5ENJA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with compound-14 n11530 (sgc - diamond i04-1 fragment screening)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
molecule keywords PH-interacting protein
molecule tags Signaling protein
source organism Homo sapiens
total genus 46
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5enjA00
3HMHA 4TU4A 3D7CA 5LKXA 4CL9A 3P1FA 5D3RA 5CP5A 5FDZA 4PS5A 5EWCA 3AQAA 4QSTA 4HBWA 4UYFB 5E9IA 5CRMA 5K29A 2R0YA 5KHMA 2DVRA 4CUQA 5F61A 5CY9A 4CUUA 3UVWA 4YYGA 5ETDA 5L99A 5DW2A 5C85A 5FE3A 5ENBA 4ALGA 5ENFA 3UW9A 5EWHA 2H60A 5F63A 4MEOA 4QNSA 5I40A 5KTUA 5EPBA 4HXLA 5DKHA 5FFYA 5DY7A 2R0VA 5FE8A 4TZ2A 5F5ZA 3LQJA 2YEKA 3DWYA 3UVDA 5CUEA 4YABA 4A9HA 4LZSA 4X2IA 5C7NA 5LUUA 4YY4A 2GRCA 2OSSA 4QR5A 5D25A 5C89A 3HMEA 4F3IA 4QY4A 3U5MA 4C66A 4HBVA 5G4SA 5I29A 5IBNA 4YATA 4CLBA 5FE4A 2DKWA 3MQMA 4WIVA 5ENGA 5TB6A 4NUDA 5CFWA 3NXBA 4XY8A 5FE9A 5LJ0A 1WUMA 4BHWA 1F68A 5EK9A 1EQFA 3MXFA 4UYHA 5KTXA 5CU8A 2DVQA 4UIUA 4O78A 4MEQA 3SVFA 4O7BA 5IG6A 5CQ4A 1JM4B 4UIXA 4A9FA 4TT4A 5J0DA 5IIDA 4NQNA 5L97A 5CTLA 4IORA 4QR3A 4QSUA 5H1VA 5F36A 2RO1A 5E3DA 2E3KA 5DFBA 4LZ2A 4RVRA 5D3PA 4A9NA 4TYLA 3MUKA 5ETBA 5HJCA 4HXOA 3SVGA 4C67A 5E9MA 5L98A 4IR3A 5ENEA 4CFKA 4A9JA 3AADA 4NR9A 5EWDA 3UV2A 3IU6A 5AMFA 5FE2A 5I83A 4N4FA 5D3NA 4KV1A 4QSRA 4UYGA 3U5NA 4LZRA 5I80A 5EU1A 4O71A 4A9EA 5DX4A 5EVAA 4NR4A 4UYFA 4QR4A 4GPJA 4O77A 4CUTA 3SVHA 5E9YA 5HFRA 5E3GA 4HBXA 4LRGA 4KCXA 5A7CA 2R0SA 5CQ8A 5EP7A 5IGMA 5E7DA 4O7CA 3LQIA 3O33A 3Q2EA 2YDWA 4NR5A 5DW1A 4UIWA 4QEWA 5LVQA 4HBYA 4NUEA 5C87A 4MR5A 2R10A 3TLPA 4MR4A 4CUPA 4QSVA 5CQ3A 2G4AA 4HXMA 4UYDA 4UYEA 3QZVA 2DWWA 4UIYA 5I7XA 4J1PA 4YC9A 4LYWA 5IGKA 5F3AA 5JI8A 3U5OA 4LYSA 3O36A 4YYHA 5D3HA 5CGPA 5I88A 2E7OA 5F2PA 4QEVA 4YH3A 3S91A 4XUAA 4YADA 4OGJA 4FLPA 2F6NA 5F25A 4YBSA 5DYAA 5C8GA 5I1QA 5FE1A 4O70A 5EV9A 4DONA 4TT6A 5A5PA 2RNWA 4MEPA 4YH4A 5A5NA 2MJVB 4HXRA 1X0JA 5ENHA 2WP1A 4NR7A 5I7YA 4N4GA 5FE5A 4Y03A 5ACYA 5DYXA 4TQNA 2D9EA 5A83A 5II2A 4NYXA 2LSPB 3LQHA 5FB1A 5CUCA 2F6JA 5D3TA 4BW1A 4A9IA 4HXSA 4LR6A 4QC1A 4AKNA 2NXBA 4IR4A 4WHUA 5L8TA 5CRZA 3U5LA 3LXJA 4YYKA 5D3SA 4BW3A 4YY6A 4A9KA 4O7EA 4QZSA 5FH6A 5HM0A 5EI4A 5A5OA 5E9KA 5LVRA 5HLSA 4XUBA 5EPSA 4YBMA 5CQ6A 5HENA 4IR6A 2D82A 2YW5A 5CQTA 4IOQA 5ENCA 4HXNA 5D3LA 4OUFA 2RS9B 3DAIA 2FSAA 5D3JA 4YYMA 4ZQLA 5H1UA 3K2JA 3UV4A 2RFJA 3G0LA 5H85A 4PTBA 4Q0NA 5HQ7A 3S92A 5BT4A 4TZ8A 5F1LA 5H1TA 5EQ1A 4NYVA 4J0RA 4TS8A 5EICA 4J3IA 5IGNA 5F1HA 4XY9A 2I7KA 5FG6A 3G0JA 4NXJA 5FB0A 5HCLA 2E7NA 2DVVA 3O35A 5FFVA 5FE0A 4QSPA 5CUDA 4QBMA 5D24A 5A5QA 3U5PA 4UITA 5DBMA 5DKDA 4O7FA 4YYIA 5HEMA 4HXPA 3IU5A 4WHWA 3UV5A 4YYJA 5HQ6A 5L8UA 5A82A 4TT2A 4OGIA 3U5KA 4LDFA 5D0CA 3MULA 4Z6HA 5DYUA 5BT5A 4O75A 5EISA 5HFQA 5A5RA 4NR8A 4Z6IA 5HRWA 4BJXA 4QYLA 5E74A 4Q0OA 4QSXA 5A81A 5FE6A 5JWMA 4QSQA 4TTEA 4A9MA 2KTBB 2RNYA 5AD2A 5C4QA 4QSSA 5FH8A 3QZTA 4CFLA 4Z93A 3O34A 4O74A 5DLZA 4QB3A 4MENA 5DLXA 4PKLA 3MB3A 2L5EA 4LC2A 4QC3A 4QUUA 3FKMX 2L85A 5AMEA 5DYCA 4A9OA 5EM3A 3P1DA 3ONIA 3GG3A 5D7XA 3UVXA 2DATA 4QSWA 2YYNA 5CUAA 4YYNA 4ZW1A 5G4RA 5FG4A 4MR6A 3ZYUA 4YBTA 3P1CA 2RI7A 4MR3A 5ENJA 5KO4A 5E9VA 2N9GA 4PY6A 4NQMA 2L84A 5CQ5A 4NRAA 4YK0A 5AD3A 4NRCA 3JVJA 5HRXA 5F62A 5TCMA 3P1EA 5CUBA 5EPRA 3P5OA 5LKZA 3JVKA 5E0RA 3JVMA 5A85A 2I8NA 4N3WA 4UIZA 5CS8A 4O7AA 4NUCA 2YELA 4J0SA 3O37A 5DFCA 4IOOA 4QUTA 5HELA 4N4IA 5CQAA 5E73A 4O76A 3MB4A 4YAXA 4Z1SA 2WP2A 5KTWA 5EGUA 4UIVA 5BT3A 4CURA 2YEMA 5CPEA 3LJWA 5HQ5A 5D26A 5CQ7A 4PCEA 5CUGA 4E96A 5EA1A 3UVYA 2YQDA 3QZSA 5L96A 2RNXA 4NR6A 4BW2A 3I3JA 5FBXA 5HRVA 5COIA 1N72A 4ALHA 3JVLA 1WUGA 1E6IA 3Q2FA 2OUOA 5II1A 2DVSA 5LJ2A 4NS5A 5ENIA 5F60A 4A9LA 5I86A 4KV4A 5E9LA 5FG5A 5DFDA 4QEUA 4LYIA 4NYWA 4NRBA 4PCIA 5LJ1A 5LKTA 5IGLA 4ZC9A 5EWWA 4CUSA 2OO1A 3RCWA 3U5JA 4HXKA 4QYDA 1JSPB 4IR5A 5FH7A 4Z1QA 5A5SA 4TU6A 5EWVA 4BW4A 4YYDA 4O72A 5FE7A 5KU3A 4N4HA 3HMFA 5CZGA 5FFWA 5DKCA 1ZS5A 5LKUA 4XYAA 5I89A
