5ENPD

Mbx2931 bound structure of bacterial efflux pump.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
HHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein
total genus 52
structure length 161
sequence length 161
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enpD00
3AJIA 4C48B 3JXJA 5AN8A 4G8LA 3ZNGA 5CBOA 3SO8A 4HLLA 5BXUA 2BKGA 2DWZA 2DVWA 5AQ9A 5AQAA 3NOCD 5HS0A 5BXOA 1D9SA 5EIBE 4LG6A 4HRMB 3V79K 4UUCA 4N5QA 5AQBA 1G3NB 2BKKB 1MX2A 4B93B 3LJNA 5JMND 4BEPA 4QFVA 5KBAA 4HI9A 4DX7D 1N11A 1K3ZD 2FO1E 4O60A 1WDYA 3T8KA 2KBXA 1QYMA 3NOGD 2XENA 3W9FA 1SW6A 1N0QA 3V31A 2F8YA 3F6QA 4ZHBA 4F6RD 4DX5D 5EIDA 1BU9A 2V5QC 1IKND 4BSZB 1DCQA 3UI2A 3V2XA 3Q9NC 3TWVA 2ZGDA 5JA4D 2Y1LE 4HI8A 3ZKJA 5EN5D 5ENQD 5AAOA 4TUMA 5HRYA 3Q9UC 3TWQA 3B7BA 4DX6D 3TWWA 2XEEA 1DC2A 2ETAA 4YDWA 4K5AB 4U95D 5AQ7A 3UXGA 3J5PA 3NBNB 5EILA 4J7WA 4HRNA 1TR4A 1MJ0A 1YMPA 5FINA 4U8VD 2NYJA 5HKPA 1A5EA 1BI8B 1IHBA 4BETA 4Z68A 5CEDB 3UTMA 4DX2A 4DX1A 1K1AA 4LNUD 4YDYA 4K5BA 3V2OA 4BESA 4CZ2D 1OT8A 1BD8A 1K1BA 4F1PA 4J8YA 1MX4A 1MX6A 5KNGA 4O1OA 3AAAC 3DEOA 2AJAA 1UOHA 2JABA 2XZTG 3EU9A 2RFMA 2J8SD 2MYOA 2RFAA 4G8KA 4A63B 3DEPA 3ZUVB 2ETCA 3HRAA 5EYPF 2L6BA 1WG0A 5CBNA 3EHQA 4RLYA 2P2CP 2QC9A 5D66A 3TWTA 5ENRD 2ZGGA 4DRXE 4ATZD 2XZDG 4GMRA 3TWUA 5CERB 2ETBA 4LSZE 2PNNA 3ZU7B 1BLXB 4CYMD 1MYOA 5ITZF 2QYJA 3JUEA 1AP7A 2DZNA 4HQDA 3D9HA 4JB8P 1SVXA 5KNHD 3TWRA 4OAVB 1N0RA 1YCSB 3C5RA 5AARA 3W9GA 2VGEA 4GPMA 2KXPC 5ENOD 5ENTD 3T9KA 4DUIA 5KWDA 3B95A 5EYLA 4HB5A 1NFIE 1OY3D 3JXIA 4U96D 4HRLA 4BERA 1AWCB 4HBDA 4NIKA 3TWXA 5CECB 4HNAD 2F8XK 2HE0A 2F37A 5ENPD 2Y0BG 5ENSD 2A5EA 5FIOA 3TWSA 2XEHA 4O1PA 4K5CA 2DZOA 5CEAA 3EHRA 1BI7B 4U8YD 3IXEA 1S70B 2V4HC 3KEAA 4QQIA 3V30A 1YYHA 4ZFHA 2B0OE 4OAUC 1IXVA 3HG0D 3J5QB
chains in the Genus database with same CATH superfamily
1PAQA 4C48B 3FTZA 3ZNGA 4EZJA 5B1AE 2XPZA 3ULYA 3LJNA 4RSYA 1WY6A 3JUIA 4WNDA 1QYMA 1VDYA 4U0UA 5KCMA 4YDEA 1NA3A 4GTRA 3CQGB 3LYAA 1ELRA 3DBSA 1Z3YA 3AS5A 3Q9NC 3ESLA 3TWQA 4DX6D 1TNYA 1SZAA 1MHQA 3QWVA 3HXEA 1RZ4A 2J9QA 2GRMA 4DJAA 3SF4A 3SBTB 3CVQA 3CHSA 4BETA 3GZ1A 3ZVVA 3R7RA 1XGWA 2LAIA 1U2VG 4F1PA 3NF1A 3S7JA 5KJMA 3ASOE 1E8YA 4AP2A 3Q4AB 4CGVA 2JLBA 5FQ7A 1TNZA 2X6JA 5A7DB 3ZRHA 1HH8A 3FFLA 3CSTA 2Y69E 1BLXB 4CYMD 2DZNA 4UI9J 4GZ6A 1O1RA 4U04A 3FHEA 4BTBA 1JCRA 3HVEB 4Q69A 1NFIE 4UQZA 2ZIRA 3ASNE 4TV3A 2EQXA 1ZB1A 5BPPA 4Q96A 5BV1A 2DZOA 5AENA 4DI3A 3NZSA 1HO8A 4HFGA 4UQYA 4DK5A 5FZRA 1SA4A 1UN8A 4GTTA 2YHCA 4CT4A 5D0OD 3GW4A 1K3ZD 3EIJA 3T8KA 3UPVA 2F8YA 3ENEA 3N71A 1DCQA 1W3BA 3ONLA 2WPVA 1XNFA 3V2XA 4KMOA 1B89A 3NB2A 4BT9A 3ASDA 5T4YA 4M7CA 4BFRA 3U64A 4N39A 4K5AB 3TG5A 3UXGA 3WXXA 4HRNA 4JD2G 4NACA 3UT4A 2WQHA 3LY7A 4DX2A 3FU6A 4F7AA 2IQCA 5AYWD 3CVXA 2C0LA 4FC8A 1ZBPA 1HFAA 4HOQA 2ILRA 3KD7A 4IRUA 3ASFA 4AV7A 4N3CA 2P2CP 5D66A 4BX9A 4GTSA 2XZDG 2VSNA 3AG1E 2QYJA 2WXOA 5AARA 1H2VC 1NP7A 4GZDA 3ZYMA 4G2VA 2I6HA 2X6FA 2XGOA 3FY4A 4KZ0A 2EILE 2HE0A 4WWOA 5AIJA 3ZHEA 3L82A 3D9KA 3PNLB 5JHBA 4C0EA 4U7EB 1TNUA 1O1TA 2XCCA 3FP3A 4H7YA 1D9SA 3FULA 3LS8A 3PE4A 3PRZA 1MX2A 3PH0C 2X6HA 2IU1A 5FQ4A 2KC7A 1E7UA 4AJWA 2XS8A 4L23A 1N52A 4BWRA 2KZTB 4L2LA 5CHEE 2ETAA 4BSXA 4FJYA 3S7DA 2A5UA 2WMOA 4I6GA 2IOLA 4CCAA 3DSXA 4G23A 3UTMA 4LEUA 2VGXA 3V2OA 5LCWC 3ZGQA 5KNGA 2CHWA 2P9PG 2MYOA 4A63B 2R5SA 1N54A 3DXMG 2QC9A 2X6IA 2ETBA 1H0AA 3OXGA 1MYOA 3TJPA 4AM9A 3MKQA 3IHYA 3UMVA 1N4PA 3MV3B 1V55E 4ME2A 4OYSA 4FADA 2H6IA 5ENSD 5FTPA 4BTAA 4ACKA 2AXZA 4GAAA 1U3CA 3B7RL 4HOSA 2V5FA 4QQIA 4Q94A 4P29A 4GTOA 4I1OB 3O4ZA 4GZ5A 1MZCA 4G8LA 4L9PA 2DVWA 1EDUA 4GZ3A 5CRUA 4JVSA 4HOUA 3HIZA 2BKKB 4B93B 2J07A 4JEUA 2KBXA 3HXBA 1E8WA 2XENA 1Z6TA 3Q75A 3D9LA 2XEVA 3QNKA 3EJNA 4J8FA 1E7VA 1HF8A 3CHOA 