5A 2Y76A 1M9HA 4DG9A 4HB0A 2C3MA 5AZ0A 4XCVA 3PF9A 4A0RA 5KKCA 1DKUA 3C8HA 2XNDD 3PUXA 2DHDA 1VKOA 3NPUA 1CEOA 4WDUA 4P8VA 1DXOA 3WN6A 2P4QA 4KWUA 5K4AA 4LBYA 2CFIA 2JGMA 3ZIDA 3E0QA 2BMAA 4TMVA 4H8UA 4K9NA 4YP6A 4HQ0A 1P7WA 3RO7A 2XB8A 2CY0A 2FPUA 4MKSA 2YL9A 4C6LA 5AVVA 5JDCC 1AQLA 3AETB 4IDAA 4N0QA 4UMEA 1FFXA 4KR0A 3VOTA 4PGHA 1L7EA 5CG1A 3NATA 4RAQA 3NHRA 4GOKA 3DU0A 1B3XA 3P19A 3IJ9A 4UTLA 4FQ7A 5KMYA 3PL5A 3SOPA 4LF7B 3ZW7A 5CX1A 4WI1A 1HLDA 3BBLA 3LRLA 3L79A 3FPHA 3NM5A 3VPGA 2DKFA 4B2YA 3UFYA 4HR7A 3D6NA 1C7SA 2OYMA 2XMSA 1Z0KA 3DHVA 4L8LA 3M9XA 1ISWA 1D4ZA 4PPYA 3ARWA 4UXIA 1XCGB 2O6HA 1Q7CA 1L8NA 3UYIA 3VIJA 4UQLA 3KLPX 4M86A 5DBEX 4CF3A 1C8KA 2Q4OA 1R3DA 4EY8A 3BG5A 3T99A 2C03A 4ZZ3A 1GAJA 3QKEA 4EWND 4R2WA 2JNWA 3EY4A 2Q4BA 2EIHA 1LU9A 4ZGWA 2OCBA 4FFRA 2D2FA 3M8KA 3KBNA 4L3OA 3T1GA 3WIVA 4U6NA 5ARCA 2F1IA 4H8VA 1PL7A 1YZVA 2VFDA 2Q0XA 5A9SA 5TJ9A 3RRFA 3X1MA 4F56A 4O1FA 1T41A 1T3GA 2ZTUA 2WUEA 2WTXA 2IPNA 3KPJA 3R6IA 3U26A 1FYWA 1HX0A 1NWCA 1UJBA 4KWSA 4XUEA 1KQOA 2V6BA 4GLLA 4MI1A 4EAMA 3COZA 4EKJA 4QUKA 5A7HA 1O66A 1L7VC 4S12A 3LW8A 4CGYA 4I55B 2VBCA 1YZHA 1NMZA 4DR3B 3S1UA 2ZR9A 3O2QB 1HDYA 1GNQA 3LQGA 2VF4X 1RAGA 1UIPA 3QLUC 3GC5A 2BV3A 4N8SA 2V6MA 5HJEA 2PP3A 1PX8A 3D6HA 3P9NA 5LLTA 5CSRA 4NXNB 2EJVA 5DBOA 5I51A 1TQ6A 3ID6C 1AZSC 4J03A 1MWOA 5F98A 1JAYA 3K2BA 3UAWA 1C8LA 5M5DA 3PXDA 5FTWA 2F2HA 4URWR 2OU4A 4RNHA 4TTTS 1U1DA 1U7OA 2PS0A 4IAOA 4QQRA 2YJ5A 1CECA 3W7LA 1PNOA 3TVAA 4B46A 1H8EA 1XQKA 5H3LA 3D8SA 5FWDA 1D03A 2X6QA 3H2IA 3VVCA 1KRCC 4IPTA 4KWIA 2QQ5A 3FGZA 2HS8A 2DT2A 4XZLX 2DT3A 3UUFA 4XYLA 5HUOA 4QSHA 2D2OA 2WE7A 4AT1A 1K8ZA 1U1FA 4QBKA 2WCSA 3K35A 1TWIA 1E0TA 3IIJA 1V9LA 2FZMA 2VSYA 5A62A 1J5PA 1VLHA 5ESRA 2P5SA 3PC4A 4NZNA 1K0FA 3HFJA 5DGTA 4MWTA 1T4GA 5B7GA 1Y5IA 3H22A 3BO9A 1BNCA 4PCNA 1F06A 3DOJA 1OC5A 2F9MA 2JDID 4BNZA 2O1WA 2BZGA 4WZAB 6LDHA 4FR5A 1XJBA 1U3DA 3BDIA 3L8YA 4CIWA 2QRLA 1E9AA 1KYQA 3GAMA 1RR2A 5FPHA 3COYA 1KOLA 1CGVA 2FRDC 5I7OA 3PR1A 3KS9A 1QIGA 1XD8A 1IIHA 2V30A 2L0XA 3TSYA 1VLWA 1XP8A 4E2VA 3OH8A 2GQAA 3RUHA 2CNDA 2XUIA 3K30A 4ZQIA 4ZYTA 3BCFA 1WB4A 3K70D 4Q7JB 5G4KB 1KFJA 2XUOA 1L7QA 5ES3A 3HN6A 2ORYA 2BUCA 1CEYA 3TB6A 2O3UA 2O8DB 4EWLA 3B3DA 3Q3IA 3CG4A 4BVJA 4LOCA 1BVWA 1OIVA 2CE2X 2IXFA 5I24A 4YACA 4HGXA 1YRHA 3CXRA 1J00A 2XBLA 4D41A 1OBFO 1PNQA 3TZKA 5BVHB 2GGGA 1RTTA 5EJ5A 5EJ7A 3PI7A 4U3AA 2C29D 3JQ6A 4ZARA 3KB1A 2QPSA 3T9DA 3MPUA 5LMCA 3UFBA 2C5LA 4V2XA 4X20A 4K9KA 3RJMA 2DQXA 4Y6RA 1P4CA 4P4TA 3NU1A 5F78A 2Z3VA 1IIGA 8AT1A 1OIMA 1RIFA 4MCIA 5BWAA 1EYWA 4OK5A 4EB6A 1W5EA 4MULA 1BA2A 3E02A 3IVTA 5HS6A 3V2GA 1CY2A 4GH3A 3I39X 3A4LA 3PUWA 1J70A 2ZAGA 3M3DA 1MB4A 5L6MB 1FP6A 2ZYFA 4XB2A 2HK8A 3F3KA 3TUIC 2PT9A 2QGFA 3H0EA 1E6UA 1Z5WA 2ZAIA 1A77A 2D2HA 2VDQB 2G06A 1ZCFA 5LWHA 1QUMA 1TYBE 4HPXA 4EY6A 3UAVA 2XA2A 5ALOA 4UEJA 4MIYA 4LRXA 2A1UB 4ZT3A 4P38A 3L12A 4AX7A 4JI1B 