chains in the Genus database with same CATH superfamily
3HMHA 4TU4A 3D7CA 5LKXA 4CL9A 3P1FA 5D3RA 5CP5A 5FDZA 4PS5A 5EWCA 3VKGA 3AQAA 4QSTA 4HBWA 4UYFB 5E9IA 5CRMA 5K29A 2R0YA 5KHMA 2DVRA 4CUQA 5F61A 5CY9A 4CUUA 3UVWA 4YYGA 5ETDA 5L99A 5DW2A 5C85A 5FE3A 5ENBA 4ALGA 5ENFA 3UW9A 5EWHA 2H60A 5F63A 4MEOA 4QNSA 5I40A 5KTUA 5EPBA 4HXLA 5DKHA 5FFYA 5DY7A 2R0VA 5FE8A 4TZ2A 5F5ZA 3LQJA 2YEKA 3DWYA 3UVDA 5CUEA 4YABA 4A9HA 4LZSA 4X2IA 5C7NA 5LUUA 4YY4A 2GRCA 2OSSA 4QR5A 5D25A 5C89A 3HMEA 4F3IA 4QY4A 3U5MA 4C66A 4HBVA 5G4SA 4AI6A 5I29A 5IBNA 4YATA 4CLBA 5FE4A 2DKWA 3MQMA 4WIVA 5ENGA 5TB6A 4NUDA 5CFWA 3NXBA 4XY8A 5FE9A 5LJ0A 1WUMA 4BHWA 1F68A 5EK9A 1EQFA 3MXFA 4UYHA 5KTXA 5CU8A 2DVQA 4UIUA 4O78A 4MEQA 3SVFA 4O7BA 5IG6A 5CQ4A 1JM4B 4UIXA 4A9FA 4TT4A 5J0DA 5IIDA 4NQNA 5L97A 5CTLA 4IORA 4QR3A 4QSUA 5H1VA 5F36A 2RO1A 5E3DA 2E3KA 5DFBA 4LZ2A 4RVRA 5D3PA 4A9NA 4TYLA 3MUKA 5ETBA 5HJCA 4HXOA 3SVGA 4C67A 5E9MA 5L98A 4IR3A 5ENEA 4CFKA 4A9JA 3AADA 4NR9A 5EWDA 3UV2A 3IU6A 5AMFA 5FE2A 5I83A 4N4FA 5D3NA 4KV1A 4QSRA 4UYGA 3U5NA 4AKGA 4LZRA 5I80A 5EU1A 4O71A 4A9EA 5DX4A 5EVAA 4NR4A 4UYFA 4QR4A 4GPJA 4O77A 4CUTA 3SVHA 5E9YA 5HFRA 5E3GA 4HBXA 4LRGA 4KCXA 5A7CA 2R0SA 5CQ8A 5EP7A 5IGMA 5E7DA 4O7CA 3LQIA 3O33A 3Q2EA 2YDWA 1PUOA 4NR5A 5DW1A 4UIWA 4QEWA 5LVQA 4HBYA 4NUEA 5C87A 4MR5A 2R10A 3D1DA 3TLPA 4MR4A 4CUPA 4QSVA 5CQ3A 2G4AA 4HXMA 4UYDA 4UYEA 3QZVA 2DWWA 4UIYA 5I7XA 4J1PA 4YC9A 4LYWA 5IGKA 5F3AA 5JI8A 3U5OA 4LYSA 3O36A 4YYHA 5D3HA 5CGPA 5I88A 2E7OA 5F2PA 4QEVA 4YH3A 3S91A 4XUAA 4YADA 4OGJA 4FLPA 2F6NA 5F25A 4YBSA 5DYAA 5C8GA 5I1QA 5FE1A 4O70A 5EV9A 4DONA 4TT6A 5A5PA 2RNWA 4MEPA 4YH4A 5A5NA 2MJVB 4HXRA 1X0JA 5ENHA 2WP1A 4NR7A 5I7YA 4N4GA 5FE5A 4Y03A 5ACYA 5DYXA 4TQNA 2D9EA 5A83A 5II2A 4NYXA 2LSPB 3LQHA 5FB1A 5CUCA 2F6JA 5D3TA 4BW1A 3D1BA 4HXSA 4LR6A 4A9IA 4QC1A 3ERRA 3VKHA 4AKNA 2NXBA 4IR4A 4WHUA 5L8TA 5CRZA 3U5LA 3LXJA 4YYKA 5D3SA 4BW3A 4YY6A 4A9KA 4O7EA 4QZSA 5FH6A 5HM0A 5EI4A 5A5OA 5E9KA 5LVRA 5HLSA 4XUBA 5EPSA 4YBMA 5CQ6A 5HENA 4IR6A 2D82A 2YW5A 5CQTA 4IOQA 5ENCA 4HXNA 5D3LA 4OUFA 2RS9B 3DAIA 2FSAA 5D3JA 4YYMA 4ZQLA 5H1UA 3K2JA 3UV4A 2RFJA 3G0LA 5H85A 4PTBA 4Q0NA 5HQ7A 3S92A 5BT4A 4TZ8A 5F1LA 5H1TA 5EQ1A 4NYVA 4J0RA 4TS8A 5EICA 4J3IA 5IGNA 5F1HA 4XY9A 2I7KA 5FG6A 3G0JA 4NXJA 5FB0A 5HCLA 2E7NA 2DVVA 3O35A 5FFVA 5FE0A 4QSPA 1ZKRA 5CUDA 4QBMA 5D24A 5A5QA 3U5PA 4UITA 5DBMA 5DKDA 4O7FA 4YYIA 5HEMA 4HXPA 3IU5A 4WHWA 3UV5A 4YYJA 5HQ6A 5L8UA 5A82A 4TT2A 4OGIA 3U5KA 4LDFA 5D0CA 3MULA 4Z6HA 5DYUA 5BT5A 4O75A 5EISA 5HFQA 5A5RA 4NR8A 4Z6IA 5HRWA 4BJXA 4QYLA 5E74A 4Q0OA 4QSXA 5A81A 5FE6A 5JWMA 4QSQA 4TTEA 4A9MA 2KTBB 2RNYA 5AD2A 5C4QA 4QSSA 5FH8A 3QZTA 4CFLA 4Z93A 3O34A 4O74A 5DLZA 4QB3A 4MENA 5DLXA 4PKLA 3MB3A 2L5EA 4LC2A 4QC3A 4QUUA 3FKMX 2L85A 5AMEA 5DYCA 4A9OA 5EM3A 3P1DA 3ONIA 3GG3A 5D7XA 3UVXA 2DATA 4QSWA 2YYNA 5CUAA 4YYNA 4ZW1A 5G4RA 5FG4A 4MR6A 3ZYUA 4YBTA 3P1CA 2RI7A 4MR3A 5ENJA 5KO4A 5E9VA 2N9GA 4PY6A 4NQMA 2L84A 5CQ5A 4NRAA 4YK0A 5AD3A 4NRCA 3JVJA 5HRXA 