3RRMB 2NC9A 2Y1LE 1HX8A 2IONA 1HG5A 3KSLA 3ASGA 4YDWA 3IKOB 3E34A 4I2WA 3D3MA 4CRWA 1TR4A 5B3SE 2V0PA 2P9KG 3BEEA 3ML9A 4DX1A 2HYZA 3WG7E 4CZ2D 5A23A 4R7LA 2R17C 4C9BB 2RFMA 2J49A 2ZISA 4UI9C 3BUAA 2NXPA 3UM0A 3ABLE 3JUEA 3PEUB 2WXKA 4NQ0A 3QJZA 3W9GA 4KVMA 1U3DA 3E30A 1OY3D 3FTWA 1ELKA 3TAXA 4CDMA 3PNTB 2R02A 2WXFA 2FULA 5EX0A 2P9UG 3ZPJA 4TUUA 2V4LA 3B13A 2EINE 1GW6A 4E85A 1YYHA 1OCZE 3FH7A 3AJIA 2PL2A 5CRVA 2AWIA 1HZ4A 1NA0A 3EHNA 3UM3A 1H6KA 2PZIA 3FEXA 4TXQA 1NL4A 2VSYA 5E76A 1TNBA 1N9AA 5D2MC 2J08A 2OCCE 1IQUA 2GRRB 4JPSA 3UKRG 2ZGDA 3FUIA 3ZKJA 4V3IA 3AS8A 2XEEA 4J7WA 2HO1A 2NYJA 2XRZA 3DWLG 4MKTA 1EYHA 1DCEA 3QDNA 1H2UA 1UG3A 4F3VA 5T8IA 3ISMC 4FJZA 3AAAC 4I2ZA 4WUYA 1LD8A 3LXUX 2J4DA 4G8KA 3FH5A 4K03A 3RO2A 5CBNA 2EIKE 1INZA 3AU5A 3ZU7B 2PNNA 1D8EA 1SA5A 4OAVB 2H6HA 3C5RA 5EX3A 2M63A 4XI0A 4L2YA 3ESKA 5LCWJ 2L0TB 1DVPA 3TWSA 4UI9K 1JCSA 3UKUG 3R7QA 2X3MA 1DNPA 5C1DA 3PVLA 3SO8A 5BXUA 2XPIA 5BXOA 5JJ6A 2R03A 2WXJA 4HRMB 3CHMA 3FUJA 3L6AA 4I9CA 2E0IA 3SI5A 3VTYA 3FUKA 3LY9A 3LDZA 1PC2A 3V31A 3SFZA 3ZFWA 4DX5D 1FPPA 2XS1A 5EKQD 1EPUA 3SQVA 1TN7A 4GYWA 4PS7A 3E4BA 4U8VD 1A5EA 2WB2A 3SHFA 1MQSA 5CEDB 3MX3A 4FU3A 4K5BA 4JZYA 2GGFA 1KT1A 1OT8A 3LEWA 4GMLA 1OWPA 3Q78A 3GYZA 2J8SD 2VSXE 2I9CA 4KT6B 2RD0A 3TWTA 4LSZE 2OEVA 3S7FA 1OUVA 2P9NG 3Q73A 3SFYA 5KWDA 2XHEA 5E75A 3L17A 2WXMA 4HRLA 2WXGA 1ELWA 4AY6A 4XI9A 3TWXA 4ANWA 3UIPC 2Y4UA 3D9JA 2A5EA 2J4BA 5H7PA 1LTXA 3EHRA 5J08A 5EDSA 3QB2A 5AQAA 3FUFA 4YDOA 4GCNA 4LG6A 4UUCA 5LOZA 5AQBA 4G24A 3KAEA 5LX8A 3UUXA 1TJCA 4I43A 4NURA 5BUZA 2E2EA 2I1JA 5G04J 3ML8A 5ENQD 4CDRA 3U9WA 5ARFA 3SGHA 3RSEG 1PY1A 3QWWA 1YMPA 4GYYA 4OVVA 3NZUA 3CVYA 4ILIA 4I1AA 4LRZA 4TXPA 4W9RA 3E37A 4UWLA 4FHKA 2ETCA 5A6CA 3DSWA 3IHVA 3QC1A 3U3WA 5FWQA 3LPZA 4I6EA 3RJVA 3QKYA 1SVXA 5KNHD 3RK6A 1YCSB 4DUIA 5EYLA 1YA0A 4FHJA 2YHEA 2R05A 3HVEA 3OTNA 2NSZA 3GZSA 3GZ2A 3EU5A 1BI7B 4HS2A 2V4HC 3PZ2A 4A1SA 2IY0C 3Q47B 4DI4A 1IXVA 1O5MA 3J5QB 4TXRA 1FT1A 2BKGA 3CVWA 3FUEA 2GRQB 5JHAA 2P9IG 4WWNA 1KZPA 4YVOA 4HI9A 1NI1A 3NAWA 4CGWA 4JEHA 1Z3XA 4E6HA 3C3RA 3L08A 4LNGA 4O6FA 3C98A 2I1KA 4HXIA 1P5QA 3R9MA 3UIOC 4ANUA 3FU5A 4UWGA 2VYIA 1MJ0A 2GRNB 4Y6WA 3DPDA 3D9IA 4ABNA 3APCA 3PZ3A 3RRNB 1MX4A 3P1UA 3DEOA 2XGSA 4I1MA 4BY6A 3HRAA 4MBGA 5EYPF 2L6BA 2PQNA 5CMYA 2UY1B 4PS3A 1WAO1 5FZQA 2X38A 2BUGA 5FZSA 4JHJA 4RVBA 4I17A 4G26A 4EZKA 2H6GA 3CK8A 5IY5E 4WAFA 1RW2A 4AXHA 4HBDA 4NIKA 1H2TC 2P9LG 4ACLA 4YVQC 3LY8A 3TGOA 1TJFA 4U8YD 3L54A 2FI7A 3FU3A 3CVVA 1N94A 5BV0A 5BNWA 2JEKA 4DLQA 5CBOA 4HLLA 3PE3A 2HM8A 2FBNA 1G3NB 3CKCA 3APDA 4QFVA 3T5VA 3W9FA 4KYOB 5CCMA 2FF4A 3PZ1A 4FLHA 4CEMA 4MS6A 3ABME 1E96B 3CVUA 2HR2A 4HI8A 3OAWA 5AAOA 3HXFA 4RQIA 3MJWA 2IO3C 1E8XA 2PQRA 5KJLA 4Z68A 3MGBA 3KEZA 2DYSE 4BESA 3TXMA 2Y3AA 4U0SA 4HLEA 1KPSB 2XGMA 2MHKA 1FT2A 4CDNA 3DEPA 4K0RA 4GTMA 2IO2C 3AS4A 4PUCA 3UX4A 5ENNA 1OWLA 5G2NA 4NRHB 3C3OA 2ZU6B 3APFA 1KT0A 5ENTD 3FTXA 2VTBA 1IYGA 5HI7A 3PREA 4U96D 5M72A 2KCKA 3CHPA 4GCOA 4B89A 2XRYA 4G25A 3MEKA 1NZNA 3CVNA 3CV0A 2AW6A 3FDHA 3URZA 2DIWA 2A4ZA 3C72A 4WNFA 3QARA 3FTYA 3V30A 4N2QA 5FQ8A 3D9MA 2V8SE 1N4SA 3Q49B 1X81A 4UWKA 1HU3A 4RG9A 1Z5SC 1WDYA 3NOGD 3LKUA 4KXKB 5G04C 3I3NA 3MKRA 3AG2E 4LCTA 4BSZB 4L7TA 2WMNA 3DXKG 3TWVA 4JHRA 2OVFA 3FU0A 2LXLA 1TN8A 3PZ4A 1UJJA 5AQ7A 1Q2ZA 2GROB 4XE0A 4GU5A 3ABKE 3ULEG 3RKVA 1S63A 3CHQA 1TYQG 2C2LA 4GA0A 4YDYA 3CEQA 3B7UX 2H6FA 4PDXA 3C3QA 3LCAA 4O1OA 1HXIA 2MRIA 3JQ0A 1FCHA 4U07A 5HQ8A 4JHKA 2MOWA 2UWJG 1JPLA 3IEGA 1AP7A 2WXQA 3TWRA 4I6JA 3FUHA 3PS6A 4N5CA 5BW8C 3UQ3A 5BT1A 4GB9A 2WXNA 4EBAG 4DPRA 4BERA 3CK9A 4EBAA 5ENPD 2Y0BG 2PM6A 4LNBA 5FIOA 2LSUA 3ZYLA 2XEHA 4XX5A 2KATA 2WQ7A 4OAUC 3JCKC 3Q5MA 3MZLB 3JXJA 4GTVA 2WXPA 3NOCD 1OCCE 3JQ1A 4O60A 