1I2DA 4WR3A 2FWBA 1EF2A 1G5PA 2PUZA 2VVSA 3C3CA 3IQEA 3KL4A 3MHTA 3HGJA 2CXNA 3QBDA 1BXRA 1AJ0A 2WZIA 3EZGA 1Q0SA 2GFHA 2C2GA 4AYTA 3KQSA 2AJDA 1J1ZA 4WXYB 1TJ5A 5F52A 3L5KA 1XBTA 4HVCA 4F71A 4GGMX 2D2XA 3OQBA 3NONA 4MP3A 4KGZA 2X8RA 2X15A 4Y96A 1QP8A 2LVBA 1R3VA 4WK4B 2J7HA 4MLDA 3DKLA 1MH1A 1BRMA 5CIYA 5FOXA 5FOSA 3CZQA 3QYFA 4JLMA 3I37X 1ZGBA 1JVNA 5LC1A 4C7GA 2XOXA 3HXTA 3TI9A 1R6VA 2CLSA 1KFCB 3VKFA 2ZYHA 5KKAA 4FXJA 4IIEA 4NPCA 3FTDA 2V97A 4ZQGA 4O11A 3KYBA 2NP6A 3IP9A 3UJPA 4N1AA 1UPBA 5AC8A 2BGWA 2HGZA 2NZWA 4AZIA 3QQ1A 4Z1DA 5F1YA 5EPOA 4KQMA 4YYEA 3W6NA 1RRGA 4KYUA 3DEJA 5EP4A 1UBJS 4XD7A 4MYUA 3R7AA 2VRCA 3P84A 4PN3A 4FK9A 1IBLB 1JUDA 3SN0A 2EG6A 5JBIA 1V79A 3SHQA 3PTKA 4CQ9A 3UK1A 1M83A 2HQRA 5JSHA 5LQJA 1YAHA 4A36A 3TFOA 1TYAE 1M5WA 3GEMA 2VTEA 2Y5SA 4HIBA 4WECA 3PHJA 2OCPA 4UZEA 3THCA 4RPCA 1OFDA 3W5DA 2OM6A 1HSZA 1FSPA 3A6EA 4W82A 3EN0A 4WOZA 3CCBA 3RIEA 1ZFJA 1U28C 2E9MA 1HR0B 4TLEA 1ID8A 4LF2A 3C2QA 3FJ6A 3LYAA 3OIXA 1AH0A 1DRUA 3SADA 4DLKA 4KW2A 3VMOA 3CQJA 4TTQA 3T4WA 3OAAA 1V77A 3KCQA 5L3SB 4QM7A 4TL7A 2JGJA 3CN9A 3MELA 1EDDA 3IIXA 1Z26A 4R1UA 1MC4A 3P0EA 4X95A 2W2VA 2A0KA 4OX9Y 5JFTA 2J25A 2AK3A 3EIHA 1D7KA 2JGAA 3KTFA 4M1QA 4TV9F 4TXHA 2PNFA 3W90A 3UWVA 5LYYA 5H2ZA 4WBNB 5CBBA 3DFIA 5J4KA 1L1QA 2FDCA 1YLVA 1YQ9A 4Q19A 5BMXA 3BDKA 1Z33A 2OHXA 4E14A 1PR2A 3QLVC 3OQJA 2Z7GA 4BBAA 4HPHA 1WXQA 3DHDA 2J6VA 2XGZA 2IFTA 4L7QA 4DV2B 2NSJA 1PK9A 1TPC1 3BE7A 4QQUA 1A0CA 2OO3A 5ALTA 2DQSA 4DMKA 1LDGA 1WUHS 2EWMA 2WSSD 3O7UA 4L9RA 2WTMA 3BWWA 2JIBA 3T61A 1FTXA 1M1YB 1PEDA 2Z8YM 5D3MA 1P1MA 3C3XA 1TTIA 5IHSA 3REOA 2IHVA 3Q7RA 4YJFB 3LBCA 4EHLA 1NL3A 2J62A 4A1FA 3FUXA 4WK6A 2J33A 4BDSA 1Q6GA 1WZAA 3GVCA 3LCHA 4NEQA 1W32A 3N2MA 1HG0A 1E0VA 1K7XA 3PJWA 4L5YA 1EVZA 4GMEA 3DBVO 3LYLA 4N7RA 2GN8A 3ZHCA 4NP6A 4IRXA 2C07A 3EAGA 4JTIA 4NOKA 2QYHA 2XVGA 4HDSA 4KAJA 4M6QA 3EEZA 3IJDA 2CZEA 1G69A 1T9BA 1WUFA 3KXPA 2WT4A 4JP3A 3TMKA 3T8QA 3VD9A 1XVIA 3H4VA 2ES4A 4H83A 2AKAB 1VCGA 1LGYA 2AZXA 2ZWZA 3RFFA 1YPIA 3ZLHA 1M72A 3B9BA 2XWSA 2WCGA 5HCUA 4FMVA 4EYQA 1GV1A 4LISA 2FTKE 5FPQA 4L9WA 5JUVA 3GI1A 1BMFD 4HN2A 1ND6A 3JZFA 1D9XA 2JLBA 4YRLA 5JD5A 2R84A 5SY9A 2R47A 1Q3NA 5CVCA 4RETA 3S46A 1XS2A 1WAMA 2HSDA 4WX2B 4K8EA 1XNQB 4YHBA 3GX9A 3URAA 4L5ZA 2WVJA 4NF2A 1EBFA 2YY7A 1JYSA 3UTCA 1G41A 3T5MA 5CB0A 3QIAA 4FIDA 3OUZA 3UA3A 1OUMA 1CXZA 5K0GA 3D64A 4Z0HO 4KQJA 2C54A 4XWTA 3W83A 3V3WA 4M0KA 3BWVA 1I36A 4WHMA 3TJRA 4HMDA 3ZCUA 3K2IA 2J3HA 4WNCA 3C3MA 2VCHA 5KBYA 5GV7A 5KSYA 3CWQA 3H2FA 1DQXA 3PYLA 5JAZA 2JIZA 3LPOA 2QQFA 2P0IA 2QCDA 3QMWA 1KZYC 3AL2A 4B9YA 4HSOA 2J3DA 4PYOA 4BFZA 5K99A 3VNMA 4F96A 3G02A 1U6KA 1V3JA 4C06A 3FGCB 1R8XA 1F8UA 2OC4A 3K8YA 4HYRA 4IF2A 1UK9A 3I72A 1XO1A 3S6TA 4TM8A 1P44A 1FA2A 2J3JA 1ISYA 1SXJA 3IP8A 2WZCA 2YIHA 1Z07A 2VC7A 5IJZA 4JGBA 3M5WA 4AUKA 2EJTA 2FFRA 3BULA 4GKLA 4WJZA 1NW4A 2A6NA 2W6PA 5CU7A 1HNZB 2LXNA 