5F62A 5TCMA 3P1EA 5CUBA 5EPRA 3P5OA 5LKZA 3JVKA 5E0RA 3JVMA 5A85A 2I8NA 4N3WA 4UIZA 5CS8A 4AKHA 4O7AA 4NUCA 4AKIA 2YELA 4J0SA 3O37A 5DFCA 4IOOA 4QUTA 5HELA 4N4IA 5CQAA 5E73A 4O76A 3MB4A 4YAXA 4Z1SA 2WP2A 5KTWA 5EGUA 4UIVA 5BT3A 4CURA 2YEMA 5CPEA 3LJWA 5HQ5A 5D26A 5CQ7A 4PCEA 5CUGA 4E96A 5EA1A 3UVYA 2YQDA 3QZSA 5L96A 2RNXA 4NR6A 4BW2A 3I3JA 5FBXA 5HRVA 5COIA 1N72A 4ALHA 3JVLA 1WUGA 1E6IA 3Q2FA 2OUOA 5II1A 2DVSA 5LJ2A 4NS5A 5ENIA 5F60A 4A9LA 5I86A 4KV4A 5E9LA 5FG5A 5DFDA 4QEUA 4LYIA 4NYWA 2EJNA 4NRBA 4PCIA 5LJ1A 5LKTA 5IGLA 4ZC9A 5EWWA 4CUSA 2OO1A 3RCWA 3U5JA 4HXKA 4QYDA 1JSPB 4IR5A 5FH7A 4Z1QA 5A5SA 4TU6A 5EWVA 4BW4A 4YYDA 4O72A 5FE7A 5KU3A 4N4HA 3HMFA 5CZGA 5FFWA 5DKCA 1ZS5A 5LKUA 4XYAA 5I89A
chains in the Genus database with same CATH topology
3HMHA 4TU4A 3D7CA 5LKXA 4CL9A 3P1FA 5D3RA 5CP5A 5FDZA 4PS5A 5EWCA 3AQAA 4QSTA 4HBWA 4UYFB 5E9IA 5CRMA 5K29A 2R0YA 5KHMA 2DVRA 4CUQA 5F61A 5CY9A 4CUUA 3UVWA 4YYGA 5ETDA 5L99A 5DW2A 5C85A 5FE3A 5ENBA 4ALGA 5ENFA 3UW9A 5EWHA 2H60A 5F63A 4MEOA 4QNSA 5I40A 5KTUA 5EPBA 4HXLA 5DKHA 5FFYA 5DY7A 2R0VA 5FE8A 4TZ2A 5F5ZA 3LQJA 2YEKA 3DWYA 3UVDA 5CUEA 4YABA 4A9HA 4LZSA 4X2IA 5C7NA 5LUUA 4YY4A 2GRCA 2OSSA 4QR5A 5D25A 5C89A 3HMEA 4F3IA 4QY4A 3U5MA 4C66A 4HBVA 5G4SA 5I29A 5IBNA 4YATA 4CLBA 5FE4A 2DKWA 3MQMA 4WIVA 5ENGA 5TB6A 4NUDA 5CFWA 3NXBA 4XY8A 5FE9A 5LJ0A 1WUMA 4BHWA 1F68A 5EK9A 1EQFA 3MXFA 4UYHA 5KTXA 5CU8A 2DVQA 4UIUA 4O78A 4MEQA 3SVFA 4O7BA 5IG6A 5CQ4A 1JM4B 4UIXA 4A9FA 4TT4A 5J0DA 5IIDA 4NQNA 5L97A 5CTLA 4IORA 4QR3A 4QSUA 5H1VA 5F36A 2RO1A 5E3DA 2E3KA 5DFBA 4LZ2A 4RVRA 5D3PA 4A9NA 4TYLA 3MUKA 5ETBA 5HJCA 4HXOA 3SVGA 4C67A 5E9MA 5L98A 4IR3A 5ENEA 4CFKA 4A9JA 3AADA 4NR9A 5EWDA 3UV2A 3IU6A 5AMFA 5FE2A 5I83A 4N4FA 5D3NA 4KV1A 4QSRA 4UYGA 3U5NA 4LZRA 5I80A 5EU1A 4O71A 4A9EA 5DX4A 5EVAA 4NR4A 4UYFA 4QR4A 4GPJA 4O77A 4CUTA 3SVHA 5E9YA 5HFRA 5E3GA 4HBXA 4LRGA 4KCXA 5A7CA 2R0SA 5CQ8A 5EP7A 5IGMA 5E7DA 4O7CA 3LQIA 3O33A 3Q2EA 2YDWA 4NR5A 5DW1A 4UIWA 4QEWA 5LVQA 4HBYA 4NUEA 5C87A 4MR5A 2R10A 3TLPA 4MR4A 4CUPA 4QSVA 5CQ3A 2G4AA 4HXMA 4UYDA 4UYEA 3QZVA 2DWWA 4UIYA 5I7XA 4J1PA 4YC9A 4LYWA 5IGKA 5F3AA 5JI8A 3U5OA 4LYSA 3O36A 4YYHA 5D3HA 5CGPA 5I88A 2E7OA 5F2PA 4QEVA 4YH3A 3S91A 4XUAA 4YADA 4OGJA 4FLPA 2F6NA 5F25A 4YBSA 5DYAA 5C8GA 5I1QA 5FE1A 4O70A 5EV9A 4DONA 4TT6A 5A5PA 2RNWA 4MEPA 4YH4A 5A5NA 2MJVB 4HXRA 1X0JA 5ENHA 2WP1A 4NR7A 5I7YA 4N4GA 5FE5A 4Y03A 5ACYA 5DYXA 4TQNA 2D9EA 5A83A 5II2A 4NYXA 2LSPB 3LQHA 5FB1A 5CUCA 2F6JA 5D3TA 4BW1A 4A9IA 4HXSA 4LR6A 4QC1A 4AKNA 2NXBA 4IR4A 4WHUA 5L8TA 5CRZA 3U5LA 3LXJA 4YYKA 5D3SA 4BW3A 4YY6A 4A9KA 4O7EA 4QZSA 5FH6A 5HM0A 5EI4A 5A5OA 5E9KA 5LVRA 5HLSA 4XUBA 5EPSA 4YBMA 5CQ6A 5HENA 4IR6A 2D82A 2YW5A 5CQTA 4IOQA 5ENCA 4HXNA 5D3LA 4OUFA 2RS9B 3DAIA 2FSAA 5D3JA 4YYMA 4ZQLA 5H1UA 3K2JA 3UV4A 2RFJA 3G0LA 5H85A 4PTBA 4Q0NA 5HQ7A 3S92A 5BT4A 4TZ8A 5F1LA 5H1TA 5EQ1A 4NYVA 4J0RA 4TS8A 5EICA 4J3IA 5IGNA 5F1HA 4XY9A 2I7KA 5FG6A 3G0JA 4NXJA 5FB0A 5HCLA 2E7NA 2DVVA 3O35A 5FFVA 5FE0A 4QSPA 5CUDA 4QBMA 5D24A 5A5QA 3U5PA 4UITA 5DBMA 5DKDA 4O7FA 4YYIA 5HEMA 4HXPA 3IU5A 4WHWA 3UV5A 4YYJA 5HQ6A 5L8UA 5A82A 4TT2A 4OGIA 3U5KA 4LDFA 5D0CA 3MULA 4Z6HA 5DYUA 5BT5A 4O75A 5EISA 5HFQA 5A5RA 4NR8A 4Z6IA 5HRWA 4BJXA 4QYLA 5E74A 4Q0OA 4QSXA 5A81A 5FE6A 5JWMA 4QSQA 4TTEA 4A9MA 2KTBB 2RNYA 5AD2A 5C4QA 4QSSA 5FH8A 3QZTA 4CFLA 4Z93A 3O34A 4O74A 5DLZA 4QB3A 4MENA 5DLXA 4PKLA 3MB3A 2L5EA 4LC2A 4QC3A 4QUUA 3FKMX 2L85A 5AMEA 5DYCA 4A9OA 5EM3A 3P1DA 3ONIA 3GG3A 