5ENPD

Mbx2931 bound structure of bacterial efflux pump.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
b'HHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein
total genus 52
structure length 161
sequence length 161
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enpD00
5CECB 2B0OE 4F6RD 3KEAA 3LJNA 5AQAA 4BESA 4DX2A 1D9SA 5ENQD 4HRNA 2RFMA 4J8YA 5ENPD 5BXUA 4K5BA 5EN5D 5ENRD 3T9KA 5JA4D 3TWWA 4B93B 1N0QA 1N11A 1IXVA 4HI9A 4HRMB 3TWRA 3Q9UC 1K1BA 1A5EA 2DZOA 4HB5A 4BETA 4OAVB 2FO1E 4CYMD 4HNAD 1AP7A 1DC2A 1K1AA 5AQBA 2QYJA 1MYOA 2DVWA 2ETBA 3EHRA 4N5QA 5JMND 1N0RA 5BXOA 3Q9NC 5AQ9A 2F8XK 3V79K 2VGEA 2V5QC 1G3NB 4HBDA 5ENOD 5HKPA 1SW6A 2J8SD 4DX5D 4HI8A 4U8VD 3TWXA 5CBNA 2F8YA 4A63B 1YCSB 2XZTG 4U96D 3UI2A 3TWQA 2DZNA 4JB8P 5AQ7A 2KXPC 5HS0A 5CBOA 4HQDA 5EIDA 3B95A 4C48B 4K5AB 3D9HA 1S70B 4F1PA 2KBXA 2BKGA 5EYLA 3SO8A 3JUEA 4J7WA 4DX6D 5EIBE 4U8YD 1QYMA 3TWUA 1OT8A 2ETAA 1MX6A 3ZUVB 4YDWA 3JXIA 4CZ2D 3EU9A 2V4HC 2MYOA 1UOHA 4O1PA 2XENA 2F37A 2ZGGA 5KNHD 3V2XA 4BERA 4UUCA 4G8LA 4LG6A 1YMPA 4LNUD 4QFVA 4O1OA 1WG0A 1DCQA 4RLYA 2HE0A 5D66A 5EILA 4GPMA 4NIKA 5CERB 4G8KA 1BI7B 3JXJA 1YYHA 1NFIE 4GMRA 3TWVA 3C5RA 4BSZB 5CEAA 4OAUC 1OY3D 2JABA 2XEEA 4K5CA 3NOCD 3W9FA 4YDYA 2ZGDA 4ZHBA 5HRYA 5ENSD 3NBNB 4Z68A 3ZU7B 1MX2A 1MX4A 1TR4A 4ZFHA 2A5EA 3UTMA 1K3ZD 4U95D 3F6QA 1WDYA 2P2CP 2XEHA 5ENTD 2NYJA 5KBAA 4O60A 3B7BA 5FIOA 4BEPA 5AAOA 2PNNA 3AAAC 1BD8A 5CEDB 3T8KA 3DEPA 4HRLA 5KNGA 3HRAA 4LSZE 4TUMA 1IKND 4DRXE 4ATZD 1BLXB 2XZDG 1BI8B 3HG0D 3V31A 2QC9A 5ITZF 3IXEA 5AN8A 1IHBA 2AJAA 2Y1LE 4DX7D 5EYPF 2DWZA 3ZNGA 5FINA 2L6BA 3W9GA 3J5PA 3V2OA 3UXGA 5KWDA 3TWSA 1BU9A 3DEOA 4HLLA 2RFAA 1AWCB 2Y0BG 4DX1A 3EHQA 4QQIA 3AJIA 1MJ0A 2BKKB 5AARA 3NOGD 3TWTA 3J5QB 4DUIA 3V30A 2ETCA 1SVXA 3ZKJA
chains in the Genus database with same CATH superfamily