2PM7A 1E8ZA 1UJKA 4URKA 3FEYA 4IYPA 4HVBA 1IKND 2ZXWE 3HDXA 2GW1A 3BG0B 3FWVA 5KJNA 3TWWA 3LVQE 3QAQA 1H6PA 2EIJE 3NBNB 5FINA 3CVLA 3VLFA 3MCXA 4GA2A 2J09A 1FVFA 2BF0X 3FTVA 3ZXPA 1UOHA 3EU9A 3ZEFA 3ZN3A 5C2YA 3LVRE 1WG0A 2IFUA 2QFCA 4ILHB 3DSSA 4GPKA 3DRAA 1K8KG 3D9OA 1JUQA 2KXPC 4WNEA 3Q15A 4G11A 3EUVA 2IEJA 2FEZA 4J6IA 5G05C 3D9NA 4GYOA 3O48A 4BT8A 1S70B 4FULA 4A3TA 1KLXA 1HE8A 3P2BA 4EZLA 4DLOA 4M3OA 2CG3A 2IF4A 2WXIA 4JA7A 1SW6A 4F6RD 4UWFA 5EIDA 3AU4A 4KVOA 4PH4B 4AVXA 4HORA 1SQMA 4J8EA 2GRPB 3RU0A 2F0YA 4TUMA 2LUHA 1KZOA 2VSOE 4EECA 4JC8A 3PDNA 1FVHA 3CR3A 5CCLA 2VJ8A 2WXLA 3Q7FA 1K1AA 3NQPA 4PS8A 1BPOA 4U8HA 2AJAA 4A1GA 2GRLA 2RFAA 4EPZA 4ANXA 3ZUVB 5ENRD 4DRXE 4GMRA 3TWUA 5J90A 5ANRA 5ARGA 2R2LA 1N0RA 4UWHA 3T8MA 5LFAA 2OEWA 1LD7A 2QYUA 3AG3E 3AG4E 4U0ZA 4J0UA 3RRUA 3ZHEB 5CECB 2F8XK 2WXHA 3I5PA 1TN6A 2VGYA 1D8DA 2DCPA 2ONDA 3KS2A 3QOUA 3Q7AA 4LERA 3IXEA 3SZ7A 4ZFHA 4AOFA 2OV8A 1EF1C 2L9BA 2OVBA 4N2SA 4N5QA 5JMND 4U63A 3SD5A 3EIQC 3TG4A 1N11A 1X5BA 5T3RA 2DBAA 1Y6IA 3L16A 3F6QA 2AVPA 3IBEA 3UI2A 4YNDA 4OVUA 2WQ6A 4WWPA 1A17A 4D10C 3B7BA 3FUNA 4L1BA 3UT8A 4A55A 1LF8A 2XPYA 3BG1B 4LUNU 4X8QA 2VGXB 3DPYA 5ANLA 1IHGA 1TEZA 2IJGX 5DIZA 3TXNA 2IOSA 3D9PA 3VLDA 1O1SA 1K1BA 4J8YA 1MX6A 1TNOA 3HYMB 4C0MA 3FUMA 1N4RA 4B94A 4XEIG 3MKQB 1Y8MA 3OXLA 2KM4A 5ITZF 2LAHA 2EIME 4HQDA 2YNQA 2YQ8A 1QNFA 5JJ7A 4F1SA 5B1BE 3CIAA 1AWCB 4WNGA 2Y4TA 4JA9A 3CQCB 1SZ9A 3HXCA 4IULA 3Q79A 3SNXA 5FT9A 4K5CA 3MV2B 5CEAA 4IN3B 2P58C 2X6KA 3KEAA 2B0OE 1JWFA 3VLEA 5AN8A 3X2QE 4F53A 4APOA 2DWZA 3FTSA 5EIBE 3CVPA 3V79K 4HOTA 3G2UA 4BEPA 5KBAA 2C0MA 4A3VA 4DX7D 3CLJA 1N95A 4XIFA 1N0QA 2DYRE 4XKCA 5G05J 4BX8A 4ZHBA 4XKBA 4TRQA 3CK7A 1N4QA 3PUKA 3ZIMA 5FJYA 5EN5D 2Q7FA 1QZ2A 4EQFA 3PZDA 4N3AA 4U95D 3KSQA 4UQXA 4B0ZA 5AJDA 3RIBA 2RKKA 1IHBA 2VTBB 3BU8A 1H6OA 3I4RB 3UM2A 3EHMA 3TL5A 4MRUA 1BD8A 2JABA 1WM5A 3G2VA 3S2AA 1V54E 3E33A 3L9TA 3VTXA 4JL0A 2KZTA 3E32A 4AEZC 3U4TA 2UY1A 4J8DA 2WXRA 3RO3A 2WVIA 2YINA 1JCQA 4H7XA 3CSFA 2VGEA 1ZU2A 3K9IA 3B95A 3CKBA 3ZW3A 4HNAD 1OWOA 3CGHA 3G2TA 1UN9A 3HXDA 4G1TA 3HG0D 4RG6A 4I9EA 5AQ9A 3U66A 3JYSA 4AIFA 3L13A 1OWMA 1HS6A 3ZYKA 2V5QC 5AJLA 1IQRA 3BQOA 3UINC 1S64A 2KCVA 3Q9UC 4B8AA 3EDTB 1DC2A 4ATGA 1OCOE 4GTPA 2CG2A 3G2SA 5EILA 3T5XA 2CHXA 5HKPA 4KZCA 1BI8B 4Y6CA 1UW4B 3FTUA 1QBQA 2XCBA 5LP0A 5JJTA 4N3BA 3FH8A 4APFA 4JXTA 1L5JA 3LJ3A 2QY7A 3EHQA 4RLYA 1S0PA 2ZGGA 4ATZD 5CERB 1OCRE 3B7TA 2AXVA 4JB8P 2XQ0A 2LO6A 2BEDA 1JWGA 4GPMA 5ENOD 3T9KA 1H19A 4HB5A 3JXIA 3FUDA 2WM9A 2L6JA 2F37A 4GA1A 4FA6A 3ULQA 3CHRA 3SFXA 2KCLA 3MA5A 3I4GA 2OOEA 3DSTA 5HS0A 2RG8A 4GMJA 1OWNA 3ASHA 5FQ6A 2FO1E 2AXUA 3QWPA 4ANVA 1HG2A 4CT0A 2CFUA 4FLBA 1BU9A 5DBKA 3SY2A 2LNIA 3ZYQA 2P9SG 5JA4D 2B6CA 5HRYA 2QZAA 5G55A 3DSVA 4FP7A 3B7SA 4KBQA 3J5PA 1QQEA 4GTQA 3DSUA 4JW1A 4B8CB 3UT7A 3SBSA 3PUJA 3L22A 3IV0A 4LNUD 2LXMA 3R9AB 5D0QD 2XZTG 4XZ4A 2BTDA 4EHMA 3OXFA 3MYVA 3ZXSA 2CHZA 5CMWA 3S7BA 2LSVA 1E90A 4AY5A 3D9HA 2FO7A 3RAUA 1OXJA 3PEVB 4GZCA 4ILGA 2VQ2A 2CFZA 4J8SA 3G2WA 3ONKA 3HHMA 4O1PA 2R59A 3UM1A 4MLPA 5KJKA 2I2OA 3QK0A 2L0IA
chains in the Genus database with same CATH topology
3AJIA 4C48B 3JXJA 5AN8A 4G8LA 3ZNGA 5CBOA 3SO8A 4HLLA 5BXUA 2BKGA 2DWZA 2DVWA 5AQ9A 5AQAA 3NOCD 5HS0A 5BXOA 1D9SA 5EIBE 4LG6A 4HRMB 3V79K 4UUCA 4N5QA 5AQBA 1G3NB 2BKKB 1MX2A 4B93B 3LJNA 5JMND 4BEPA 4QFVA 5KBAA 4HI9A 4DX7D 1N11A 1K3ZD 2FO1E 4O60A 1WDYA 3T8KA 2KBXA 1QYMA 3NOGD 2XENA 3W9FA 1SW6A 1N0QA 3V31A 2F8YA 3F6QA 4ZHBA 4F6RD 4DX5D 5EIDA 1BU9A 2V5QC 1IKND 4BSZB 1DCQA 3UI2A 3V2XA 3Q9NC 3TWVA 2ZGDA 5JA4D 2Y1LE 4HI8A 3ZKJA 5EN5D 5ENQD 5AAOA 4TUMA 5HRYA 3Q9UC 3TWQA 3B7BA 4DX6D 3TWWA 2XEEA 1DC2A 2ETAA 4YDWA 4K5AB 4U95D 5AQ7A 3UXGA 3J5PA 3NBNB 5EILA 4J7WA 