5D7XA 3UVXA 2DATA 4QSWA 2YYNA 5CUAA 4YYNA 4ZW1A 5G4RA 5FG4A 4MR6A 3ZYUA 4YBTA 3P1CA 2RI7A 4MR3A 5ENJA 5KO4A 5E9VA 2N9GA 4PY6A 4NQMA 2L84A 5CQ5A 4NRAA 4YK0A 5AD3A 4NRCA 3JVJA 5HRXA 5F62A 5TCMA 3P1EA 5CUBA 5EPRA 3P5OA 5LKZA 3JVKA 5E0RA 3JVMA 5A85A 2I8NA 4N3WA 4UIZA 5CS8A 4O7AA 4NUCA 2YELA 4J0SA 3O37A 5DFCA 4IOOA 4QUTA 5HELA 4N4IA 5CQAA 5E73A 4O76A 3MB4A 4YAXA 4Z1SA 2WP2A 5KTWA 5EGUA 4UIVA 5BT3A 4CURA 2YEMA 5CPEA 3LJWA 5HQ5A 5D26A 5CQ7A 4PCEA 5CUGA 4E96A 5EA1A 3UVYA 2YQDA 3QZSA 5L96A 2RNXA 4NR6A 4BW2A 3I3JA 5FBXA 5HRVA 5COIA 1N72A 4ALHA 3JVLA 1WUGA 1E6IA 3Q2FA 2OUOA 5II1A 2DVSA 5LJ2A 4NS5A 5ENIA 5F60A 4A9LA 5I86A 4KV4A 5E9LA 5FG5A 5DFDA 4QEUA 4LYIA 4NYWA 4NRBA 4PCIA 5LJ1A 5LKTA 5IGLA 4ZC9A 5EWWA 4CUSA 2OO1A 3RCWA 3U5JA 4HXKA 4QYDA 1JSPB 4IR5A 5FH7A 4Z1QA 5A5SA 4TU6A 5EWVA 4BW4A 4YYDA 4O72A 5FE7A 5KU3A 4N4HA 3HMFA 5CZGA 5FFWA 5DKCA 1ZS5A 5LKUA 4XYAA 5I89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMH A;  4TU4 A;  3D7C A;  5LKX A;  4CL9 A;  3P1F A;  5D3R A;  5CP5 A;  5FDZ A;  4PS5 A;  5EWC A;  3AQA A;  4QST A;  4HBW A;  4UYF B;  5E9I A;  5CRM A;  5K29 A;  2R0Y A;  5KHM A;  2DVR A;  4CUQ A;  5F61 A;  5CY9 A;  4CUU A;  3UVW A;  4YYG A;  5ETD A;  5L99 A;  5DW2 A;  5C85 A;  5FE3 A;  5ENB A;  4ALG A;  5ENF A;  3UW9 A;  5EWH A;  2H60 A;  5F63 A;  4MEO A;  4QNS A;  5I40 A;  5KTU A;  5EPB A;  4HXL A;  5DKH A;  5FFY A;  5DY7 A;  2R0V A;  5FE8 A;  4TZ2 A;  5F5Z A;  3LQJ A;  2YEK A;  3DWY A;  3UVD A;  5CUE A;  4YAB A;  4A9H A;  4LZS A;  4X2I A;  5C7N A;  5LUU A;  4YY4 A;  2GRC A;  2OSS A;  4QR5 A;  5D25 A;  5C89 A;  3HME A;  4F3I A;  4QY4 A;  3U5M A;  4C66 A;  4HBV A;  5G4S A;  5I29 A;  5IBN A;  4YAT A;  4CLB A;  5FE4 A;  2DKW A;  3MQM A;  4WIV A;  5ENG A;  5TB6 A;  4NUD A;  5CFW A;  3NXB A;  4XY8 A;  5FE9 A;  5LJ0 A;  1WUM A;  4BHW A;  1F68 A;  5EK9 A;  1EQF A;  3MXF A;  4UYH A;  5KTX A;  5CU8 A;  2DVQ A;  4UIU A;  4O78 A;  4MEQ A;  3SVF A;  4O7B A;  5IG6 A;  5CQ4 A;  1JM4 B;  4UIX A;  4A9F A;  4TT4 A;  5J0D A;  5IID A;  4NQN A;  5L97 A;  5CTL A;  4IOR A;  4QR3 A;  4QSU A;  5H1V A;  5F36 A;  2RO1 A;  5E3D A;  2E3K A;  5DFB A;  4LZ2 A;  4RVR A;  5D3P A;  4A9N A;  4TYL A;  3MUK A;  5ETB A;  5HJC A;  4HXO A;  3SVG A;  4C67 A;  5E9M A;  5L98 A;  4IR3 A;  5ENE A;  4CFK A;  4A9J A;  3AAD A;  4NR9 A;  5EWD A;  3UV2 A;  3IU6 A;  5AMF A;  5FE2 A;  5I83 A;  4N4F A;  5D3N A;  4KV1 A;  4QSR A;  4UYG A;  3U5N A;  4LZR A;  5I80 A;  5EU1 A;  4O71 A;  4A9E A;  5DX4 A;  5EVA A;  4NR4 A;  4UYF A;  4QR4 A;  4GPJ A;  4O77 A;  4CUT A;  3SVH A;  5E9Y A;  5HFR A;  5E3G A;  4HBX A;  4LRG A;  4KCX A;  5A7C A;  2R0S A;  5CQ8 A;  5EP7 A;  5IGM A;  5E7D A;  4O7C A;  3LQI A;  3O33 A;  3Q2E A;  2YDW A;  4NR5 A;  5DW1 A;  4UIW A;  4QEW A;  5LVQ A;  4HBY A;  4NUE A;  5C87 A;  4MR5 A;  2R10 A;  3TLP A;  4MR4 A;  4CUP A;  4QSV A;  5CQ3 A;  2G4A A;  4HXM A;  4UYD A;  4UYE A;  3QZV A;  2DWW A;  4UIY A;  5I7X A;  4J1P A;  4YC9 A;  4LYW A;  5IGK A;  5F3A A;  5JI8 A;  3U5O A;  4LYS A;  3O36 A;  4YYH A;  5D3H A;  5CGP A;  5I88 A;  2E7O A;  5F2P A;  4QEV A;  4YH3 A;  3S91 A;  4XUA A;  4YAD A;  4OGJ A;  4FLP A;  2F6N A;  5F25 A;  4YBS A;  5DYA A;  5C8G A;  5I1Q A;  5FE1 A;  4O70 A;  5EV9 A;  4DON A;  4TT6 A;  5A5P A;  2RNW A;  4MEP A;  4YH4 A;  5A5N A;  2MJV B;  4HXR A;  1X0J A;  5ENH A;  2WP1 A;  4NR7 A;  5I7Y A;  4N4G A;  5FE5 A;  4Y03 A;  5ACY A;  5DYX A;  4TQN A;  2D9E A;  5A83 A;  5II2 A;  4NYX A;  2LSP B;  3LQH A;  5FB1 A;  