3GDRA 3B12A 2C04A 1DHPA 5IOBA 5A8QA 3UICA 4G9EA 1T35A 1HLGA 3KQYA 4I2NA 4B0PA 3F9IA 3G9XA 4WK9A 3C3BA 1GDHA 1MORA 4E88A 3AK4A 2ZEJA 3II6X 1EFRD 4FC7A 4OBWA 4P8XA 1OGJA 5FA5A 2G37A 4DQVA 4OT7A 3TI7A 1UMCA 5AYIA 4P81A 1XB2A 4PTXA 1JNXX 5H81A 1P0BA 3AS1A 1WUJS 1W4ZA 3BJRA 5LZ5A 2VT3A 1J0CA 3VR5D 1MRZA 1BIFA 1DPGA 1H5YA 5BXSA 3VD3A 3OF5A 4YROA 5I4KA 1DE5A 3KTDA 2HY7A 4RIFA 3OZFA 4K9MA 1EUDB 3UA4A 4AUBA 2FQ1A 5AVOA 4BRSA 2V3DA 4RXMA 4I9JA 4JKIA 2K2WA 2SHKA 1JI2A 1YQUA 4BMVA 1FW8A 3DL7A 1RY0A 3M0JA 3GEHA 1V43A 1G5QA 2Z2AA 3UPMA 1LV8A 1U2DA 3N9RA 2VJKA 5DW0A 2C84A 2CLEA 4IY1A 5T8GA 5E8RA 5F76A 1KXZA 1N1DA 4I9AA 3QC0A 1TXGA 2YUTA 1QOXA 1RQ7A 3GVPA 2XTJA 2BM1A 2CBXA 3ARZA 2I87A 2V82A 3STCA 4FLEA 3GNLA 4YRDA 3GNOA 3O8QA 1GVOA 1CUZA 4M0FA 4ALIA 1JVBA 4R7JA 5K6AA 5CPMA 4AXNA 1RKXA 3EXRA 2X0YA 3LNMA 1QGED 4XLZA 3GNXA 1LBMA 1R9GA 2Z25A 1TYCA 3W06A 2PZAA 5HILA 3H2KA 3EG9B 3I6QA 1UKBA 3T5TA 1WZLA 1P7TA 2XKJE 3CT7A 4O4VA 1NQTA 3JASB 3M1IA 5GJVC 1C29B 4RA6A 4E5NA 2ZS8A 3RYSA 4W6ZA 1E1QD 3AHJA 5DHPA 2E68A 4ENTA 4FGJA 4G5YA 2ALJA 4Y1EA 2GWNA 2OCYC 2B8JA 2MSWA 4U9IS 4HJXA 3OPYB 5INTA 2NLYA 2DTXA 5FULA 5JWHA 4ZJUA 1GTL1 3GHRA 5HUJA 5KNBH 3VD5A 3T5PA 2VO1A 2FRDA 4F11A 3PUOA 4DDTA 2D23A 3OQ8A 4AYSA 5KYYA 4TTUA 4IXNA 2PTHA 2DYKA 1J79A 5MGBA 2KAUC 4K38A 3GKFA 1DCTA 3JQ7A 4XX6A 3GJYA 2ETXA 1QGAA 2QVYX 5ALHA 1ZUHA 5IAEA 4AY2A 4TRJA 5IK2A 2WJ6A 4P5PA 2W42A 2AI1A 2BBTA 2UZ0A 3AY6A 4AD1A 1MHTA 4PXAA 1NKSA 2N1BA 2C82A 4F3NA 1KEEA 1L5ZA 4E1BA 4LYPA 1MRSA 1MJGA 3LPMA 3DG7A 5BUSA 2CITA 2R96A 3WYBA 4FZJA 1U0OC 2NXJA 3UMCA 2F3QA 4PNZA 1V02E 1C7FA 3HABA 4NDNE 3BG9A 5DX1A 4PRTA 1QR6A 2XE8A 5FHQA 1QGDA 1ADJA 4CGZA 1TK3A 3GO4A 1XRVA 4MUXA 1N2BA 4PMZA 1BRLB 1E6QM 2R8WA 3USBA 2YW2A 2FSPA 5EEGA 4UB9A 2PTWA 4EB0A 2JA2A 5EXPA 1YUNA 1VLIA 3W5VA 3GGOA 4DF2A 3JSAA 3VNKA 2UY5A 3NQ8A 4D4IA 1CTQA 2ZM5A 4JKLA 1CJCA 2WVSA 2W4XA 1PSZA 1T9HA 1VFSA 2A79A 4HNNA 4RTLA 4H3DA 1PKYA 3ZCSA 2W6JD 5JJ5A 1RYZA 1RPKA 2V5AA 1NUPA 5EWMA 3REQB 2FK7A 2GVDC 4GS5A 3SIXA 4QE1A 3GCZA 2X9LA 1TU4A 3KT6A 2JF6A 3JQAD 3E4CA 5DXXA 4JDYA 2PU0A 4CQMD 3WNVA 5BW8A 3K94A 4MEJA 2LP4Y 3HDJA 1Z3NA 1FBAA 1FDRA 2D1FA 4ARZA 1CUXA 1YF3A 5FA6A 3M3HA 5ADUS 2QV5A 3SEFA 4P7FA 1C3FA 3IP3A 3FCUB 1JSXA 1FXPA 4A92A 2B9EA 2RK6A 5LL6P 4LF1A 2JBHA 1Q3KA 5HMLA 4X22A 2O3RA 4GVXA 3NFUA 3FZGA 1FNCA 3HEBA 3TBKA 3A13A 2H1IA 1D2NA 2XMQA 4FGSA 1YBMA 5HDRA 2E21A 3W4KA 2GEUA 5JANA 2IDJA 4UREA 2ZCVA 4P08A 1T0IA 7ADHA 1E9EA 3WIBA 1JQDA 2RHGA 4GXRA 1U9ZA 4UM7A 4UU8A 5MFPA 1EDEA 3OZ7A 4AM8A 1SVOA 2WWGA 3KWLA 5FO1A 3AJAA 3RRJA 4O4HA 4DN6A 3NQBA 5CK5A 1W5BA 1QW7A 4N0MA 4A3YA 2P79A 1HNYA 1VGQA 3VC2A 4MB5A 4ILKA 2O92A 1EWQA 1J6OA 3BTNA 1NM5A 1Q0LA 5BSGA 1PJ8A 3I01M 4JN6A 5FORA 3RE1A 3V4ZA 3RU7A 3A3OA 3E70C 1SPBS 4NSNA 2PE4A 3O6YX 1UJ5A 2REQB 2I4NA 1Z6QA 2I57A 4CD7A 3TTUA 3FDKA 3UWOA 1Q74A 4LPSA 2XSBA 5CSUA 5JTUA 4MWZA 1NVFA 2GARA 4L0CA 1ISPA 