4FJYA 2XPZA 3KEAA 4DX2A 3FUJA 4J8SA 4HRNA 3PEUB 4WWPA 4I1AA 3GZ1A 3D9KA 2WVIA 4L1BA 2E2EA 4NURA 2FO1E 1AP7A 3CQCB 3T5XA 2CHXA 2J4DA 3P2BA 2EQXA 3TWXA 4CGVA 4GA2A 4EZLA 4U96D 4UI9C 5KCMA 5HS0A 2WXNA 1E8YA 4J7WA 2VTBA 2PL2A 1E96B 4HOUA 1TNBA 3LKUA 4J0UA 2V4HC 2XENA 4G8LA 4RLYA 4F3VA 4Y6WA 3U64A 5JJTA 3G2SA 3VTXA 4N3AA 4D10C 1OCZE 4JHRA 3CVVA 1PAQA 2X6IA 3UKUG 4NACA 5ENTD 2P9KG 2NYJA 4AY6A 2FO7A 3EIJA 4L2LA 2P9PG 4EBAA 3PNTB 3LS8A 3HXDA 2BF0X 2RG8A 3Q47B 3HVEB 2Y1LE 3RO3A 3Q73A 3L22A 5KWDA 5FQ8A 3HXFA 4FLHA 4G25A 3MA5A 3SFZA 3V30A 2H6GA 3CIAA 3UX4A 4XX5A 2BTDA 3B13A 5FQ6A 2ZU6B 1FT2A 3HIZA 3CK8A 2ETBA 2CHZA 3D9MA 2V5QC 5HKPA 3NZSA 4UWGA 4RG6A 3QK0A 2WXGA 3B7SA 1HO8A 3FUHA 3IKOB 5JHBA 3APCA 2KZTB 2R05A 2WMNA 4K0RA 2ZGGA 4BERA 3P1UA 3FY4A 3QC1A 3QKYA 4HOQA 2IONA 1QQEA 3FU3A 1MX2A 2X38A 5G05J 1H6KA 3F6QA 3MCXA 4KVOA 4GYYA 4GTTA 4Q96A 3FU5A 1BLXB 2P9LG 4YVQC 3TXMA 3V31A 4BWRA 3AG4E 4HORA 1LF8A 2AJAA 4GTQA 2XRYA 1LD7A 1YA0A 2L6BA 1HX8A 1DVPA 2ONDA 4TXQA 3DXKG 4PS8A 5EX0A 5CCMA 2IJGX 3L13A 4Q69A 5B3SE 1TNYA 4V3IA 4ANXA 2DZOA 1DC2A 2VTBB 2QYJA 2DVWA 3L82A 5M72A 4A63B 2R03A 4J8FA 4FULA 3ASNE 4ATGA 2R5SA 1EYHA 3SO8A 5KJMA 2DYRE 4I9EA 4U8YD 5LCWC 3E4BA 2VQ2A 4DI3A 4RG9A 3FTYA 3UM0A 4TXPA 1INZA 5C2YA 1WG0A 1JUQA 5CERB 4GPMA 4E85A 2DYSE 4PS7A 1YYHA 1U2VG 4K5CA 4CDMA 4KT6B 4U0SA 2MHKA 5EKQD 3U9WA 4Z68A 1ZB1A 3D9JA 3QB2A 2PM7A 4ZFHA 4N2QA 3FUMA 4I6EA 5JHAA 2AVPA 3FH5A 2LXLA 4I6GA 4IRUA 4KZCA 2X6KA 5ARGA 2QC9A 3NQPA 3ASFA 5BPPA 1OWNA 4HLLA 3I3NA 3AJIA 3Q4AB 3SF4A 4XI9A 1H6PA 3CQGB 4F6RD 3OAWA 1D9SA 2WPVA 3ZW3A 1K8KG 1E7UA 4K5BA 1HU3A 2VJ8A 4GB9A 4CT4A 5CMYA 5AENA 3D9OA 5H7PA 4BY6A 4YVOA 3SY2A 4DLOA 3Q5MA 1VDYA 3HHMA 3ENEA 4U7EB 5BUZA 2VGXA 4I1MA 4R7LA 4KMOA 5AQ7A 2KXPC 3D9HA 5DBKA 4AM9A 1OT8A 1PY1A 2WXRA 4O1PA 5AJLA 4J8DA 3ONLA 2OVFA 1JWGA 1JWFA 5EILA 2OEVA 3ZN3A 4XZ4A 4UWLA 1O5MA 3S7DA 1W3BA 1N4PA 4YDYA 2QFCA 3AG1E 3SD5A 4UQZA 3RKVA 1TNUA 2Y3AA 3B7TA 3HXEA 4LRZA 3DSTA 1FCHA 4RQIA 3D9NA 3HXCA 1OCRE 3PH0C 2J09A 5EYPF 1JCSA 2YHEA 3FH7A 3DBSA 3V2OA 2I1JA 1N9AA 4J6IA 2J08A 2Y0BG 1TNOA 3EHQA 2KATA 4FLBA 5ARFA 3S7BA 5BNWA 4IN3B 3OTNA 3KEZA 4FA6A 4OVUA 5ENRD 3Q9UC 3TXNA 1K1AA 3FH8A 1E8ZA 3PZ1A 5BXOA 1SW6A 3AU5A 5ANLA 3FTWA 3KAEA 5CBNA 3C98A 4PS3A 1KLXA 4G24A 1OCOE 2BKGA 2XHEA 4E6HA 1NZNA 2DCPA 2L0IA 3PZDA 5FT9A 3MYVA 2EIME 4LNUD 3ZYMA 2B6CA 5D66A 4KZ0A 3DSWA 3L08A 1BI7B 3L6AA 2IY0C 4WUYA 2IO3C 4APOA 2ZXWE 3CKBA 3FHEA 2R02A 4GTVA 5KBAA 5FIOA 4N3BA 2PNNA 3GZSA 