5CUC A;  2F6J A;  5D3T A;  4BW1 A;  4A9I A;  4HXS A;  4LR6 A;  4QC1 A;  4AKN A;  2NXB A;  4IR4 A;  4WHU A;  5L8T A;  5CRZ A;  3U5L A;  3LXJ A;  4YYK A;  5D3S A;  4BW3 A;  4YY6 A;  4A9K A;  4O7E A;  4QZS A;  5FH6 A;  5HM0 A;  5EI4 A;  5A5O A;  5E9K A;  5LVR A;  5HLS A;  4XUB A;  5EPS A;  4YBM A;  5CQ6 A;  5HEN A;  4IR6 A;  2D82 A;  2YW5 A;  5CQT A;  4IOQ A;  5ENC A;  4HXN A;  5D3L A;  4OUF A;  2RS9 B;  3DAI A;  2FSA A;  5D3J A;  4YYM A;  4ZQL A;  5H1U A;  3K2J A;  3UV4 A;  2RFJ A;  3G0L A;  5H85 A;  4PTB A;  4Q0N A;  5HQ7 A;  3S92 A;  5BT4 A;  4TZ8 A;  5F1L A;  5H1T A;  5EQ1 A;  4NYV A;  4J0R A;  4TS8 A;  5EIC A;  4J3I A;  5IGN A;  5F1H A;  4XY9 A;  2I7K A;  5FG6 A;  3G0J A;  4NXJ A;  5FB0 A;  5HCL A;  2E7N A;  2DVV A;  3O35 A;  5FFV A;  5FE0 A;  4QSP A;  5CUD A;  4QBM A;  5D24 A;  5A5Q A;  3U5P A;  4UIT A;  5DBM A;  5DKD A;  4O7F A;  4YYI A;  5HEM A;  4HXP A;  3IU5 A;  4WHW A;  3UV5 A;  4YYJ A;  5HQ6 A;  5L8U A;  5A82 A;  4TT2 A;  4OGI A;  3U5K A;  4LDF A;  5D0C A;  3MUL A;  4Z6H A;  5DYU A;  5BT5 A;  4O75 A;  5EIS A;  5HFQ A;  5A5R A;  4NR8 A;  4Z6I A;  5HRW A;  4BJX A;  4QYL A;  5E74 A;  4Q0O A;  4QSX A;  5A81 A;  5FE6 A;  5JWM A;  4QSQ A;  4TTE A;  4A9M A;  2KTB B;  2RNY A;  5AD2 A;  5C4Q A;  4QSS A;  5FH8 A;  3QZT A;  4CFL A;  4Z93 A;  3O34 A;  4O74 A;  5DLZ A;  4QB3 A;  4MEN A;  5DLX A;  4PKL A;  3MB3 A;  2L5E A;  4LC2 A;  4QC3 A;  4QUU A;  3FKM X;  2L85 A;  5AME A;  5DYC A;  4A9O A;  5EM3 A;  3P1D A;  3ONI A;  3GG3 A;  5D7X A;  3UVX A;  2DAT A;  4QSW A;  2YYN A;  5CUA A;  4YYN A;  4ZW1 A;  5G4R A;  5FG4 A;  4MR6 A;  3ZYU A;  4YBT A;  3P1C A;  2RI7 A;  4MR3 A;  5ENJ A;  5KO4 A;  5E9V A;  2N9G A;  4PY6 A;  4NQM A;  2L84 A;  5CQ5 A;  4NRA A;  4YK0 A;  5AD3 A;  4NRC A;  3JVJ A;  5HRX A;  5F62 A;  5TCM A;  3P1E A;  5CUB A;  5EPR A;  3P5O A;  5LKZ A;  3JVK A;  5E0R A;  3JVM A;  5A85 A;  2I8N A;  4N3W A;  4UIZ A;  5CS8 A;  4O7A A;  4NUC A;  2YEL A;  4J0S A;  3O37 A;  5DFC A;  4IOO A;  4QUT A;  5HEL A;  4N4I A;  5CQA A;  5E73 A;  4O76 A;  3MB4 A;  4YAX A;  4Z1S A;  2WP2 A;  5KTW A;  5EGU A;  4UIV A;  5BT3 A;  4CUR A;  2YEM A;  5CPE A;  3LJW A;  5HQ5 A;  5D26 A;  5CQ7 A;  4PCE A;  5CUG A;  4E96 A;  5EA1 A;  3UVY A;  2YQD A;  3QZS A;  5L96 A;  2RNX A;  4NR6 A;  4BW2 A;  3I3J A;  5FBX A;  5HRV A;  5COI A;  1N72 A;  4ALH A;  3JVL A;  1WUG A;  1E6I A;  3Q2F A;  2OUO A;  5II1 A;  2DVS A;  5LJ2 A;  4NS5 A;  5ENI A;  5F60 A;  4A9L A;  5I86 A;  4KV4 A;  5E9L A;  5FG5 A;  5DFD A;  4QEU A;  4LYI A;  4NYW A;  4NRB A;  4PCI A;  5LJ1 A;  5LKT A;  5IGL A;  4ZC9 A;  5EWW A;  4CUS A;  2OO1 A;  3RCW A;  3U5J A;  4HXK A;  4QYD A;  1JSP B;  4IR5 A;  5FH7 A;  4Z1Q A;  5A5S A;  4TU6 A;  5EWV A;  4BW4 A;  4YYD A;  4O72 A;  5FE7 A;  5KU3 A;  4N4H A;  3HMF A;  5CZG A;  5FFW A;  5DKC A;  1ZS5 A;  5LKU A;  4XYA A;  5I89 A; 
#chains in the Genus database with same CATH topology
 3HMH A;  4TU4 A;  3D7C A;  5LKX A;  4CL9 A;  3P1F A;  5D3R A;  5CP5 A;  5FDZ A;  4PS5 A;  5EWC A;  3VKG A;  3AQA A;  4QST A;  4HBW A;  4UYF B;  5E9I A;  5CRM A;  5K29 A;  2R0Y A;  5KHM A;  2DVR A;  4CUQ A;  5F61 A;  5CY9 A;  4CUU A;  3UVW A;  4YYG A;  5ETD A;  5L99 A;  5DW2 A;  5C85 A;  5FE3 A;  5ENB A;  4ALG A;  5ENF A;  3UW9 A;  5EWH A;  2H60 A;  5F63 A;  4MEO A;  4QNS A;  5I40 A;  5KTU A;  5EPB A;  4HXL A;  5DKH A;  5FFY A;  5DY7 A;  2R0V A;  5FE8 A;  4TZ2 A;  5F5Z A;  3LQJ A;  2YEK A;  3DWY A;  3UVD A;  5CUE A;  4YAB A;  4A9H A;  