2G63A 1G8GA 1WV2A 3INTA 4J90A 3HUTA 1NNI1 4O14A 1YH3A 1I51A 2P7HA 1J2RA 4M9SA 1EQCA 2RSLA 5DBUA 1DVRA 3E3AA 1V5GA 2DP3A 4NZ3A 4LXGA 2GDVA 4QHRA 1HBJA 1D4FA 4Q8PA 1FJXA 3OLZA 5DNYB 4PHTA 2DJIA 2VXYA 3M5XA 3AR9A 4WQMA 3IR7A 4JIRA 4PCUA 2SNIE 4ZFNA 4KMSA 4U2YA 4EEZA 3KLNA 5GQBA 2O9RA 4CXMA 4EF4A 2GH1A 4W8OA 4FONA 4HWTA 4D3FA 2C2WA 3QOMA 5B3KA 5I7HA 5TQJA 3FOCA 1OPXA 2P75A 1USGA 4MUZA 2XRMA 1HDGO 3UXIA 5EJIA 4RE0A 3DAGA 4LYJA 5AW7A 3GFQA 3GLKA 1FWIC 2FHFA 5LDHA 1G55A 3DC2A 2J7GA 1QHPA 3CLMA 3AR3A 1GZ6A 2JK0A 2DUUA 2IRWA 1C9EA 4YRKA 2VDLB 3AEZA 4OGGA 4O16A 3D2BA 4HAOA 1X42A 3PTLA 3GLGE 1AXEA 3PFCA 4MA4A 2C8LA 2GGIA 4W5QA 1AHIA 1VPVA 4L74A 3OSZA 4LYRA 3TSWA 1XXXA 1LL4A 4TTRA 1P39A 4OQLA 1BSVA 1RXWA 3RF6A 4IKOA 2PX0A 2V5LA 3AUOA 4A8JB 3T55A 1D1TA 5FF9A 1E79A 2O2JA 3KKOA 4L4PA 2GDJA 4MOZA 1AH4A 1FY2A 4LY3A 1HFJA 1DU4A 4H4CA 3NALA 1B0PA 2O54A 3U7FB 3LHVA 3G17A 3CUGA 4N02A 4RR4A 4ZI7B 5J43A 5MHBA 3TZ6A 4LJLA 3OZRA 2AMXA 4CI9A 1PWXA 5HJLA 2QYSA 4HNTA 2PDQA 4YJHB 2LBPA 3NWPA 3HIJA 3LGAA 2AG6A 1V8OA 1G5AA 1S3SA 1YS2X 4JFRA 1ADOA 1OA0A 4ETMA 4XWWA 4RVCA 4UM9D 2AZTA 2RHGB 2Q7OE 1R88A 4CQJA 4CLRA 4HAUA 1MPXA 3NO3A 5CXPA 1E3ZA 3ISJA 1KCXA 3SBEA 3RLFA 4A6XA 2PH7A 1MUUA 1U2PA 3F7OA 4JTRA 4HCDA 2JBAA 1H1DA 1RHUA 3JQPA 4XBSA 1YBAA 1HVQA 3SCOA 1KGUA 4FJ1A 1I32A 3OEYA 3R12A 1AL8A 2F1OA 1FFYA 1E7MA 4BXOB 4X7PA 3FLMA 2ZX7A 4PLZA 4QU9A 4YDRA 1AK1A 3DC8A 3HL4A 3HV9A 2CLHB 5J5DA 4I9FA 1J2YA 5I02A 3CUJA 4GEGA 1F1JA 2Q5CA 4YP9A 2J7KA 1KAMA 3TM4A 4EY4A 3DWFA 5DMXA 2A3BA 4P4SB 1EM8A 3R8HA 4FWTA 5FL0A 4GWKA 4MW6A 1ACLA 4LGCA 1YNOA 4WXYA 2PAFA 2G08A 4JLVA 3W38A 1XMIA 2XWEA 3MTBA 1UH5A 5IU6A 5GIPE 1I1WA 1DSSG 1C9DA 3C5QA 3X1ZA 4MQFA 4LUIA 4LBWA 4YJGA 1R2QA 2JBWA 3AFMA 5IUKC 3LVFO 3PVCA 1GQFA 5GWXA 2VNHA 4U2CA 2RONA 5DX7A 4DAIA 1A1VA 1SHLA 3RGTA 3FX4A 2E4XA 7XIMA 2C78A 3AOEC 3D3EA 4XBKA 5C8YB 4FN4A 5DM2A 1VCOA 3G8RA 1I80A 5ALZA 4B83A 1DX6A 4L4MA 1Y6QA 5HKBA 1QJWA 2VHEA 1OZAA 1H4VB 2JI7A 1Y5WA 5JBFA 4WADA 4IOTA 1BE1A 4MPRA 5EKSA 4ZICA 1QH8A 1R6UA 4P7BA 3LTEA 1V03A 4HYWA 1IXSB 3WJXA 3RYCA 3O8LA 1O94A 2ZLBA 1W6RA 2QTHA 4QELA 4P9NA 3R0VA 5HHTA 1PWZA 1OHHD 2RGEA 5HZMA 1Z0AA 3SHTA 1W59A 4CWAA 3KWXA 1VYPX 2ZWOA 8ADHA 1SZPA 2AEJA 3D6VA 5AXBA 3KHKA 2OG2A 3TJ4A 1DAOA 4LVBA 3KQNA 4QGBA 3ZTYA 4P34A 1Q16A 3F98A 1MUWA 1JF6A 3MMPA 2WA2A 4RK0A 2VC5A 5C5EA 4CKCA 3WB2A 4S1WA 1K5GA 1JSLA 2CZGA 1I3CA 2NXWA 1CRZA 3W9SA 1QO0D 3IOBA 1F3LA 1BFKA 2QEQA 1YQ2A 4O0LA 3R0KA 3F67A 2BFMA 4JSTA 1WA3A 4YV2A 1E5VA 1YB7A 3TNDA 1LA2A 1T25A 1E6WA 4ZZ2A 3TIVA 2BGNE 2RGRA 2J7CA 1D2EA 2AMLA 5CJMA 3KJHA 3RLGA 4C29A 5DM60 5E3HA 1NYTA 2WHEA 3SE7A 1NUTA 5F9HA 2IMRA 3K4PA 5HMMA 1YNSA 3GRFA 5C9UA 5ALWA 4FMCB 1RYEA 3GC6A 5EIBC 1YCGA 4QOHA 3PQ4A 3EAFA 4KUGA 4UM5A 4DUOA 1FVOA 1BW9A 1AHNA 2WJVA 2WWHA 3HB0A 4IOJA 1Z7YA 3AF3A 3L68A 3BAFA 4Q82A 5KNLA 3H2JA 4JJFA 4BC0A 3SS9X 4MKRA 2GK7A 3BGGA 3DLAA 1C8BA 3BD8A 3E35A 