3T8KA 3CSFA 3RSEG 4TXRA 4MBGA 5AJDA 5KJNA 3FTZA 3OXLA 3G2UA 1KT0A 2V8SE 2XS8A 1MQSA 1JCQA 2PQNA 5E75A 4APFA 2R17C 4DX1A 2OVBA 4U04A 4JHJA 5BW8C 4KVMA 5A23A 3JYSA 4XKCA 5J90A 4ILGA 3U66A 4X8QA 2VGXB 2AW6A 4J8YA 5E76A 4Y6CA 4A3TA 1IXVA 3JUIA 4JL0A 3CVQA 3RU0A 1TNZA 4B89A 2I2OA 2DBAA 1SA4A 4O6FA 3LVRE 1OWLA 4G2VA 3UIOC 4C48B 1S70B 4GZ3A 4DX6D 4ANUA 4IYPA 3TAXA 3BEEA 3JXJA 4GTMA 1OY3D 2GROB 5A7DB 3I4RB 4G1TA 5ENSD 5FQ4A 3HYMB 3ZU7B 2H6FA 2LAIA 3ESLA 1ELWA 1OCCE 4ACLA 3MX3A 3LY8A 4BEPA 1H2VC 3FEYA 3AAAC 3FEXA 3CHMA 5G2NA 3KSQA 4NQ0A 2VSXE 4I6JA 4C0MA 3ZRHA 3VTYA 4CGWA 3DXMG 1N94A 2C0LA 1AWCB 2IOSA 3LXUX 2X6FA 4EPZA 1TYQG 4G11A 1X81A 3SFYA 3ZKJA 1MHQA 2C2LA 3URZA 3B7UX 5FZRA 4GTOA 4JEUA 5B1BE 3T9KA 1H6OA 1SQMA 2KCKA 2WXFA 4WNEA 2LXMA 4BETA 4U63A 4MLPA 4N5QA 1N0RA 5AQ9A 4XE0A 2J8SD 2FULA 2OOEA 4P29A 5LOZA 3TG4A 3QWPA 4XI0A 3B7RL 3GZ2A 3JUEA 3ML8A 3L54A 1O1SA 4L9PA 2C0MA 2LSVA 1NA0A 4N5CA 3FUDA 3CVWA 3MV2B 4BFRA 1DCQA 3UINC 3PREA 3ZYLA 4G8KA 4FC8A 5HQ8A 1Z3YA 4A55A 4ZHBA 3Q49B 3NBNB 2HYZA 2R2LA 3SBTB 1WDYA 3AS4A 1TN7A 2XPYA 5KNGA 2RKKA 3O4ZA 3PZ3A 1IKND 2WQ7A 2XZDG 1QZ2A 3G2VA 2XGOA 4UI9J 4DK5A 2VSYA 1V54E 5FWQA 4GTSA 3ABLE 2VSOE 4DUIA 3ZYQA 2LSUA 3PRZA 2P58C 5ANRA 3DSXA 4UQXA 5A6CA 2VGYA 2WXMA 2RFMA 1L5JA 1IQUA 4A3VA 2KCLA 4A1SA 3TWWA 1E7VA 1WY6A 4N3CA 4FU3A 3CR3A 2J4BA 3ASGA 4HLEA 4GTPA 4ABNA 2BEDA 3E32A 1E8WA 2NC9A 4WNGA 2EIJE 2XCCA 2IOLA 3ZXPA 5CBOA 4GPKA 4L7TA 5EIDA 4Q94A 1HE8A 5EYLA 4GA1A 1OUVA 4HS2A 5EIBE 4N2SA 5LP0A 4F1SA 4YDWA 3MJWA 2I9CA 5KJLA 2AWIA 3V2XA 4EZKA 2PQRA 2R59A 4C9BB 1KT1A 4BT8A 2HE0A 3UPVA 1NFIE 5G04J 3E37A 3UKRG 3APDA 3L17A 4L23A 3R9AB 2IU1A 1B89A 3PEVB 3E33A 2GRMA 3PUJA 5G55A 3DRAA 3CKCA 4TUMA 3CK9A 3HG0D 4OVVA 5ITZF 4DX7D 3T5VA 5FINA 5CRVA 1SZ9A 2RFAA 2ZIRA 1WM5A 1NP7A 4QQIA 4MKTA 5AARA 4B0ZA 1SVXA 4PUCA 3MV3B 4GTRA 4F7AA 3IBEA 3CHPA 5EN5D 5JA4D 2JLBA 3U4TA 5D0OD 2J49A 3N71A 3C72A 4H7YA 3DSUA 3ABKE 4JHKA 1SZAA 3SZ7A 1UN9A 1DNPA 3V79K 2NSZA 3UT7A 2WXHA 3UQ3A 3MKRA 4PH4B 1U3DA 2V0PA 4HQDA 1D8EA 3UUXA 3PDNA 5J08A 2QY7A 4JZYA 4FADA 1QYMA 4GMJA 3DSSA 2HO1A 4O1OA 2F0YA 3EIQC 4UWKA 4DLQA 2CFUA 2AXVA 1S64A 3QAQA 3LEWA 3CHOA 1OWPA 