4LZS A;  4X2I A;  5C7N A;  5LUU A;  4YY4 A;  2GRC A;  2OSS A;  4QR5 A;  5D25 A;  5C89 A;  3HME A;  4F3I A;  4QY4 A;  3U5M A;  4C66 A;  4HBV A;  5G4S A;  4AI6 A;  5I29 A;  5IBN A;  4YAT A;  4CLB A;  5FE4 A;  2DKW A;  3MQM A;  4WIV A;  5ENG A;  5TB6 A;  4NUD A;  5CFW A;  3NXB A;  4XY8 A;  5FE9 A;  5LJ0 A;  1WUM A;  4BHW A;  1F68 A;  5EK9 A;  1EQF A;  3MXF A;  4UYH A;  5KTX A;  5CU8 A;  2DVQ A;  4UIU A;  4O78 A;  4MEQ A;  3SVF A;  4O7B A;  5IG6 A;  5CQ4 A;  1JM4 B;  4UIX A;  4A9F A;  4TT4 A;  5J0D A;  5IID A;  4NQN A;  5L97 A;  5CTL A;  4IOR A;  4QR3 A;  4QSU A;  5H1V A;  5F36 A;  2RO1 A;  5E3D A;  2E3K A;  5DFB A;  4LZ2 A;  4RVR A;  5D3P A;  4A9N A;  4TYL A;  3MUK A;  5ETB A;  5HJC A;  4HXO A;  3SVG A;  4C67 A;  5E9M A;  5L98 A;  4IR3 A;  5ENE A;  4CFK A;  4A9J A;  3AAD A;  4NR9 A;  5EWD A;  3UV2 A;  3IU6 A;  5AMF A;  5FE2 A;  5I83 A;  4N4F A;  5D3N A;  4KV1 A;  4QSR A;  4UYG A;  3U5N A;  4AKG A;  4LZR A;  5I80 A;  5EU1 A;  4O71 A;  4A9E A;  5DX4 A;  5EVA A;  4NR4 A;  4UYF A;  4QR4 A;  4GPJ A;  4O77 A;  4CUT A;  3SVH A;  5E9Y A;  5HFR A;  5E3G A;  4HBX A;  4LRG A;  4KCX A;  5A7C A;  2R0S A;  5CQ8 A;  5EP7 A;  5IGM A;  5E7D A;  4O7C A;  3LQI A;  3O33 A;  3Q2E A;  2YDW A;  1PUO A;  4NR5 A;  5DW1 A;  4UIW A;  4QEW A;  5LVQ A;  4HBY A;  4NUE A;  5C87 A;  4MR5 A;  2R10 A;  3D1D A;  3TLP A;  4MR4 A;  4CUP A;  4QSV A;  5CQ3 A;  2G4A A;  4HXM A;  4UYD A;  4UYE A;  3QZV A;  2DWW A;  4UIY A;  5I7X A;  4J1P A;  4YC9 A;  4LYW A;  5IGK A;  5F3A A;  5JI8 A;  3U5O A;  4LYS A;  3O36 A;  4YYH A;  5D3H A;  5CGP A;  5I88 A;  2E7O A;  5F2P A;  4QEV A;  4YH3 A;  3S91 A;  4XUA A;  4YAD A;  4OGJ A;  4FLP A;  2F6N A;  5F25 A;  4YBS A;  5DYA A;  5C8G A;  5I1Q A;  5FE1 A;  4O70 A;  5EV9 A;  4DON A;  4TT6 A;  5A5P A;  2RNW A;  4MEP A;  4YH4 A;  5A5N A;  2MJV B;  4HXR A;  1X0J A;  5ENH A;  2WP1 A;  4NR7 A;  5I7Y A;  4N4G A;  5FE5 A;  4Y03 A;  5ACY A;  5DYX A;  4TQN A;  2D9E A;  5A83 A;  5II2 A;  4NYX A;  2LSP B;  3LQH A;  5FB1 A;  5CUC A;  2F6J A;  5D3T A;  4BW1 A;  3D1B A;  4HXS A;  4LR6 A;  4A9I A;  4QC1 A;  3ERR A;  3VKH A;  4AKN A;  2NXB A;  4IR4 A;  4WHU A;  5L8T A;  5CRZ A;  3U5L A;  3LXJ A;  4YYK A;  5D3S A;  4BW3 A;  4YY6 A;  4A9K A;  4O7E A;  4QZS A;  5FH6 A;  5HM0 A;  5EI4 A;  5A5O A;  5E9K A;  5LVR A;  5HLS A;  4XUB A;  5EPS A;  4YBM A;  5CQ6 A;  5HEN A;  4IR6 A;  2D82 A;  2YW5 A;  5CQT A;  4IOQ A;  5ENC A;  4HXN A;  5D3L A;  4OUF A;  2RS9 B;  3DAI A;  2FSA A;  5D3J A;  4YYM A;  4ZQL A;  5H1U A;  3K2J A;  3UV4 A;  2RFJ A;  3G0L A;  5H85 A;  4PTB A;  4Q0N A;  5HQ7 A;  3S92 A;  5BT4 A;  4TZ8 A;  5F1L A;  5H1T A;  5EQ1 A;  4NYV A;  4J0R A;  4TS8 A;  5EIC A;  4J3I A;  5IGN A;  5F1H A;  4XY9 A;  2I7K A;  5FG6 A;  3G0J A;  4NXJ A;  5FB0 A;  5HCL A;  2E7N A;  2DVV A;  3O35 A;  5FFV A;  5FE0 A;  4QSP A;  1ZKR A;  5CUD A;  4QBM A;  5D24 A;  5A5Q A;  3U5P A;  4UIT A;  5DBM A;  5DKD A;  4O7F A;  4YYI A;  5HEM A;  4HXP A;  3IU5 A;  4WHW A;  3UV5 A;  4YYJ A;  5HQ6 A;  5L8U A;  5A82 A;  4TT2 A;  4OGI A;  3U5K A;  4LDF A;  5D0C A;  3MUL A;  4Z6H A;  5DYU A;  5BT5 A;  4O75 A;  5EIS A;  5HFQ A;  5A5R A;  4NR8 A;  4Z6I A;  5HRW A;  4BJX A;  4QYL A;  5E74 A;  4Q0O A;  4QSX A;  5A81 A;  5FE6 A;  5JWM A;  4QSQ A;  4TTE A;  4A9M A;  2KTB B;  2RNY A;  5AD2 A;  5C4Q A;  4QSS A;  5FH8 A;  3QZT A;  4CFL A;  4Z93 A;  3O34 A;  4O74 A;  5DLZ A;  4QB3 A;  4MEN A;  5DLX A;  4PKL A;  3MB3 A;  2L5E A;  4LC2 A;  4QC3 A;  4QUU A;  3FKM