4HRNA 1TR4A 1MJ0A 1YMPA 5FINA 4U8VD 2NYJA 5HKPA 1A5EA 1BI8B 1IHBA 4BETA 4Z68A 5CEDB 3UTMA 4DX2A 4DX1A 1K1AA 4LNUD 4YDYA 4K5BA 3V2OA 4BESA 4CZ2D 1OT8A 1BD8A 1K1BA 4F1PA 4J8YA 1MX4A 1MX6A 5KNGA 4O1OA 3AAAC 3DEOA 2AJAA 1UOHA 2JABA 2XZTG 3EU9A 2RFMA 2J8SD 2MYOA 2RFAA 4G8KA 4A63B 3DEPA 3ZUVB 2ETCA 3HRAA 5EYPF 2L6BA 1WG0A 5CBNA 3EHQA 4RLYA 2P2CP 2QC9A 5D66A 3TWTA 5ENRD 2ZGGA 4DRXE 4ATZD 2XZDG 4GMRA 3TWUA 5CERB 2ETBA 4LSZE 2PNNA 3ZU7B 1BLXB 4CYMD 1MYOA 5ITZF 2QYJA 3JUEA 1AP7A 2DZNA 4HQDA 3D9HA 4JB8P 1SVXA 5KNHD 3TWRA 4OAVB 1N0RA 1YCSB 3C5RA 5AARA 3W9GA 2VGEA 4GPMA 2KXPC 5ENOD 5ENTD 3T9KA 4DUIA 5KWDA 3B95A 5EYLA 4HB5A 1NFIE 1OY3D 3JXIA 4U96D 4HRLA 4BERA 1AWCB 4HBDA 4NIKA 3TWXA 5CECB 4HNAD 2F8XK 2HE0A 2F37A 5ENPD 2Y0BG 5ENSD 2A5EA 5FIOA 3TWSA 2XEHA 4O1PA 4K5CA 2DZOA 5CEAA 3EHRA 1BI7B 4U8YD 3IXEA 1S70B 2V4HC 3KEAA 4QQIA 3V30A 1YYHA 4ZFHA 2B0OE 4OAUC 1IXVA 3HG0D 3J5QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJI A;  4C48 B;  3JXJ A;  5AN8 A;  4G8L A;  3ZNG A;  5CBO A;  3SO8 A;  4HLL A;  5BXU A;  2BKG A;  2DWZ A;  2DVW A;  5AQ9 A;  5AQA A;  3NOC D;  5HS0 A;  5BXO A;  1D9S A;  5EIB E;  4LG6 A;  4HRM B;  3V79 K;  4UUC A;  4N5Q A;  5AQB A;  1G3N B;  2BKK B;  1MX2 A;  4B93 B;  3LJN A;  5JMN D;  4BEP A;  4QFV A;  5KBA A;  4HI9 A;  4DX7 D;  1N11 A;  1K3Z D;  2FO1 E;  4O60 A;  1WDY A;  3T8K A;  2KBX A;  1QYM A;  3NOG D;  2XEN A;  3W9F A;  1SW6 A;  1N0Q A;  3V31 A;  2F8Y A;  3F6Q A;  4ZHB A;  4F6R D;  4DX5 D;  5EID A;  1BU9 A;  2V5Q C;  1IKN D;  4BSZ B;  1DCQ A;  3UI2 A;  3V2X A;  3Q9N C;  3TWV A;  2ZGD A;  5JA4 D;  2Y1L E;  4HI8 A;  3ZKJ A;  5EN5 D;  5ENQ D;  5AAO A;  4TUM A;  5HRY A;  3Q9U C;  3TWQ A;  3B7B A;  4DX6 D;  3TWW A;  2XEE A;  1DC2 A;  2ETA A;  4YDW A;  4K5A B;  4U95 D;  5AQ7 A;  3UXG A;  3J5P A;  3NBN B;  5EIL A;  4J7W A;  4HRN A;  1TR4 A;  1MJ0 A;  1YMP A;  5FIN A;  4U8V D;  2NYJ A;  5HKP A;  1A5E A;  1BI8 B;  1IHB A;  4BET A;  4Z68 A;  5CED B;  3UTM A;  4DX2 A;  4DX1 A;  1K1A A;  4LNU D;  4YDY A;  4K5B A;  3V2O A;  4BES A;  4CZ2 D;  1OT8 A;  1BD8 A;  1K1B A;  4F1P A;  4J8Y A;  1MX4 A;  1MX6 A;  5KNG A;  4O1O A;  3AAA C;  3DEO A;  2AJA A;  1UOH A;  2JAB A;  2XZT G;  3EU9 A;  2RFM A;  2J8S D;  2MYO A;  2RFA A;  4G8K A;  4A63 B;  3DEP A;  3ZUV B;  2ETC A;  3HRA A;  5EYP F;  2L6B A;  1WG0 A;  5CBN A;  3EHQ A;  4RLY A;  2P2C P;  2QC9 A;  5D66 A;  3TWT A;  5ENR D;  2ZGG A;  4DRX E;  4ATZ D;  2XZD G;  4GMR A;  3TWU A;  5CER B;  2ETB A;  4LSZ E;  2PNN A;  3ZU7 B;  1BLX B;  4CYM D;  1MYO A;  5ITZ F;  2QYJ A;  3JUE A;  1AP7 A;  2DZN A;  4HQD A;  3D9H A;  4JB8 P;  1SVX A;  5KNH D;  3TWR A;  4OAV B;  1N0R A;  1YCS B;  3C5R A;  5AAR A;  3W9G A;  2VGE A;  4GPM A;  2KXP C;  5ENO D;  5ENT D;  3T9K A;  4DUI A;  5KWD A;  3B95 A;  5EYL A;  4HB5 A;  1NFI E;  1OY3 D;  3JXI A;  4U96 D;  4HRL A;  4BER A;  1AWC B;  4HBD A;  4NIK A;  3TWX A;  5CEC B;  4HNA D;  2F8X K;  2HE0 A;  2F37 A;  5ENP D;  2Y0B G;  5ENS D;  2A5E A;  5FIO A;  3TWS A;  2XEH A;  4O1P A;  4K5C A;  2DZO A;  5CEA A;  3EHR A;  1BI7 B;  4U8Y D;  3IXE A;  1S70 B;  2V4H C;  3KEA A;  4QQI A;  3V30 A;  1YYH A;  4ZFH A;  2B0O E;  4OAU C;  1IXV A;  3HG0 D;  3J5Q B; 
#chains in the Genus database with same CATH topology