3LJ3A 3CK7A 1Q2ZA 2GW1A 4KBQA 1BD8A 4AOFA 2AXUA 3QNKA 3UMVA 1BI8B 2IQCA 3CEQA 3MEKA 4YDOA 5AN8A 5DIZA 3EDTB 3APFA 3L9TA 4UI9K 3GW4A 4TV3A 4CDNA 5LCWJ 1UW4B 3DEOA 5LX8A 4DPRA 3K9IA 2MOWA 4GU5A 3RK6A 2BKKB 3NB2A 2WQHA 4I1OB 5T3RA 3ONKA 4IULA 3IHVA 4FHJA 2GGFA 3CVYA 1XGWA 1Z6TA 2IF4A 3TWRA 2XGSA 4EZJA 3CVUA 4OAVB 4BTBA 1QBQA 4FP7A 3ZVVA 3QJZA 4AEZC 4TRQA 1E90A 2XZTG 3MKQA 4AXHA 4LUNU 1BPOA 4AIFA 3TJPA 3VLDA 5FZQA 3FTUA 3FUFA 2X6HA 1S63A 1UG3A 3ULQA 2MYOA 2FEZA 4AY5A 4HXIA 4H7XA 3FP3A 1KPSB 4RSYA 4B94A 4OAUC 3OXFA 1TN6A 3D3MA 4HOSA 4BT9A 1OWOA 1MX4A 1TR4A 3UTMA 4U95D 4LEUA 3RRMB 2LAHA 3CGHA 3PUKA 4HVBA 1JCRA 2YINA 4DRXE 4ATZD 3OXGA 3R7QA 2A4ZA 3KD7A 3UM1A 2P9UG 3RAUA 3PZ4A 2DWZA 3ZNGA 1S0PA 1N95A 2YHCA 1LD8A 3PE4A 4CDRA 2QYUA 4KYOB 4KXKB 4ME2A 3NOGD 3NZUA 4GZ5A 2P9NG 4M3OA 1UJKA 4GA0A 1N0QA 3C3QA 3LY9A 5CRUA 2JEKA 3FDHA 3FUEA 2RD0A 4ILHB 2IEJA 3LCAA 4I2ZA 3ZIMA 3DPDA 3CLJA 1KZPA 2WXQA 4M7CA 4J8EA 2KCVA 1IYGA 5EDSA 3T8MA 4U0UA 4F1PA 5C1DA 1E8XA 3Q7FA 2V5FA 5CMWA 3EHMA 2LUHA 3FU6A 1TJFA 3ML9A 1U3CA 4TUUA 4GMRA 4BSZB 4OYSA 3SGHA 5BV0A 2J9QA 3QWWA 5HRYA 3Q79A 4GCOA 1IHGA 4O60A 4I9CA 5ENNA 1H2TC 3RIBA 1WAO1 1JPLA 3AS8A 3VLFA 4C0EA 5BT1A 3Q78A 4WAFA 1IHBA 2P9SG 3CVXA 1XNFA 3CHSA 1Y8MA 3LY7A 3X2QE 1MJ0A 3IV0A 3LYAA 3PVLA 1N4QA 2CG2A 2NXPA 4DI4A 5ENQD 5FTPA 4RVBA 3TG5A 3ZHEA 3MKQB 2VYIA 2LO6A 4HRMB 3RRUA 5G05C 2HR2A 1ELKA 3S7JA 4HB5A 4CYMD 4I43A 3Q15A 5AYWD 3UM3A 4UWHA 3Q9NC 4HBDA 3BUAA 1YCSB 2L6JA 3U3WA 2XPIA 3KSLA 3EU9A 1D8DA 2F37A 3UM2A 3NAWA 1SA5A 1V55E 2OV8A 2WXKA 2XRZA 4UWFA 2XEEA 5B1AE 4BX8A 2M63A 5D0QD 4JEHA 3FTVA 1P5QA 4UQYA 2I1KA 3S2AA 1EDUA 3R9MA 2L9BA 3FTSA 5AAOA 3ASOE 5CEDB 1FVFA 5G04C 2BUGA 4JVSA 3CHRA 3EJNA 1MZCA 2OCCE 1Z3XA 4G23A 2WXLA 4A1GA 1H2UA 4JA9A 4LNGA 3TWSA 2ILRA 1O1RA 3G2WA 1HS6A 4GYWA 3NF1A 4B8CB 4JW1A 3TWTA 3KS2A 3TGOA 1H19A 4N39A 4HI9A 2CG3A 5JJ6A 1RZ4A 2L0TB 3IHYA 5JMND 3PNLB 1HH8A 2MRIA 1ELRA 1QNFA 1G3NB 3D9PA 3SHFA 1IQRA 3MGBA 1UJJA 3TL5A 4K5AB 3HXBA 2UY1A 4NRHB 4CZ2D 3ZUVB 2QZAA 2DIWA 1UOHA 4GYOA 4LG6A 1TEZA 3G2TA 4GZ6A 3FWVA 3QDNA 1KZOA 3PZ2A 3AU4A 5CHEE 2JABA 3SQVA 2XGMA 2ZGDA 2YNQA 4CEMA 1K3ZD 5AIJA 5BV1A 1FT1A 2PZIA 