4LCSA 5BR7A 3OE1A 3GW3A 1U3VA 1XTJA 3TZBA 2QYTA 3U8GA 2R6OA 4WT7A 3ZE0B 1QGUA 4PUEA 3IAS1 4N0PA 2VDHA 3P7MA 5FTJA 1M3SA 1WZKA 3EVGA 3KVOA 4BC1A 3OBBA 1AGPA 4ZXLA 2B69A 1MVOA 1J0AA 1J2EA 2ARKA 4D4MA 3N0WA 3CZ5A 2C1GA 4A8RA 5HTKA 2NV1A 3MSGA 1QHHA 2Z1WA 5AJTA 1E32A 3TQQA 2CLEB 1I8TA 3DV0A 3F5MA 2O8VA 3A9CA 2W11A 2H54A 4RPJA 2XA9A 2ODQA 1JFVA 5GJMA 1EP3A 4RF5A 5AHIA 3BRCA 1DXIA 4ZPXA 5HBGA 4FDAA 4FLSA 5B36A 5E6YA 3FRHA 4L9ZA 1ZJIA 1U99A 1WCYA 3E6AA 3L93A 1ZG3A 3I2HA 4KDEA 4HV4A 1T2EA 1UP7A 4ID3A 2VP2A 3EKZA 4H9TA 4MCAA 4CIDA 1E64A 4E38A 4GZ5A 4UR9A 2PMCA 2VEPA 2GD6A 4MVJE 1X1SA 5IVIA 4BMPB 4E2WA 2HXGA 4QJ4B 1OINA 3ETJA 4ZV4A 3VDXA 1E1EA 3EVTA 3PPXA 5EGNA 3RR4A 5JLAA 1HO1A 3KEHA 1K7XB 1JFSA 3VH4A 1CFZA 1K0UA 1Z7AA 2P68A 1M33A 2ACRA 2YYZA 4C01A 3C43A 5AJUA 1LTKA 2I1LA 3F96A 3CZJA 3ZDFA 4MI3A 4H6RA 4RTRA 3BOLA 2O2XA 4AKGA 5D6OA 3KQLA 1G1AA 3F8SA 3LPPA 2QXUA 3LHFA 1WW3A 3NC1C 2HUPA 2P30A 3UJ7A 4BQ3A 4KT2A 1BH2A 1EFLA 4PZAA 4NU0A 1N5MA 3WBEA 5NULA 5H7XA 5AW1A 1B16A 1P0CA 4FLFA 1JEQB 2A3CA 2WKSA 1GT6A 3SB0A 3DR5A 4Z0JA 1N77A 2SBTA 1B42A 3L5MA 1DG9A 3L0DA 2FQIA 3N8HA 5H8MA 3GGGA 2A7QA 1ULZA 1F51E 3U13A 3W74A 2Y92A 2VPTA 3F71A 4HH0A 4J3XA 3U17A 4TMWA 4DMGA 4B4HA 1MQRA 1UWAA 4X54A 4OUKX 2QM3A 3Q5DA 3QPZA 4OMCA 1WXEA 2Z5LA 5A0VA 2WMYA 3VZSA 3ADKA 4J75A 4NARA 1Z6KA 2V8OA 1LP6A 5LBTA 3M5YA 5IFPA 1T29A 4LRYA 4W4TA 1EMDA 4X8HA 1ZMBA 1A2QA 1PWMA 1DLJA 3AL3A 2HK0A 3E82A 5A71A 2PX3A 2OORC 1Y7TA 1ZZGA 2XT6A 3ZD8A 4C1LA 4EPKA 4GC5A 4H6VA 4S1TA 1I9CA 1L8XA 4XM2A 3WFJA 1TVPA 1ZC3A 1IHIA 1C7TA 1X9GA 3EVEA 3V6MA 4MB6A 3NL6A 3E2QA 5DISB 1AXGA 4LV5B 4Z9FA 1A2KC 2IY9A 2C9CA 3K0EA 4HRAA 2R2AA 3A27A 5I7RA 3VV2A 3LC2O 3CLTC 4KIWA 4W5WA 3PPHA 2UYOA 5KOHA 4Y9PA 1JR3D 1Z82A 2CUKA 3MWFA 3K5XA 4HK5A 3H83A 4GY1A 1P62B 3ZR5A 1UOQA 5J5VA 1WABA 4RGVA 4JLOA 1B00A 1EGZA 4BKUA 1V6XA 3K0FA 3VC5A 4YIHA 3P0WA 8RUCA 2JIWA 4XIYA 2A0FA 1IQ8A 1EBBA 2NV9A 5EXDA 3VKBA 3QQ0A 3ETGA 1N2XA 2AL2B 4URYR 4ZQMA 1E89A 4ZJPA 3NR0A 3T8YA 4DNOA 3F03K 2AD1A 2QROA 5JC1A 3U81A 1VEPA 1VB9A 1E5TA 2DHQA 4JY8A 2WUVA 4ZC1A 4GKKB 4H9XA 2CETA 3CA8A 4ROTA 1GLNA 4ZT5A 4CMAA 2IHBA 1EFAA 4HEQA 3PEFA 1SM9A 4B5XA 4TTGA 4WKAA 1EJXC 4N4PA 1P0KA 3I12A 2WQ6A 1E9SA 1THFD 1ISRA 1QE3A 1V7CA 4A5SA 1ML4A 2HDJA 4UOEA 5CYGA 1VEOA 1J8VA 3U40A 3ARXA 2PK3A 1IY9A 4AVNA 1TUFA 2XIQA 1FKWA 4ZAYA 2LPMA 2BVDA 3CTPA 3ANLA 2RHHA 3B3JA 3PJUA 3WQQA 1W30A 1GQQA 4GMDA 2PGIA 3AMDA 4O2AB 4RVSA 4BHTA 3DKJA 1W4LA 4LB3A 1E6SM 3H99A 1XCBA 2DUZA 3N8GA 2JGDB 1KZ1A 5JXIA 3UAXA 1YZGA 3DC0A 1TYEB 2OZLA 4P5DA 2CBJA 3OIDA 2LTAA 1UD6A 2IOFK 1SUXA 4J3WA 3CUEF 3QKRB 4A27A 5DSXA 3TTEA 3LD5A 3KS5A 1NARA 3O2NA 1KBKA 4UR7A 4GKVA 5CB4A 4FDUA 3TVYA 2QDGA 1BHO1 1K75A 1PHRA 3IVXA 1WXWA 4FS9A 2CNOA 3ND8A 4IILA 3CLUC 2RGAA 5KNDD 3Q9UA 3IV3A 1BDIA 1ZJAA 2DKOA 3EFOA 3R9XB 1LRKA 5B57C 3DYVA 4UTXA 1OZMA 2CXSA 1LG2A 1C3EA 3MKVA 1PI3A 1X39A 2ZRGA 2QUVA 3MUXA 4RK5A 