X;  2L85 A;  5AME A;  5DYC A;  4A9O A;  5EM3 A;  3P1D A;  3ONI A;  3GG3 A;  5D7X A;  3UVX A;  2DAT A;  4QSW A;  2YYN A;  5CUA A;  4YYN A;  4ZW1 A;  5G4R A;  5FG4 A;  4MR6 A;  3ZYU A;  4YBT A;  3P1C A;  2RI7 A;  4MR3 A;  5ENJ A;  5KO4 A;  5E9V A;  2N9G A;  4PY6 A;  4NQM A;  2L84 A;  5CQ5 A;  4NRA A;  4YK0 A;  5AD3 A;  4NRC A;  3JVJ A;  5HRX A;  5F62 A;  5TCM A;  3P1E A;  5CUB A;  5EPR A;  3P5O A;  5LKZ A;  3JVK A;  5E0R A;  3JVM A;  5A85 A;  2I8N A;  4N3W A;  4UIZ A;  5CS8 A;  4AKH A;  4O7A A;  4NUC A;  4AKI A;  2YEL A;  4J0S A;  3O37 A;  5DFC A;  4IOO A;  4QUT A;  5HEL A;  4N4I A;  5CQA A;  5E73 A;  4O76 A;  3MB4 A;  4YAX A;  4Z1S A;  2WP2 A;  5KTW A;  5EGU A;  4UIV A;  5BT3 A;  4CUR A;  2YEM A;  5CPE A;  3LJW A;  5HQ5 A;  5D26 A;  5CQ7 A;  4PCE A;  5CUG A;  4E96 A;  5EA1 A;  3UVY A;  2YQD A;  3QZS A;  5L96 A;  2RNX A;  4NR6 A;  4BW2 A;  3I3J A;  5FBX A;  5HRV A;  5COI A;  1N72 A;  4ALH A;  3JVL A;  1WUG A;  1E6I A;  3Q2F A;  2OUO A;  5II1 A;  2DVS A;  5LJ2 A;  4NS5 A;  5ENI A;  5F60 A;  4A9L A;  5I86 A;  4KV4 A;  5E9L A;  5FG5 A;  5DFD A;  4QEU A;  4LYI A;  4NYW A;  2EJN A;  4NRB A;  4PCI A;  5LJ1 A;  5LKT A;  5IGL A;  4ZC9 A;  5EWW A;  4CUS A;  2OO1 A;  3RCW A;  3U5J A;  4HXK A;  4QYD A;  1JSP B;  4IR5 A;  5FH7 A;  4Z1Q A;  5A5S A;  4TU6 A;  5EWV A;  4BW4 A;  4YYD A;  4O72 A;  5FE7 A;  5KU3 A;  4N4H A;  3HMF A;  5CZG A;  5FFW A;  5DKC A;  1ZS5 A;  5LKU A;  4XYA A;  5I89 A; 
#chains in the Genus database with same CATH homology
 3HMH A;  4TU4 A;  3D7C A;  5LKX A;  4CL9 A;  3P1F A;  5D3R A;  5CP5 A;  5FDZ A;  4PS5 A;  5EWC A;  3AQA A;  4QST A;  4HBW A;  4UYF B;  5E9I A;  5CRM A;  5K29 A;  2R0Y A;  5KHM A;  2DVR A;  4CUQ A;  5F61 A;  5CY9 A;  4CUU A;  3UVW A;  4YYG A;  5ETD A;  5L99 A;  5DW2 A;  5C85 A;  5FE3 A;  5ENB A;  4ALG A;  5ENF A;  3UW9 A;  5EWH A;  2H60 A;  5F63 A;  4MEO A;  4QNS A;  5I40 A;  5KTU A;  5EPB A;  4HXL A;  5DKH A;  5FFY A;  5DY7 A;  2R0V A;  5FE8 A;  4TZ2 A;  5F5Z A;  3LQJ A;  2YEK A;  3DWY A;  3UVD A;  5CUE A;  4YAB A;  4A9H A;  4LZS A;  4X2I A;  5C7N A;  5LUU A;  4YY4 A;  2GRC A;  2OSS A;  4QR5 A;  5D25 A;  5C89 A;  3HME A;  4F3I A;  4QY4 A;  3U5M A;  4C66 A;  4HBV A;  5G4S A;  5I29 A;  5IBN A;  4YAT A;  4CLB A;  5FE4 A;  2DKW A;  3MQM A;  4WIV A;  5ENG A;  5TB6 A;  4NUD A;  5CFW A;  3NXB A;  4XY8 A;  5FE9 A;  5LJ0 A;  1WUM A;  4BHW A;  1F68 A;  5EK9 A;  1EQF A;  3MXF A;  4UYH A;  5KTX A;  5CU8 A;  2DVQ A;  4UIU A;  4O78 A;  4MEQ A;  3SVF A;  4O7B A;  5IG6 A;  5CQ4 A;  1JM4 B;  4UIX A;  4A9F A;  4TT4 A;  5J0D A;  5IID A;  4NQN A;  5L97 A;  5CTL A;  4IOR A;  4QR3 A;  4QSU A;  5H1V A;  5F36 A;  2RO1 A;  5E3D A;  2E3K A;  5DFB A;  4LZ2 A;  4RVR A;  5D3P A;  4A9N A;  4TYL A;  3MUK A;  5ETB A;  5HJC A;  4HXO A;  3SVG A;  4C67 A;  5E9M A;  5L98 A;  4IR3 A;  5ENE A;  4CFK A;  4A9J A;  3AAD A;  4NR9 A;  5EWD A;  3UV2 A;  3IU6 A;  5AMF A;  5FE2 A;  5I83 A;  4N4F A;  5D3N A;  4KV1 A;  4QSR A;  4UYG A;  3U5N A;  4LZR A;  5I80 A;  5EU1 A;  4O71 A;  4A9E A;  5DX4 A;  5EVA A;  4NR4 A;  4UYF A;  4QR4 A;  4GPJ A;  4O77 A;  4CUT A;  3SVH A;  5E9Y A;  5HFR A;  5E3G A;  4HBX A;  4LRG A;  4KCX A;  5A7C A;  2R0S A;  5CQ8 A;  5EP7 A;  5IGM A;  5E7D A;  4O7C A;  3LQI A;  3O33 A;  3Q2E A;  2YDW A;  4NR5 A;  5DW1 A;  4UIW A;  4QEW A;  5LVQ A;  4HBY A;  4NUE A;  5C87 A;  4MR5 A;  2R10 A;  3TLP A;  4MR4 A;  4CUP A;  4QSV A;  5CQ3 A;  2G4A A;  4HXM A;  4UYD A;  4UYE A;  3QZV A;  2DWW