5T4YA 4GZCA 2AXZA 4HOTA 3EHNA 3DEPA 3HRAA 2Y69E 2P9IG 3ZFWA 2WXIA 3Q75A 3ZHEB 2KM4A 3IEGA 4DJAA 2XS1A 3BU8A 1O1TA 3UT4A 4PDXA 2XQ0A 5AQAA 1TN8A 4BESA 5FZSA 3SFXA 1H0AA 4YDEA 1EPUA 1X5BA 2CFZA 3ZEFA 3E30A 1A5EA 2Y4UA 3PE3A 3ESKA 1MYOA 2OEWA 3AG3E 1UN8A 5LFAA 2WMOA 5ENOD 3WXXA 4HI8A 3JQ1A 2F8YA 4HFGA 3UI2A 4ACKA 2EIKE 4JB8P 3ABME 3B95A 3ASHA 3EU5A 2KBXA 1ZBPA 2Y4TA 1RW2A 5T8IA 2ETAA 1N54A 4B8AA 4WWNA 3Q7AA 5KNHD 3RO2A 1YMPA 2GRLA 3CVLA 2GRQB 3RJVA 4NIKA 3ZXSA 4GZDA 2IO2C 3FUNA 3MZLB 3VLEA 4BTAA 2EILE 3QARA 4I17A 1HXIA 4I2WA 4AVXA 3DPYA 3ISMC 4XIFA 3C3RA 2A5EA 2XEHA 3FUKA 3B7BA 3WG7E 1DCEA 3BG0B 5JJ7A 4MRUA 4LSZE 1A17A 3C3OA 3UT8A 3HDXA 3S7FA 2WM9A 2FBNA 1HF8A 3W9GA 3SNXA 2VSNA 2WXPA 4EQFA 2YQ8A 2UWJG 2EINE 4XEIG 3ASDA 4CCAA 4EBAG 1MX6A 3BQOA 4LCTA 4BX9A 2IFUA 3FFLA 4JD2G 1GW6A 3ZPJA 2H6HA 4JXTA 4G26A 4B93B 2X3MA 2J07A 2PM6A 2UY1B 4HNAD 1NI1A 3LPZA 3EHRA 1FVHA 3DWLG 3JCKC 1Y6IA 2F8XK 2VGEA 1HFAA 2DZNA 5FQ7A 4ANVA 2HM8A 1N4RA 1PC2A 1FPPA 2WXOA 1HG2A 4WWOA 1N52A 4URKA 4WNFA 4UUCA 3QOUA 2E0IA 4QFVA 1OXJA 4U07A 2A5UA 3TWVA 4JA7A 3NOCD 3W9FA 4YNDA 1HG5A 4FHKA 4BSXA 1NA3A 2LNIA 3D9LA 3ULYA 1ZU2A 2P2CP 2KC7A 3D9IA 2GRRB 1TJCA 5CCLA 3RRNB 3L16A 3R7RA 1LTXA 3IXEA 4ILIA 1Z5SC 1HZ4A 2WXJA 4LNBA 4CT0A 3J5PA 4XKBA 3JQ0A 3AG2E 1NL4A 2GRPB 3BG1B 1BU9A 3CHQA 3ULEG 4FJZA 2FI7A 3EUVA 3J5QB 4JPSA 1OWMA 2XEVA 4MS6A 3UIPC 4ANWA 5CECB 2B0OE 3LJNA 3FUIA 2H6IA 2WQ6A 3LDZA 3HVEA 5HI7A 5ENPD 5BXUA 3GYZA 3LVQE 3SBSA 2ZISA 3O48A 1N11A 4GCNA 1K1BA 1EF1C 2GRNB 4L2YA 2Q7FA 5FJYA 4EECA 5AQBA 2X6JA 3CVPA 4JC8A 4DX5D 5KJKA 4U8VD 3FTXA 3PS6A 4K03A 3CVNA 3TWQA 3I5PA 2CHWA 4U0ZA 1N4SA 4EHMA 3TWUA 4AV7A 3FULA 3JXIA 4AJWA 3E34A 3FU0A 3I4GA 3ZYKA 4W9RA 3CSTA 2I6HA 4CRWA 3C5RA 5CEAA 5D2MC 4AP2A 2KZTA 2V4LA 5EX3A 3AS5A 2FF4A 4GMLA 4WNDA 4HRLA 2WB2A 3CV0A 3ZGQA 3DSVA 4F53A 3UXGA 4LERA 3SI5A 4U8HA 2XCBA 3QWVA 4GAAA 5IY5E 2ETCA
chains in the Genus database with same CATH topology