4AMVA 2HWUA 5K0CA 4ZVLA 3KB8A 1DDIA 4KCGA 3RLVA 1R8QA 1RP7A 3RTBA 5SYMA 5CGMA 3GWZA 1YJXA 1J0YA 2IPXA 3WQ5A 1J4AA 2JPDA 2YZRA 4JJAA 4BLRA 1V3KA 2OT3B 1ISGA 1GZ3A 2JRCA 2GJ9A 1GOTA 4DIEA 1ZD3A 1UFVA 4PLHA 3GRPA 1UBPC 4DF0A 2H08A 1L2QA 4GX5A 2IUEA 3KWFA 2VTBB 2D3TA 4E4FA 4N7MA 3KYCB 3U7GA 4HQKA 1M9NA 5AH0A 3CG0A 3WNNA 3G2GA 4PAWA 2OQHA 1XEFA 5IDZA 1ULSA 1EUNA 3Q10A 3HK2A 3IPYA 3D0QA 4H7PA 4XH9B 3FYSA 4LBUA 5EUMA 3B6IA 2P9JA 3HMQA 1XYCA 3EKLA 3RJTA 1N2EA 5J40A 4S1VA 4RCZA 4OQMA 4XJXA 2CZQA 1EVYA 4PRKA 4Z8XA 2GEBA 1BPLB 5FSEC 1JG2A 3FLUA 3M0ZA 1OHLA 3MGAA 3QU4A 1WSDA 5F2LA 1RBQA 4QXMA 2H7XA 4BNKA 1NW8A 1I4OA 2QQ6A 3FKSA 1ZLXA 3IESA 3D2AA 2XGOA 4MR8A 4ARSA 2P5TB 4AF8A 1RJEA 5XINA 4RJLA 1MRAA 3GRIA 5D2VA 3MUCA 4YAJA 3T44A 2WG0A 3DEQA 4DC1A 1AZTA 1ODTC 3I9MA 1UR9A 3KCJA 1SZFA 1C8XA 4PLVA 1Z6GA 1C9JA 3DVQX 2JKAA 2C94A 4G7EA 3CRVA 3T3OA 1VGAA 4M19A 2ANBA 1U5AA 1OB2A 4Q32A 1TKRA 1M2WA 4U6QA 3BL6A 3SCQA 4DJEC 3SG0A 4URXR 3ZYZA 2ZADA 4P32A 1QNPA 3PVFA 4TL8A 1G1YA 1JTEA 3LK7A 2FDSA 4JIHA 2W43A 3M0HA 5BXTA 2W6MA 4N4QA 2EFDB 3S42A 1SCKA 1KNXA 1TFRA 1Z45A 2GMWA 1VM6A 5K3AA 2IOYA 3IUYA 3KUXA 4FSAA 1M1NB 4OK6A 3IRDA 2OYRA 5L6UA 1DP4A 3CSUA 4UFMA 5B6JA 4C6MA 5EB8A 2YFYA 3N5KA 1CW2B 4XQ6A 3LXAA 4ZOEA 3E22B 1YRQA 3F90A 1HFWA 3OE7A 1QPBA 4KIJA 1Y6ZA 721PA 2GCPA 3ES7A 1TMHA 4YTRA 4B5NA 4WDXA 2HU8A 4GZJA 5K05A 3DOEA 1NE7A 1UM9A 3GSMA 3DF7A 4ZOLB 4EB8A 2CF5A 1EUAA 4B3XA 2IZ1A 2ZDSA 4E5DA 1I2PA 3D4OA 1KR1A 4LHYA 4W7UA 5E70A 1SVWA 1MF7A 5DPMA 5CCBA 1BMQA 1E2PA 3WGIA 4DR1B 4US0R 1LXCA 2QJWA 1LT8A 2HWYA 3QY9A 4HSHA 1E43A 4EKEA 4OQDA 5SICE 3UH1A 2Z5VA 1I7DA 1OFVA 3KU1A 3EXTA 4DPPA 2FG7C 4EKDA 4U2DA 1CRPA 3LI2A 3IKVA 2A3AA 3OFSA 4WJEA 2E40A 2FY8A 3B51X 3JWPA 4KQ2A 5T4BA 1KEPA 2BEJA 3CK5A 3UXAA 2P9YA 4C04A 3O63A 1TT5A 3ESDA 2GCOA 2PDGA 4ME6A 2E6YA 2PMBA 4XXHA 2MJLA 2O3QA 5A2CA 2WHQA 5CEEA 1F9AA 2POQX 1I3OA 4ZYZA 2C61A 3H5OA 3CEHA 4GUHA 5JH7F 1VH7A 1OXXK 4GBUA 4C2TA 2NZ8A 4FI4A 5LN1A 1JDNA 1K7FA 1CZHA 2JCSA 1RMTA 1VJTA 4MR9A 1OT1A 3WMGA 4YO7A 4I5XA 3DBHA 1ZMRA 4RVGA 4EYEA 2J9RA 4W7VA 3W1RA 1P2VA 3RVSA 4ZT4A 4IOKA 5C8XA 4D7AA 4PHFA 4Z4CA 4ZR8A 3GRVA 1TJYA 1JCTA 3IE2A 3AVWA 4ZJZA 2AR7A 1ZB5A 1CY4A 4QE3A 2CFFA 1C0KA 2ANCA 4EFLA 4BKOA 2QZRA 2DR0A 4QX6A 3O7WA 1Y4AE 3Q67A 4XVRA 6TIMA 2QJFA 5GJNA 4CV3A 5F4ZA 5AFDA 2VPZA 3VR4D 4BJ3A 2X3FA 3K70B 3OETA 1EB8A 2VYCA 4OMFG 1K03A 1M6WA 3MGGA 2I6GA 2PFSA 4IH4A 2YNMA 3A58B 3KE8A 3F7JA 4YRBA 1XLKA 5LUBA 2CC0A 2YWHA 1W87A 1FCQA 4W5RA 3B3QA 2GDZA 5JFGA 1QV9A 1NY6A 1RLMA 2ZX5A 4QECA 1YDYA 4CQDA 4X2RA 2H4XA 4P1ZA 4H7ZA 3W7DA 1CETA 3CVWA 4TU1A 4D8ZA 3B2NA 3VHLB 3EDEA 3TXXA 1J0IA 3HDVA 5D09A 2DW7A 4C6OA 3E84A 3JQFA 2WZQA 2R6DA 4KGVA 1MIHA 3W23A 1T8RA 3RQSA 1DMSA 2Q1SA 4HN4A 2HDNB 2OKTA 1Z6ZA 3PFBA 4AY3A 5F2EA 4JOMA 1J24A 4JELA 2QVXX 3S1LA 1L7MA 1ATIA 3A0RB 2I3AA 2Q99A 4FA3A 3L1IA 2OD7A 2VZLA 4L4YA 1DC3A 6XIMA 5I8PA 1UJ6A 3LCWA 