 1PAQ A;  4C48 B;  3FTZ A;  3ZNG A;  4EZJ A;  5B1A E;  2XPZ A;  3ULY A;  3LJN A;  4RSY A;  1WY6 A;  3JUI A;  4WND A;  1QYM A;  1VDY A;  4U0U A;  5KCM A;  4YDE A;  1NA3 A;  4GTR A;  3CQG B;  3LYA A;  1ELR A;  3DBS A;  1Z3Y A;  3AS5 A;  3Q9N C;  3ESL A;  3TWQ A;  4DX6 D;  1TNY A;  1SZA A;  1MHQ A;  3QWV A;  3HXE A;  1RZ4 A;  2J9Q A;  2GRM A;  4DJA A;  3SF4 A;  3SBT B;  3CVQ A;  3CHS A;  4BET A;  3GZ1 A;  3ZVV A;  3R7R A;  1XGW A;  2LAI A;  1U2V G;  4F1P A;  3NF1 A;  3S7J A;  5KJM A;  3ASO E;  1E8Y A;  4AP2 A;  3Q4A B;  4CGV A;  2JLB A;  5FQ7 A;  1TNZ A;  2X6J A;  5A7D B;  3ZRH A;  1HH8 A;  3FFL A;  3CST A;  2Y69 E;  1BLX B;  4CYM D;  2DZN A;  4UI9 J;  4GZ6 A;  1O1R A;  4U04 A;  3FHE A;  4BTB A;  1JCR A;  3HVE B;  4Q69 A;  1NFI E;  4UQZ A;  2ZIR A;  3ASN E;  4TV3 A;  2EQX A;  1ZB1 A;  5BPP A;  4Q96 A;  5BV1 A;  2DZO A;  5AEN A;  4DI3 A;  3NZS A;  1HO8 A;  4HFG A;  4UQY A;  4DK5 A;  5FZR A;  1SA4 A;  1UN8 A;  4GTT A;  2YHC A;  4CT4 A;  5D0O D;  3GW4 A;  1K3Z D;  3EIJ A;  3T8K A;  3UPV A;  2F8Y A;  3ENE A;  3N71 A;  1DCQ A;  1W3B A;  3ONL A;  2WPV A;  1XNF A;  3V2X A;  4KMO A;  1B89 A;  3NB2 A;  4BT9 A;  3ASD A;  5T4Y A;  4M7C A;  4BFR A;  3U64 A;  4N39 A;  4K5A B;  3TG5 A;  3UXG A;  3WXX A;  4HRN A;  4JD2 G;  4NAC A;  3UT4 A;  2WQH A;  3LY7 A;  4DX2 A;  3FU6 A;  4F7A A;  2IQC A;  5AYW D;  3CVX A;  2C0L A;  4FC8 A;  1ZBP A;  1HFA A;  4HOQ A;  2ILR A;  3KD7 A;  4IRU A;  3ASF A;  4AV7 A;  4N3C A;  2P2C P;  5D66 A;  4BX9 A;  4GTS A;  2XZD G;  2VSN A;  3AG1 E;  2QYJ A;  2WXO A;  5AAR A;  1H2V C;  1NP7 A;  4GZD A;  3ZYM A;  4G2V A;  2I6H A;  2X6F A;  2XGO A;  3FY4 A;  4KZ0 A;  2EIL E;  2HE0 A;  4WWO A;  5AIJ A;  3ZHE A;  3L82 A;  3D9K A;  3PNL B;  5JHB A;  4C0E A;  4U7E B;  1TNU A;  1O1T A;  2XCC A;  3FP3 A;  4H7Y A;  1D9S A;  3FUL A;  3LS8 A;  3PE4 A;  3PRZ A;  1MX2 A;  3PH0 C;  2X6H A;  2IU1 A;  5FQ4 A;  2KC7 A;  1E7U A;  4AJW A;  2XS8 A;  4L23 A;  1N52 A;  4BWR A;  2KZT B;  4L2L A;  5CHE E;  2ETA A;  4BSX A;  4FJY A;  3S7D A;  2A5U A;  2WMO A;  4I6G A;  2IOL A;  4CCA A;  3DSX A;  4G23 A;  3UTM A;  4LEU A;  2VGX A;  3V2O A;  5LCW C;  3ZGQ A;  5KNG A;  2CHW A;  2P9P G;  2MYO A;  4A63 B;  2R5S A;  1N54 A;  3DXM G;  2QC9 A;  2X6I A;  2ETB A;  1H0A A;  3OXG A;  1MYO A;  3TJP A;  4AM9 A;  3MKQ A;  3IHY A;  3UMV A;  1N4P A;  3MV3 B;  1V55 E;  4ME2 A;  4OYS A;  4FAD A;  2H6I A;  5ENS D;  5FTP A;  4BTA A;  4ACK A;  2AXZ A;  4GAA A;  1U3C A;  3B7R L;  4HOS A;  2V5F A;  4QQI A;  4Q94 A;  4P29 A;  4GTO A;  4I1O B;  3O4Z A;  4GZ5 A;  1MZC A;  4G8L A;  4L9P A;  2DVW A;  1EDU A;  4GZ3 A;  5CRU A;  4JVS A;  4HOU A;  3HIZ A;  2BKK B;  4B93 B;  2J07 A;  4JEU A;  2KBX A;  3HXB A;  1E8W A;  2XEN A;  1Z6T A;  3Q75 A;  3D9L A;  2XEV A;  3QNK A;  3EJN A;  4J8F A;  1E7V A;  1HF8 A;  3CHO A;  3RRM B;  2NC9 A;  2Y1L E;  1HX8 A;  2ION A;  1HG5 A;  3KSL A;  3ASG A;  4YDW A;  3IKO B;  3E34 A;  4I2W A;  3D3M A;  4CRW A;  1TR4 A;  5B3S E;  2V0P A;  2P9K G;  3BEE A;  3ML9 A;  4DX1 A;  2HYZ A;  3WG7 E;  4CZ2 D;  5A23 A;  4R7L A;  2R17 C;  4C9B B;  2RFM A;  2J49 A;  2ZIS A;  4UI9 C;  3BUA A;  2NXP A;  3UM0 A;  3ABL E;  3JUE A;  3PEU B;  2WXK A;  4NQ0 A;  3QJZ A;  3W9G A;  4KVM A;  1U3D A;  3E30 A;  1OY3 D;  3FTW A;  1ELK A;  3TAX A;  4CDM A;  3PNT B;  2R02 A;  2WXF A;  2FUL A;  5EX0 A;  2P9U G;  3ZPJ A;  4TUU A;  2V4L A;  3B13 A;  2EIN E;  1GW6 A;  4E85 A;  1YYH A;  1OCZ E;  3FH7 A;  3AJI A;  2PL2 A;  5CRV A;  2AWI A;  1HZ4 A;  1NA0 A;  3EHN A;  3UM3 A;  1H6K A;  2PZI A;  3FEX A;  4TXQ A;  1NL4 A;  2VSY A;  5E76 A;  1TNB A;  1N9A A;  5D2M C;  2J08 A;  2OCC E;  1IQU A;  2GRR B;  4JPS A;  3UKR G;  2ZGD A;  3FUI A;  3ZKJ A;  4V3I A;  3AS8 A;  2XEE A;  4J7W A;  2HO1 A;  2NYJ A;  2XRZ A;  3DWL G;  4MKT A;  1EYH A;  1DCE A;  3QDN A;  1H2U A;  1UG3 A;  4F3V A;  5T8I A;  3ISM C;  4FJZ A;  3AAA C;  4I2Z A;  4WUY A;  1LD8 A;  3LXU X;  2J4D A;  4G8K A;  3FH5 A;  4K03 A;  3RO2 A;  5CBN A;  2EIK E;  1INZ A;  3AU5 A;  3ZU7 B;  2PNN A;  1D8E A;  1SA5 A;  4OAV B;  2H6H A;  3C5R A;  5EX3 A;  2M63 A;  4XI0 A;  4L2Y A;  3ESK A;  5LCW J;  2L0T B;  1DVP A;  3TWS A;  4UI9 K;  1JCS A;  3UKU G;  3R7Q A;  2X3M A;  1DNP A;  5C1D