5CECB 2B0OE 4F6RD 3KEAA 3LJNA 5AQAA 4BESA 4DX2A 1D9SA 5ENQD 4HRNA 2RFMA 4J8YA 5ENPD 5BXUA 4K5BA 5EN5D 5ENRD 3T9KA 5JA4D 3TWWA 4B93B 1N0QA 1N11A 1IXVA 4HI9A 4HRMB 3TWRA 3Q9UC 1K1BA 1A5EA 2DZOA 4HB5A 4BETA 4OAVB 2FO1E 4CYMD 4HNAD 1AP7A 1DC2A 1K1AA 5AQBA 2QYJA 1MYOA 2DVWA 2ETBA 3EHRA 4N5QA 5JMND 1N0RA 5BXOA 3Q9NC 5AQ9A 2F8XK 3V79K 2VGEA 2V5QC 1G3NB 4HBDA 5ENOD 5HKPA 1SW6A 2J8SD 4DX5D 4HI8A 4U8VD 3TWXA 5CBNA 2F8YA 4A63B 1YCSB 2XZTG 4U96D 3UI2A 3TWQA 2DZNA 4JB8P 5AQ7A 2KXPC 5HS0A 5CBOA 4HQDA 5EIDA 3B95A 4C48B 4K5AB 3D9HA 1S70B 4F1PA 2KBXA 2BKGA 5EYLA 3SO8A 3JUEA 4J7WA 4DX6D 5EIBE 4U8YD 1QYMA 3TWUA 1OT8A 2ETAA 1MX6A 3ZUVB 4YDWA 3JXIA 4CZ2D 3EU9A 2V4HC 2MYOA 1UOHA 4O1PA 2XENA 2F37A 2ZGGA 5KNHD 3V2XA 4BERA 4UUCA 4G8LA 4LG6A 1YMPA 4LNUD 4QFVA 4O1OA 1WG0A 1DCQA 4RLYA 2HE0A 5D66A 5EILA 4GPMA 4NIKA 5CERB 4G8KA 1BI7B 3JXJA 1YYHA 1NFIE 4GMRA 3TWVA 3C5RA 4BSZB 5CEAA 4OAUC 1OY3D 2JABA 2XEEA 4K5CA 3NOCD 3W9FA 4YDYA 2ZGDA 4ZHBA 5HRYA 5ENSD 3NBNB 4Z68A 3ZU7B 1MX2A 1MX4A 1TR4A 4ZFHA 2A5EA 3UTMA 1K3ZD 4U95D 3F6QA 1WDYA 2P2CP 2XEHA 5ENTD 2NYJA 5KBAA 4O60A 3B7BA 5FIOA 4BEPA 5AAOA 2PNNA 3AAAC 1BD8A 5CEDB 3T8KA 3DEPA 4HRLA 5KNGA 3HRAA 4LSZE 4TUMA 1IKND 4DRXE 4ATZD 1BLXB 2XZDG 1BI8B 3HG0D 3V31A 2QC9A 5ITZF 3IXEA 5AN8A 1IHBA 2AJAA 2Y1LE 4DX7D 5EYPF 2DWZA 3ZNGA 5FINA 2L6BA 3W9GA 3J5PA 3V2OA 3UXGA 5KWDA 3TWSA 1BU9A 3DEOA 4HLLA 2RFAA 1AWCB 2Y0BG 4DX1A 3EHQA 4QQIA 3AJIA 1MJ0A 2BKKB 5AARA 3NOGD 3TWTA 3J5QB 4DUIA 3V30A 2ETCA 1SVXA 3ZKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEC B;  2B0O E;  4F6R D;  3KEA A;  3LJN A;  5AQA A;  4BES A;  4DX2 A;  1D9S A;  5ENQ D;  4HRN A;  2RFM A;  4J8Y A;  5ENP D;  5BXU A;  4K5B A;  5EN5 D;  5ENR D;  3T9K A;  5JA4 D;  3TWW A;  4B93 B;  1N0Q A;  1N11 A;  1IXV A;  4HI9 A;  4HRM B;  3TWR A;  3Q9U C;  1K1B A;  1A5E A;  2DZO A;  4HB5 A;  4BET A;  4OAV B;  2FO1 E;  4CYM D;  4HNA D;  1AP7 A;  1DC2 A;  1K1A A;  5AQB A;  2QYJ A;  1MYO A;  2DVW A;  2ETB A;  3EHR A;  4N5Q A;  5JMN D;  1N0R A;  5BXO A;  3Q9N C;  5AQ9 A;  2F8X K;  3V79 K;  2VGE A;  2V5Q C;  1G3N B;  4HBD A;  5ENO D;  5HKP A;  1SW6 A;  2J8S D;  4DX5 D;  4HI8 A;  4U8V D;  3TWX A;  5CBN A;  2F8Y A;  4A63 B;  1YCS B;  2XZT G;  4U96 D;  3UI2 A;  3TWQ A;  2DZN A;  4JB8 P;  5AQ7 A;  2KXP C;  5HS0 A;  5CBO A;  4HQD A;  5EID A;  3B95 A;  4C48 B;  4K5A B;  3D9H A;  1S70 B;  4F1P A;  2KBX