3MBFA 2G0NA 5AKGA 5K45A 4ZTXA 2KB0A 1NPTO 4DCVA 2ADOA 4HPJA 1Z4KA 5KETA 3VTKA 3VR4A 3ONCA 2RB5A 5BRQA 2CXGA 1KMQA 1ADBA 4C6IA 5U1PA 2O4UX 2D0FA 1X96A 5GGYA 1NOFA 4LJ6A 1G64A 2AH5A 2ZR8A 2PXHA 1NQ5A 1JR3E 2YHIA 5EPEA 3HFGA 1BJTA 4IIYA 1IYXA 3S5ZA 2WILA 1K6EA 2HQSA 2HEGA 2Q02A 3JYOA 4QPJC 1CJBA 4AMCA 1OB0A 1U5CA 4HWOA 3HN7A 4HGZA 4Z4GA 5F9MA 4TRRA 2OFXA 1KJZA 3DPSA 5AK5A 1Z5GA 5AESA 3WL7A 3H87A 4AJKA 4YIWA 5KX5F 3T7SA 3GZTB 8TIMA 3GDBA 4KC0A 3SC2B 4GACA 4R05A 4RVUA 1MIOB 3TFQA 4GQQA 1YQGA 1GQLA 1Z42A 1OYYA 3QKWA 2V9PA 1K7EA 1X7WA 4AUEA 1AO0A 4QOFA 3E74A 4XD3A 5J5RA 4DNPA 1U1IA 2KS6A 1Q1BA 4D3ZA 3I1YA 3LV6A 1SZNA 2JFNA 4JR2A 3H4MA 3QOWA 2OY0A 3P60A 1VPXA 1KTVA 2VJPA 1BVYF 2IQDA 4W1PA 1M34A 2ODWA 2Z28A 5IDVA 5L7TA 2C7FA 2ZC1A 3PFHA 1PV1A 2WAGA 3OFKA 1EWTA 3Q3EA 1EC8A 2GVEA 1KTIA 3ILSA 1E92A 3I4FA 4I0WB 1ULUA 2WSYB 2YZMA 3JQ8A 1RI2A 5D8DA 4K6CA 3OU8A 2JD1A 1VJSA 3G1WA 2Y88A 1N92A 4MMWA 2BY0A 1V2HE 2QIIA 5D3MB 1CLVA 4N5HX 2OK8A 1ZPDA 3HHPA 2WZHA 2VDUE 2A2IA 2WHLA 3V9PA 1EJVC 3TDMA 5HDQA 5FNZA 3VU0A 1U3FA 1Q7EA 5K8IA 1XJQA 3O7MA 3M34A 4YRFA 1Z7EA 5EJ8A 4UC0A 3BHMA 5A9SB 4HSEA 4JUDX 5BNFA 2FLIA 3VIGA 1JA1A 1JIBA 3SJAA 4UM8B 4CKWB 2QX4A 3R3YA 2X58A 1RQRA 1ITUA 2R8OA 4H01A 3A1EA 1XH2A 1HKVA 1GCUA 5LJLA 1VFNA 3JATB 1GL3A 3ZZMA 4EHKA 4M0XA 2FW9A 1TTHA 3DDNA 1J22A 2OSVA 1E7QA 1BOFA 4JC0A 2VQEB 1Q4WA 1RZUA 1G21E 4PULA 5BYKA 1XQWA 2QHXA 5IMBA 3SCSA 3TFXA 4J7AA 1H2FA 1YDHA 2CVHA 4CZ2A 1YVPA 5BSTA 4R1MA 4LEIA 4LG1A 1IEQA 4AD4A 1S2MA 4RTMA 5IDYA 4TTSA 2QRPA 1L8OA 5DN6A 1Q6EA 4BLQA 3EZNA 3G2OA 4ZI2A 1FX0A 3WGMA 2B6HA 3KBJA 4GISA 4GVFA 1MC8A 2AI2A 2G8NA 2EC5A 2J8TA 2O2SA 3LQLA 4MQFB 3Q11A 3SC3A 4ECEA 5E0FA 1U8FO 4LFBB 4ZD6A 2BCEA 1V16A 4EP1A 4OXKA 3A4MA 1UC4B 3UJ2A 4IOLA 3B40A 1Y48E 2BEWA 2G96A 3NH9A 2J77A 4O1CA 1CS0B 3PJRA 2NU8B 4HJWA 4LY8A 3SMQA 3PFMA 2VNJA 2WC7A 3JRKA 3ET5A 3SQDA 3C5VA 4J9JA 4ZXOA 3DE1X 1QFEA 4HNAB 3KZXA 2PDNA 3G2LA 2J9YB 3FNDA 4ZMBA 1VTKA 1RCQA 2UUPA 3B9PA 5JNRA 4X7MA 3UJSA 4F0RA 3B38A 1S5PA 5H3HA 4RVDA 1DWGM 1P7PA 3L04A 4I1IA 2YBVA 2XMBA 3FS2A 4REQA 2J7DA 5HA5A 1I9GA 4RPLA 3NC4A 5JYBA 3F9CA 1DHRA 4I81A 4NJEB 3C8UA 4YAWA 4UNQA 3KFLA 1AKEA 3W3AA 4U7HA 1Q15A 5J58A 3Q94A 1P60A 1E8DA 2NSHA 1MZRA 1P33A 1YBQA 4Z1OA 5AYYA 1PX2A 4K6AA 4KFPA 2XZ7A 3Q37A 3UM9A 3MP3A 3SRKA 5IJ9A 2V96A 2VDOB 3WC4A 4NYUA 4DBEA 3BGWA 5HSGA 5E09A 2B7BA 4PC7A 4EVQA 3PUKA 4O1DA 5HBRA 1TIKA 2ENUA 5ANRB 4EA6A 1QI0A 4DC0A 4A4DA 2ISWA 4GGBA 3ZI7A 4BFSA 4DYVA 1XINA 2X0EA 1J7JA 1JP7A 2EFYA 4UFPA 4PPFA 4FDVA 1TMGE 4Z5XA 4K9OA 1BVNP 4K81B 2W00A 1UQUA 1H3GA 4NBLA 1Q11A 1DXHA 3IPXA 2IW3A 4ANFA 5ELXA 4BNDA 2D0GA 4Q9KA 3N75A 1H50A 2XGMA 2OV1A 2QD5A 4P7NA 2RE8A 2PH1A 4F4JA 2GGJA 3WUEA 1UMDB 4EI2A 1OY0A 3RJ9A 1ID1A 2NMVA 4QJ1A 1YJAA 1ZCOA 1YE8A 1JALA 5LOVA 1N8NA 4NYIR 1GPJA 1XZPA 1VRWA 3K8KA 4B6SA 4OOUA 1M2HA 3ZOKA 1O97C 1BE0A 4M83A 5AECA 4RHXA 3LLVA 2V9ZA 5FRDA 2HLDD 2WY2D 