A;  3PVL A;  3SO8 A;  5BXU A;  2XPI A;  5BXO A;  5JJ6 A;  2R03 A;  2WXJ A;  4HRM B;  3CHM A;  3FUJ A;  3L6A A;  4I9C A;  2E0I A;  3SI5 A;  3VTY A;  3FUK A;  3LY9 A;  3LDZ A;  1PC2 A;  3V31 A;  3SFZ A;  3ZFW A;  4DX5 D;  1FPP A;  2XS1 A;  5EKQ D;  1EPU A;  3SQV A;  1TN7 A;  4GYW A;  4PS7 A;  3E4B A;  4U8V D;  1A5E A;  2WB2 A;  3SHF A;  1MQS A;  5CED B;  3MX3 A;  4FU3 A;  4K5B A;  4JZY A;  2GGF A;  1KT1 A;  1OT8 A;  3LEW A;  4GML A;  1OWP A;  3Q78 A;  3GYZ A;  2J8S D;  2VSX E;  2I9C A;  4KT6 B;  2RD0 A;  3TWT A;  4LSZ E;  2OEV A;  3S7F A;  1OUV A;  2P9N G;  3Q73 A;  3SFY A;  5KWD A;  2XHE A;  5E75 A;  3L17 A;  2WXM A;  4HRL A;  2WXG A;  1ELW A;  4AY6 A;  4XI9 A;  3TWX A;  4ANW A;  3UIP C;  2Y4U A;  3D9J A;  2A5E A;  2J4B A;  5H7P A;  1LTX A;  3EHR A;  5J08 A;  5EDS A;  3QB2 A;  5AQA A;  3FUF A;  4YDO A;  4GCN A;  4LG6 A;  4UUC A;  5LOZ A;  5AQB A;  4G24 A;  3KAE A;  5LX8 A;  3UUX A;  1TJC A;  4I43 A;  4NUR A;  5BUZ A;  2E2E A;  2I1J A;  5G04 J;  3ML8 A;  5ENQ D;  4CDR A;  3U9W A;  5ARF A;  3SGH A;  3RSE G;  1PY1 A;  3QWW A;  1YMP A;  4GYY A;  4OVV A;  3NZU A;  3CVY A;  4ILI A;  4I1A A;  4LRZ A;  4TXP A;  4W9R A;  3E37 A;  4UWL A;  4FHK A;  2ETC A;  5A6C A;  3DSW A;  3IHV A;  3QC1 A;  3U3W A;  5FWQ A;  3LPZ A;  4I6E A;  3RJV A;  3QKY A;  1SVX A;  5KNH D;  3RK6 A;  1YCS B;  4DUI A;  5EYL A;  1YA0 A;  4FHJ A;  2YHE A;  2R05 A;  3HVE A;  3OTN A;  2NSZ A;  3GZS A;  3GZ2 A;  3EU5 A;  1BI7 B;  4HS2 A;  2V4H C;  3PZ2 A;  4A1S A;  2IY0 C;  3Q47 B;  4DI4 A;  1IXV A;  1O5M A;  3J5Q B;  4TXR A;  1FT1 A;  2BKG A;  3CVW A;  3FUE A;  2GRQ B;  5JHA A;  2P9I G;  4WWN A;  1KZP A;  4YVO A;  4HI9 A;  1NI1 A;  3NAW A;  4CGW A;  4JEH A;  1Z3X A;  4E6H A;  3C3R A;  3L08 A;  4LNG A;  4O6F A;  3C98 A;  2I1K A;  4HXI A;  1P5Q A;  3R9M A;  3UIO C;  4ANU A;  3FU5 A;  4UWG A;  2VYI A;  1MJ0 A;  2GRN B;  4Y6W A;  3DPD A;  3D9I A;  4ABN A;  3APC A;  3PZ3 A;  3RRN B;  1MX4 A;  3P1U A;  3DEO A;  2XGS A;  4I1M A;  4BY6 A;  3HRA A;  4MBG A;  5EYP F;  2L6B A;  2PQN A;  5CMY A;  2UY1 B;  4PS3 A;  1WAO 1;  5FZQ A;  2X38 A;  2BUG A;  5FZS A;  4JHJ A;  4RVB A;  4I17 A;  4G26 A;  4EZK A;  2H6G A;  3CK8 A;  5IY5 E;  4WAF A;  1RW2 A;  4AXH A;  4HBD A;  4NIK A;  1H2T C;  2P9L G;  4ACL A;  4YVQ C;  3LY8 A;  3TGO A;  1TJF A;  4U8Y D;  3L54 A;  2FI7 A;  3FU3 A;  3CVV A;  1N94 A;  5BV0 A;  5BNW A;  2JEK A;  4DLQ A;  5CBO A;  4HLL A;  3PE3 A;  2HM8 A;  2FBN A;  1G3N B;  3CKC A;  3APD A;  4QFV A;  3T5V A;  3W9F A;  4KYO B;  5CCM A;  2FF4 A;  3PZ1 A;  4FLH A;  4CEM A;  4MS6 A;  3ABM E;  1E96 B;  3CVU A;  2HR2 A;  4HI8 A;  3OAW A;  5AAO A;  3HXF A;  4RQI A;  3MJW A;  2IO3 C;  1E8X A;  2PQR A;  5KJL A;  4Z68 A;  3MGB A;  3KEZ A;  2DYS E;  4BES A;  3TXM A;  2Y3A A;  4U0S A;  4HLE A;  1KPS B;  2XGM A;  2MHK A;  1FT2 A;  4CDN A;  3DEP A;  4K0R A;  4GTM A;  2IO2 C;  3AS4 A;  4PUC A;  3UX4 A;  5ENN A;  1OWL A;  5G2N A;  4NRH B;  3C3O A;  2ZU6 B;  3APF A;  1KT0 A;  5ENT D;  3FTX A;  2VTB A;  1IYG A;  5HI7 A;  3PRE A;  4U96 D;  5M72 A;  2KCK A;  3CHP A;  4GCO A;  4B89 A;  2XRY A;  4G25 A;  3MEK A;  1NZN A;  3CVN A;  3CV0 A;  2AW6 A;  3FDH A;  3URZ A;  2DIW A;  2A4Z A;  3C72 A;  4WNF A;  3QAR A;  3FTY A;  3V30 A;  4N2Q A;  5FQ8 A;  3D9M A;  2V8S E;  1N4S A;  3Q49 B;  1X81 A;  4UWK A;  1HU3 A;  4RG9 A;  1Z5S C;  1WDY A;  3NOG D;  3LKU A;  4KXK B;  5G04 C;  3I3N A;  3MKR A;  3AG2 E;  4LCT A;  4BSZ B;  4L7T A;  2WMN A;  3DXK G;  3TWV A;  4JHR A;  2OVF A;  3FU0 A;  2LXL A;  1TN8 A;  3PZ4 A;  1UJJ A;  5AQ7 A;  1Q2Z A;  2GRO B;  4XE0 A;  4GU5 A;  3ABK E;  3ULE G;  3RKV A;  1S63 A;  3CHQ A;  1TYQ G;  2C2L A;  4GA0 A;  4YDY A;  3CEQ A;  3B7U X;  2H6F A;  4PDX A;  3C3Q A;  3LCA