A;  4UIY A;  5I7X A;  4J1P A;  4YC9 A;  4LYW A;  5IGK A;  5F3A A;  5JI8 A;  3U5O A;  4LYS A;  3O36 A;  4YYH A;  5D3H A;  5CGP A;  5I88 A;  2E7O A;  5F2P A;  4QEV A;  4YH3 A;  3S91 A;  4XUA A;  4YAD A;  4OGJ A;  4FLP A;  2F6N A;  5F25 A;  4YBS A;  5DYA A;  5C8G A;  5I1Q A;  5FE1 A;  4O70 A;  5EV9 A;  4DON A;  4TT6 A;  5A5P A;  2RNW A;  4MEP A;  4YH4 A;  5A5N A;  2MJV B;  4HXR A;  1X0J A;  5ENH A;  2WP1 A;  4NR7 A;  5I7Y A;  4N4G A;  5FE5 A;  4Y03 A;  5ACY A;  5DYX A;  4TQN A;  2D9E A;  5A83 A;  5II2 A;  4NYX A;  2LSP B;  3LQH A;  5FB1 A;  5CUC A;  2F6J A;  5D3T A;  4BW1 A;  4A9I A;  4HXS A;  4LR6 A;  4QC1 A;  4AKN A;  2NXB A;  4IR4 A;  4WHU A;  5L8T A;  5CRZ A;  3U5L A;  3LXJ A;  4YYK A;  5D3S A;  4BW3 A;  4YY6 A;  4A9K A;  4O7E A;  4QZS A;  5FH6 A;  5HM0 A;  5EI4 A;  5A5O A;  5E9K A;  5LVR A;  5HLS A;  4XUB A;  5EPS A;  4YBM A;  5CQ6 A;  5HEN A;  4IR6 A;  2D82 A;  2YW5 A;  5CQT A;  4IOQ A;  5ENC A;  4HXN A;  5D3L A;  4OUF A;  2RS9 B;  3DAI A;  2FSA A;  5D3J A;  4YYM A;  4ZQL A;  5H1U A;  3K2J A;  3UV4 A;  2RFJ A;  3G0L A;  5H85 A;  4PTB A;  4Q0N A;  5HQ7 A;  3S92 A;  5BT4 A;  4TZ8 A;  5F1L A;  5H1T A;  5EQ1 A;  4NYV A;  4J0R A;  4TS8 A;  5EIC A;  4J3I A;  5IGN A;  5F1H A;  4XY9 A;  2I7K A;  5FG6 A;  3G0J A;  4NXJ A;  5FB0 A;  5HCL A;  2E7N A;  2DVV A;  3O35 A;  5FFV A;  5FE0 A;  4QSP A;  5CUD A;  4QBM A;  5D24 A;  5A5Q A;  3U5P A;  4UIT A;  5DBM A;  5DKD A;  4O7F A;  4YYI A;  5HEM A;  4HXP A;  3IU5 A;  4WHW A;  3UV5 A;  4YYJ A;  5HQ6 A;  5L8U A;  5A82 A;  4TT2 A;  4OGI A;  3U5K A;  4LDF A;  5D0C A;  3MUL A;  4Z6H A;  5DYU A;  5BT5 A;  4O75 A;  5EIS A;  5HFQ A;  5A5R A;  4NR8 A;  4Z6I A;  5HRW A;  4BJX A;  4QYL A;  5E74 A;  4Q0O A;  4QSX A;  5A81 A;  5FE6 A;  5JWM A;  4QSQ A;  4TTE A;  4A9M A;  2KTB B;  2RNY A;  5AD2 A;  5C4Q A;  4QSS A;  5FH8 A;  3QZT A;  4CFL A;  4Z93 A;  3O34 A;  4O74 A;  5DLZ A;  4QB3 A;  4MEN A;  5DLX A;  4PKL A;  3MB3 A;  2L5E A;  4LC2 A;  4QC3 A;  4QUU A;  3FKM X;  2L85 A;  5AME A;  5DYC A;  4A9O A;  5EM3 A;  3P1D A;  3ONI A;  3GG3 A;  5D7X A;  3UVX A;  2DAT A;  4QSW A;  2YYN A;  5CUA A;  4YYN A;  4ZW1 A;  5G4R A;  5FG4 A;  4MR6 A;  3ZYU A;  4YBT A;  3P1C A;  2RI7 A;  4MR3 A;  5ENJ A;  5KO4 A;  5E9V A;  2N9G A;  4PY6 A;  4NQM A;  2L84 A;  5CQ5 A;  4NRA A;  4YK0 A;  5AD3 A;  4NRC A;  3JVJ A;  5HRX A;  5F62 A;  5TCM A;  3P1E A;  5CUB A;  5EPR A;  3P5O A;  5LKZ A;  3JVK A;  5E0R A;  3JVM A;  5A85 A;  2I8N A;  4N3W A;  4UIZ A;  5CS8 A;  4O7A A;  4NUC A;  2YEL A;  4J0S A;  3O37 A;  5DFC A;  4IOO A;  4QUT A;  5HEL A;  4N4I A;  5CQA A;  5E73 A;  4O76 A;  3MB4 A;  4YAX A;  4Z1S A;  2WP2 A;  5KTW A;  5EGU A;  4UIV A;  5BT3 A;  4CUR A;  2YEM A;  5CPE A;  3LJW A;  5HQ5 A;  5D26 A;  5CQ7 A;  4PCE A;  5CUG A;  4E96 A;  5EA1 A;  3UVY A;  2YQD A;  3QZS A;  5L96 A;  2RNX A;  4NR6 A;  4BW2 A;  3I3J A;  5FBX A;  5HRV A;  5COI A;  1N72 A;  4ALH A;  3JVL A;  1WUG A;  1E6I A;  3Q2F A;  2OUO A;  5II1 A;  2DVS A;  5LJ2 A;  4NS5 A;  5ENI A;  5F60 A;  4A9L A;  5I86 A;  4KV4 A;  5E9L A;  5FG5 A;  5DFD A;  4QEU A;  4LYI A;  4NYW A;  4NRB A;  4PCI A;  5LJ1 A;  5LKT A;  5IGL A;  4ZC9 A;  5EWW A;  4CUS A;  2OO1 A;  3RCW A;  3U5J A;  4HXK A;  4QYD A;  1JSP B;  4IR5 A;  5FH7 A;  4Z1Q A;  5A5S A;  4TU6 A;  5EWV A;  4BW4 A;  4YYD A;  4O72 A;  5FE7 A;  5KU3 A;  4N4H A;  3HMF A;  5CZG A;  5FFW A;  5DKC A;  1ZS5 A;  5LKU A;  4XYA A;  5I89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...