A;  2BKG A;  5EYL A;  3SO8 A;  3JUE A;  4J7W A;  4DX6 D;  5EIB E;  4U8Y D;  1QYM A;  3TWU A;  1OT8 A;  2ETA A;  1MX6 A;  3ZUV B;  4YDW A;  3JXI A;  4CZ2 D;  3EU9 A;  2V4H C;  2MYO A;  1UOH A;  4O1P A;  2XEN A;  2F37 A;  2ZGG A;  5KNH D;  3V2X A;  4BER A;  4UUC A;  4G8L A;  4LG6 A;  1YMP A;  4LNU D;  4QFV A;  4O1O A;  1WG0 A;  1DCQ A;  4RLY A;  2HE0 A;  5D66 A;  5EIL A;  4GPM A;  4NIK A;  5CER B;  4G8K A;  1BI7 B;  3JXJ A;  1YYH A;  1NFI E;  4GMR A;  3TWV A;  3C5R A;  4BSZ B;  5CEA A;  4OAU C;  1OY3 D;  2JAB A;  2XEE A;  4K5C A;  3NOC D;  3W9F A;  4YDY A;  2ZGD A;  4ZHB A;  5HRY A;  5ENS D;  3NBN B;  4Z68 A;  3ZU7 B;  1MX2 A;  1MX4 A;  1TR4 A;  4ZFH A;  2A5E A;  3UTM A;  1K3Z D;  4U95 D;  3F6Q A;  1WDY A;  2P2C P;  2XEH A;  5ENT D;  2NYJ A;  5KBA A;  4O60 A;  3B7B A;  5FIO A;  4BEP A;  5AAO A;  2PNN A;  3AAA C;  1BD8 A;  5CED B;  3T8K A;  3DEP A;  4HRL A;  5KNG A;  3HRA A;  4LSZ E;  4TUM A;  1IKN D;  4DRX E;  4ATZ D;  1BLX B;  2XZD G;  1BI8 B;  3HG0 D;  3V31 A;  2QC9 A;  5ITZ F;  3IXE A;  5AN8 A;  1IHB A;  2AJA A;  2Y1L E;  4DX7 D;  5EYP F;  2DWZ A;  3ZNG A;  5FIN A;  2L6B A;  3W9G A;  3J5P A;  3V2O A;  3UXG A;  5KWD A;  3TWS A;  1BU9 A;  3DEO A;  4HLL A;  2RFA A;  1AWC B;  2Y0B G;  4DX1 A;  3EHQ A;  4QQI A;  3AJI A;  1MJ0 A;  2BKK B;  5AAR A;  3NOG D;  3TWT A;  3J5Q B;  4DUI A;  3V30 A;  2ETC A;  1SVX A;  3ZKJ A; 
#chains in the Genus database with same CATH topology
 4FJY A;  2XPZ A;  3KEA A;  4DX2 A;  3FUJ A;  4J8S A;  4HRN A;  3PEU B;  4WWP A;  4I1A A;  3GZ1 A;  3D9K A;  2WVI A;  4L1B A;  2E2E A;  4NUR A;  2FO1 E;  1AP7 A;  3CQC B;  3T5X A;  2CHX A;  2J4D A;  3P2B A;  2EQX A;  3TWX A;  4CGV A;  4GA2 A;  4EZL A;  4U96 D;  4UI9 C;  5KCM A;  5HS0 A;  2WXN A;  1E8Y A;  4J7W A;  2VTB A;  2PL2 A;  1E96 B;  4HOU A;  1TNB A;  3LKU A;  4J0U A;  2V4H C;  2XEN A;  4G8L A;  4RLY A;  4F3V A;  4Y6W A;  3U64 A;  5JJT A;  3G2S A;  3VTX A;  4N3A A;  4D10 C;  1OCZ E;  4JHR A;  3CVV A;  1PAQ A;  2X6I A;  3UKU G;  4NAC A;  5ENT D;  2P9K G;  2NYJ A;  4AY6 A;  2FO7 A;  3EIJ A;  4L2L A;  2P9P G;  4EBA A;  3PNT B;  3LS8 A;  3HXD A;  2BF0 X;  2RG8 A;  3Q47 