A;  4O1O A;  1HXI A;  2MRI A;  3JQ0 A;  1FCH A;  4U07 A;  5HQ8 A;  4JHK A;  2MOW A;  2UWJ G;  1JPL A;  3IEG A;  1AP7 A;  2WXQ A;  3TWR A;  4I6J A;  3FUH A;  3PS6 A;  4N5C A;  5BW8 C;  3UQ3 A;  5BT1 A;  4GB9 A;  2WXN A;  4EBA G;  4DPR A;  4BER A;  3CK9 A;  4EBA A;  5ENP D;  2Y0B G;  2PM6 A;  4LNB A;  5FIO A;  2LSU A;  3ZYL A;  2XEH A;  4XX5 A;  2KAT A;  2WQ7 A;  4OAU C;  3JCK C;  3Q5M A;  3MZL B;  3JXJ A;  4GTV A;  2WXP A;  3NOC D;  1OCC E;  3JQ1 A;  4O60 A;  2PM7 A;  1E8Z A;  1UJK A;  4URK A;  3FEY A;  4IYP A;  4HVB A;  1IKN D;  2ZXW E;  3HDX A;  2GW1 A;  3BG0 B;  3FWV A;  5KJN A;  3TWW A;  3LVQ E;  3QAQ A;  1H6P A;  2EIJ E;  3NBN B;  5FIN A;  3CVL A;  3VLF A;  3MCX A;  4GA2 A;  2J09 A;  1FVF A;  2BF0 X;  3FTV A;  3ZXP A;  1UOH A;  3EU9 A;  3ZEF A;  3ZN3 A;  5C2Y A;  3LVR E;  1WG0 A;  2IFU A;  2QFC A;  4ILH B;  3DSS A;  4GPK A;  3DRA A;  1K8K G;  3D9O A;  1JUQ A;  2KXP C;  4WNE A;  3Q15 A;  4G11 A;  3EUV A;  2IEJ A;  2FEZ A;  4J6I A;  5G05 C;  3D9N A;  4GYO A;  3O48 A;  4BT8 A;  1S70 B;  4FUL A;  4A3T A;  1KLX A;  1HE8 A;  3P2B A;  4EZL A;  4DLO A;  4M3O A;  2CG3 A;  2IF4 A;  2WXI A;  4JA7 A;  1SW6 A;  4F6R D;  4UWF A;  5EID A;  3AU4 A;  4KVO A;  4PH4 B;  4AVX A;  4HOR A;  1SQM A;  4J8E A;  2GRP B;  3RU0 A;  2F0Y A;  4TUM A;  2LUH A;  1KZO A;  2VSO E;  4EEC A;  4JC8 A;  3PDN A;  1FVH A;  3CR3 A;  5CCL A;  2VJ8 A;  2WXL A;  3Q7F A;  1K1A A;  3NQP A;  4PS8 A;  1BPO A;  4U8H A;  2AJA A;  4A1G A;  2GRL A;  2RFA A;  4EPZ A;  4ANX A;  3ZUV B;  5ENR D;  4DRX E;  4GMR A;  3TWU A;  5J90 A;  5ANR A;  5ARG A;  2R2L A;  1N0R A;  4UWH A;  3T8M A;  5LFA A;  2OEW A;  1LD7 A;  2QYU A;  3AG3 E;  3AG4 E;  4U0Z A;  4J0U A;  3RRU A;  3ZHE B;  5CEC B;  2F8X K;  2WXH A;  3I5P A;  1TN6 A;  2VGY A;  1D8D A;  2DCP A;  2OND A;  3KS2 A;  3QOU A;  3Q7A A;  4LER A;  3IXE A;  3SZ7 A;  4ZFH A;  4AOF A;  2OV8 A;  1EF1 C;  2L9B A;  2OVB A;  4N2S A;  4N5Q A;  5JMN D;  4U63 A;  3SD5 A;  3EIQ C;  3TG4 A;  1N11 A;  1X5B A;  5T3R A;  2DBA A;  1Y6I A;  3L16 A;  3F6Q A;  2AVP A;  3IBE A;  3UI2 A;  4YND A;  4OVU A;  2WQ6 A;  4WWP A;  1A17 A;  4D10 C;  3B7B A;  3FUN A;  4L1B A;  3UT8 A;  4A55 A;  1LF8 A;  2XPY A;  3BG1 B;  4LUN U;  4X8Q A;  2VGX B;  3DPY A;  5ANL A;  1IHG A;  1TEZ A;  2IJG X;  5DIZ A;  3TXN A;  2IOS A;  3D9P A;  3VLD A;  1O1S A;  1K1B A;  4J8Y A;  1MX6 A;  1TNO A;  3HYM B;  4C0M A;  3FUM A;  1N4R A;  4B94 A;  4XEI G;  3MKQ B;  1Y8M A;  3OXL A;  2KM4 A;  5ITZ F;  2LAH A;  2EIM E;  4HQD A;  2YNQ A;  2YQ8 A;  1QNF A;  5JJ7 A;  4F1S A;  5B1B E;  3CIA A;  1AWC B;  4WNG A;  2Y4T A;  4JA9 A;  3CQC B;  1SZ9 A;  3HXC A;  4IUL A;  3Q79 A;  3SNX A;  5FT9 A;  4K5C A;  3MV2 B;  5CEA A;  4IN3 B;  2P58 C;  2X6K A;  3KEA A;  2B0O E;  1JWF A;  3VLE A;  5AN8 A;  3X2Q E;  4F53 A;  4APO A;  2DWZ A;  3FTS A;  5EIB E;  3CVP A;  3V79 K;  4HOT A;  3G2U A;  4BEP A;  5KBA A;  2C0M A;  4A3V A;  4DX7 D;  3CLJ A;  1N95 A;  4XIF A;  1N0Q A;  2DYR E;  4XKC A;  5G05 J;  4BX8 A;  4ZHB A;  4XKB A;  4TRQ A;  3CK7 A;  1N4Q A;  3PUK A;  3ZIM A;  5FJY A;  5EN5 D;  2Q7F A;  1QZ2 A;  4EQF A;  3PZD A;  4N3A A;  4U95 D;  3KSQ A;  4UQX A;  4B0Z A;  5AJD A;  3RIB A;  2RKK A;  1IHB A;  2VTB B;  3BU8 A;  1H6O A;  3I4R B;  3UM2 A;  3EHM A;  3TL5 A;  4MRU A;  1BD8 A;  2JAB A;  1WM5 A;  3G2V A;  3S2A A;  1V54 E;  3E33 A;  3L9T A;  3VTX A;  4JL0 A;  2KZT A;  3E32 A;  4AEZ C;  3U4T A;  2UY1 A;  4J8D A;  2WXR A;  3RO3 A;  2WVI A;  2YIN A;  1JCQ A;  4H7X A;  3CSF A;  2VGE A;  1ZU2 A;  3K9I A;  3B95 A;  3CKB A;  3ZW3 A;  4HNA D;  1OWO A;  3CGH A;  3G2T A;  1UN9 A;  3HXD A;  4G1T A;  3HG0 D;  4RG6 A;  4I9E A;  5AQ9 A;  3U66 A;  3JYS A;  4AIF A;  3L13 A;  1OWM A;  1HS6 A;  3ZYK A;  2V5Q