4OOFA 3E22A 5JE8A 1RXYA 4O6VA 5FJIA 3UG4A 2E37A 4JCLA 2AJBA 3NHPA 4XIFA 2OCXA 2QDKA 3CMCO 5JVDB 2O20A 1SVUA 4HMQA 7MHTA 3FKRA 1ABEA 1NV9A 5C8YA 3K6RA 3KTCA 2LKCA 1D5CA 1H2RS 2CHGA 2A9JA 4P7LA 1Y4UA 1O57A 3VKVA 3UUWA 2HHJA 1CQXA 3RK0A 3QVMA 4Y6PA 5C7VA 3VFLA 3NXSA 2OGZA 4MNKA 1T9GS 2HRCA 3SZGA 3N2KB 3E0FA 4HWGA 4AJLA 4IQLA 4EJSA 2EP5A 3UJCA 2Z6UA 3JYNA 1KXVA 2YA2A 2VC9A 2C92A 4GH1A 1YE6A 3B1ZA 4J2HA 1SMAA 3UWYA 3PLNA 3THQA 4D2JA 2GJKA 3WV5A 3BFKA 5HWNA 3RSGA 5HZHA 3W2LA 1X87A 5F64A 5IUJC 5AJZA 2Y71A 1PGNA 1YOVA 3RADC 1FH7A 1SBQA 4REQB 3G68A 1OWQA 4W88A 4PXSA 1GOWA 5L4LA 1NVTA 3JS5A 2J0UB 4LQDA 1Q6RA 1J2BA 1GRVA 1D2GA 5DLDA 3BL8A 2P1ZA 4ZGYA 1OLUA 2Z3WA 4R41A 4XX0A 4HNOA 2CBUA 1WZUA 2YRWA 5FLKA 1SXGA 5DHTA 2JH9A 2CUTA 4PLPA 5DRTA 4BP3A 1HXJA 2B78A 4P2BA 1EKOA 3V4VB 2EF0A 1KSGA 3OA5A 1N7GA 1EJ7L 2PX4A 3MUNA 2WW5A 2GHRA 3KE9A 1KYYA 4KE6A 3ONDA 3MXOA 1BGWA 1OA1A 5FH9A 3JALB 4EK9A 4UUQA 2R2GA 4XGKA 1DJOA 3T38A 3KUDA 3S2LA 3IDZA 2DG2A 5CEWA 2A88A 1AUVA 2BWGA 2EPNA 3TOXA 3LXUX 2J5BA 3R20A 1GUBA 3GDGA 4CTMA 4GQBA 4GLOA 1Z17A 3ZV4A 2PWDA 3LU1A 2VDJA 3VI2A 3HV2A 2KM1A 5IUNC 2W2LA 2GM3A 4BE4A 3GQYA 1M7XA 1BQ4A 2EQ5A 4EPXA 2W8ZA 3EEQA 2YOFA 2BLEA 1XLHA 3E7XA 1GLVA 2IZ7A 3CL7A 4FGKA 3OEXA 1OG6A 1XL1A 3OZGA 4WW0A 2BHYA 4LH8A 1JEYB 3MYYA 1RJFA 5KCMA 3K4QA 3L1HA 4Z7NB 1ODJA 4L0QA 5I6SA 8ABPA 3U62A 2J13A 1EP1A 3H23A 1HWYA 1B90A 1A0EA 4MS3A 5CLHA 4BMYA 3IOYA 1ALDA 4FEYA 3JVIA 3AEKA 4M1ZA 4LS0A 2PLKA 4K6GA 2H92A 3ID7A 4RVHA 1VFHA 1XA4A 4YP7A 1XZDA 4PCLA 1TA9A 5JRJA 1KO0A 4ZRNA 4RJTA 3A4WA 1FWDC 4GXPA 2B4AA 1ILEA 3W2HA 2Y1WA 3RSZA 3A31A 4G1FA 4OLAA 3DT8A 1ZONA 3GQVA 3KVLA 3EWUA 3UK2A 3JD4A 1F8MA 3DB1A 5JJLA 2HRWA 4MWBA 1YR8A 5KQPA 4BMSA 4Z7QB 1GFWA 3E9QA 2JCVA 3M33A 2WUFA 1R3WA 4XD6A 2O8DA 4QDZA 3TC3A 4PU0A 2J46A 4JIMA 1IXYA 3WGGA 1T5DX 4PS1A 4UQPA 3MILA 3Q3CA 1QMGA 3U1BA 3QGKC 3RITA 3M81A 1MEIA 1RLOA 3DDCA 1UKZA 4BVKA 4HK6A 1K9EA 2NPFA 4DDKA 4DZTA 4KCWA 1ODKA 1B9BA 1EYEA 5JXWA 1E6LA 1AA1B 2B92A 4AO6A 4O4LF 1WKEA 3B8UA 1Q20A 4C6CA 2JAQA 1ONEA 1V4BA 2JFGA 1H23A 1KBLA 3MWYW 1VEMA 4ZQPA 1L6YA 1DBTA 2G67A 3TSDA 4Y30A 4BO8A 1FW6A 1G2QA 4IDHA 2BDUA 3ITYA 2RH9B 3RK4A 2YBTA 2O8CB 1A2BA 2EQDA 3F6SA 2V5KA 3HXOA 2QV0A 4UDNA 4YUZA 5AVRA 2BGUA 4H7IA 1JYVA 3PNQA 2QZ9A 4N7JA 1I7QB 5C6MA 5B58T 2Q1TA 1XA3A 1OWLA 1Y8RA 2EZTA 1O2DA 4XUGB 4DJED 2C4MA 1XI2A 1RWWA 4CG2A 1GPUA 5U9CA 5GM1A 1KO1A 1VHCA 3C3NA 1AQ6A 5DK6A 3R74A 4GXQA 4MZYA 2Y3IA 4Z7OB 1I2MA 5LXTA 1TZJA 2FEPA 4BN5A 3NG1A 3I45A 3LENA 2RAVA 4ZOBA 4MQLA 1J2JA 3BIOA 1I75A 2WJIA 1PT6A 2A0YA 3KS6A 3OCXA 1Z34A 2W63A 3VDAA 3MFYA 2VX6A 1QLHA 1EBGA 4YQZA 3VQTA 3F74A 1VRXA 1ZBQA 3DECA 4KWWA 1M0SA 3T1VA 1RI4A 3UJ6A 4PYMA 4J94A 4EL5A 4A91A 3MTWA 1Q8AA 1AZLA 1P9WA 1G17A 3WICA 2WLZA 1NT4A 5IVDA 4O19A 2HNBA 3DLCA 3DKPA 1OIXA 1XKQA 5EZSA 1GHTA 4B4OA 2M6KA 2QVCA 4OXXA 1F3WA 2W2KB 2XQJA 1GN8A 3RJXA 4ENSA 1M74A 1ZSYA 4WOBA 3FJYA