C;  5AJL A;  1IQR A;  3BQO A;  3UIN C;  1S64 A;  2KCV A;  3Q9U C;  4B8A A;  3EDT B;  1DC2 A;  4ATG A;  1OCO E;  4GTP A;  2CG2 A;  3G2S A;  5EIL A;  3T5X A;  2CHX A;  5HKP A;  4KZC A;  1BI8 B;  4Y6C A;  1UW4 B;  3FTU A;  1QBQ A;  2XCB A;  5LP0 A;  5JJT A;  4N3B A;  3FH8 A;  4APF A;  4JXT A;  1L5J A;  3LJ3 A;  2QY7 A;  3EHQ A;  4RLY A;  1S0P A;  2ZGG A;  4ATZ D;  5CER B;  1OCR E;  3B7T A;  2AXV A;  4JB8 P;  2XQ0 A;  2LO6 A;  2BED A;  1JWG A;  4GPM A;  5ENO D;  3T9K A;  1H19 A;  4HB5 A;  3JXI A;  3FUD A;  2WM9 A;  2L6J A;  2F37 A;  4GA1 A;  4FA6 A;  3ULQ A;  3CHR A;  3SFX A;  2KCL A;  3MA5 A;  3I4G A;  2OOE A;  3DST A;  5HS0 A;  2RG8 A;  4GMJ A;  1OWN A;  3ASH A;  5FQ6 A;  2FO1 E;  2AXU A;  3QWP A;  4ANV A;  1HG2 A;  4CT0 A;  2CFU A;  4FLB A;  1BU9 A;  5DBK A;  3SY2 A;  2LNI A;  3ZYQ A;  2P9S G;  5JA4 D;  2B6C A;  5HRY A;  2QZA A;  5G55 A;  3DSV A;  4FP7 A;  3B7S A;  4KBQ A;  3J5P A;  1QQE A;  4GTQ A;  3DSU A;  4JW1 A;  4B8C B;  3UT7 A;  3SBS A;  3PUJ A;  3L22 A;  3IV0 A;  4LNU D;  2LXM A;  3R9A B;  5D0Q D;  2XZT G;  4XZ4 A;  2BTD A;  4EHM A;  3OXF A;  3MYV A;  3ZXS A;  2CHZ A;  5CMW A;  3S7B A;  2LSV A;  1E90 A;  4AY5 A;  3D9H A;  2FO7 A;  3RAU A;  1OXJ A;  3PEV B;  4GZC A;  4ILG A;  2VQ2 A;  2CFZ A;  4J8S A;  3G2W A;  3ONK A;  3HHM A;  4O1P A;  2R59 A;  3UM1 A;  4MLP A;  5KJK A;  2I2O A;  3QK0 A;  2L0I A; 
#chains in the Genus database with same CATH homology
 3AJI A;  4C48 B;  3JXJ A;  5AN8 A;  4G8L A;  3ZNG A;  5CBO A;  3SO8 A;  4HLL A;  5BXU A;  2BKG A;  2DWZ A;  2DVW A;  5AQ9 A;  5AQA A;  3NOC D;  5HS0 A;  5BXO A;  1D9S A;  5EIB E;  4LG6 A;  4HRM B;  3V79 K;  4UUC A;  4N5Q A;  5AQB A;  1G3N B;  2BKK B;  1MX2 A;  4B93 B;  3LJN A;  5JMN D;  4BEP A;  4QFV A;  5KBA A;  4HI9 A;  4DX7 D;  1N11 A;  1K3Z D;  2FO1 E;  4O60 A;  1WDY A;  3T8K A;  2KBX A;  1QYM A;  3NOG D;  2XEN A;  3W9F A;  1SW6 A;  1N0Q A;  3V31 A;  2F8Y A;  3F6Q A;  4ZHB A;  4F6R D;  4DX5 D;  5EID A;  1BU9 A;  2V5Q C;  1IKN D;  4BSZ B;  1DCQ A;  3UI2 A;  3V2X A;  3Q9N C;  3TWV A;  2ZGD A;  5JA4 D;  2Y1L E;  4HI8 A;  3ZKJ A;  5EN5 D;  5ENQ D;  5AAO A;  4TUM A;  5HRY A;  3Q9U C;  3TWQ A;  3B7B A;  4DX6 D;  3TWW A;  2XEE A;  1DC2 A;  2ETA A;  4YDW A;  4K5A B;  4U95 D;  5AQ7 A;  3UXG A;  3J5P A;  3NBN B;  5EIL A;  4J7W A;  4HRN A;  1TR4 A;  1MJ0 A;  1YMP A;  5FIN A;  4U8V D;  2NYJ A;  5HKP A;  1A5E A;  1BI8 B;  1IHB A;  4BET A;  4Z68 A;  5CED B;  3UTM A;  4DX2 A;  4DX1 A;  1K1A A;  4LNU D;  4YDY A;  4K5B A;  3V2O A;  4BES A;  4CZ2 D;  1OT8 A;  1BD8 A;  1K1B A;  4F1P A;  4J8Y A;  1MX4 A;  1MX6 A;  5KNG A;  4O1O A;  3AAA C;  3DEO A;  2AJA A;  1UOH A;  2JAB A;  2XZT G;  3EU9 A;  2RFM A;  2J8S D;  2MYO A;  2RFA A;  4G8K A;  4A63 B;  3DEP A;  3ZUV B;  2ETC A;  3HRA A;  5EYP F;  2L6B A;  1WG0 A;  5CBN A;  3EHQ A;  4RLY A;  2P2C P;  2QC9 A;  5D66 A;  3TWT A;  5ENR D;  2ZGG A;  4DRX E;  4ATZ D;  2XZD G;  4GMR A;  3TWU A;  5CER B;  2ETB A;  4LSZ E;  2PNN A;  3ZU7 B;  1BLX B;  4CYM D;  1MYO A;  5ITZ F;  2QYJ A;  3JUE A;  1AP7 A;  2DZN A;  4HQD A;  3D9H A;  4JB8 P;  1SVX A;  5KNH D;  3TWR A;  4OAV B;  1N0R A;  1YCS B;  3C5R A;  5AAR A;  3W9G A;  2VGE A;  4GPM A;  2KXP C;  5ENO D;  5ENT D;  3T9K A;  4DUI A;  5KWD A;  3B95 A;  5EYL A;  4HB5 A;  1NFI E;  1OY3 D;  3JXI A;  4U96 D;  4HRL A;  4BER A;  1AWC B;  4HBD A;  4NIK A;  3TWX A;  5CEC B;  4HNA D;  2F8X K;  2HE0 A;  2F37 A;  5ENP D;  2Y0B G;  5ENS D;  2A5E A;  5FIO A;  3TWS A;  2XEH A;  4O1P A;  4K5C A;  2DZO A;  5CEA A;  3EHR A;  1BI7 B;  4U8Y D;  3IXE A;  1S70 B;  2V4H C;  3KEA A;  4QQI A;  3V30 A;  1YYH A;  4ZFH A;  2B0O E;  4OAU C;  1IXV A;  3HG0 D;  3J5Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...