B;  3HVE B;  2Y1L E;  3RO3 A;  3Q73 A;  3L22 A;  5KWD A;  5FQ8 A;  3HXF A;  4FLH A;  4G25 A;  3MA5 A;  3SFZ A;  3V30 A;  2H6G A;  3CIA A;  3UX4 A;  4XX5 A;  2BTD A;  3B13 A;  5FQ6 A;  2ZU6 B;  1FT2 A;  3HIZ A;  3CK8 A;  2ETB A;  2CHZ A;  3D9M A;  2V5Q C;  5HKP A;  3NZS A;  4UWG A;  4RG6 A;  3QK0 A;  2WXG A;  3B7S A;  1HO8 A;  3FUH A;  3IKO B;  5JHB A;  3APC A;  2KZT B;  2R05 A;  2WMN A;  4K0R A;  2ZGG A;  4BER A;  3P1U A;  3FY4 A;  3QC1 A;  3QKY A;  4HOQ A;  2ION A;  1QQE A;  3FU3 A;  1MX2 A;  2X38 A;  5G05 J;  1H6K A;  3F6Q A;  3MCX A;  4KVO A;  4GYY A;  4GTT A;  4Q96 A;  3FU5 A;  1BLX B;  2P9L G;  4YVQ C;  3TXM A;  3V31 A;  4BWR A;  3AG4 E;  4HOR A;  1LF8 A;  2AJA A;  4GTQ A;  2XRY A;  1LD7 A;  1YA0 A;  2L6B A;  1HX8 A;  1DVP A;  2OND A;  4TXQ A;  3DXK G;  4PS8 A;  5EX0 A;  5CCM A;  2IJG X;  3L13 A;  4Q69 A;  5B3S E;  1TNY A;  4V3I A;  4ANX A;  2DZO A;  1DC2 A;  2VTB B;  2QYJ A;  2DVW A;  3L82 A;  5M72 A;  4A63 B;  2R03 A;  4J8F A;  4FUL A;  3ASN E;  4ATG A;  2R5S A;  1EYH A;  3SO8 A;  5KJM A;  2DYR E;  4I9E A;  4U8Y D;  5LCW C;  3E4B A;  2VQ2 A;  4DI3 A;  4RG9 A;  3FTY A;  3UM0 A;  4TXP A;  1INZ A;  5C2Y A;  1WG0 A;  1JUQ A;  5CER B;  4GPM A;  4E85 A;  2DYS E;  4PS7 A;  1YYH A;  1U2V G;  4K5C A;  4CDM A;  4KT6 B;  4U0S A;  2MHK A;  5EKQ D;  3U9W A;  4Z68 A;  1ZB1 A;  3D9J A;  3QB2 A;  2PM7 A;  4ZFH A;  4N2Q A;  3FUM A;  4I6E A;  5JHA A;  2AVP A;  3FH5 A;  2LXL A;  4I6G A;  4IRU A;  4KZC A;  2X6K A;  5ARG A;  2QC9 A;  3NQP A;  3ASF A;  5BPP A;  1OWN A;  4HLL A;  3I3N A;  3AJI A;  3Q4A B;  3SF4 A;  4XI9 A;  1H6P A;  3CQG B;  4F6R D;  3OAW A;  1D9S A;  2WPV A;  3ZW3 A;  1K8K G;  1E7U A;  4K5B A;  1HU3 A;  2VJ8 A;  4GB9 A;  4CT4 A;  5CMY A;  5AEN A;  3D9O A;  5H7P A;  4BY6 A;  4YVO A;  3SY2 A;  4DLO A;  3Q5M A;  1VDY A;  3HHM A;  3ENE A;  4U7E B;  5BUZ A;  2VGX A;  4I1M A;  4R7L A;  4KMO A;  5AQ7 A;  2KXP C;  3D9H A;  5DBK A;  4AM9 A;  1OT8 A;  1PY1 A;  2WXR A;  4O1P A;  5AJL A;  4J8D A;  3ONL A;  2OVF A;  1JWG A;  1JWF A;  5EIL A;  2OEV A;  3ZN3 A;  4XZ4 A;  4UWL A;  1O5M A;  3S7D A;  1W3B A;  1N4P A;  4YDY A;  2QFC A;  3AG1 E;  3SD5 A;  4UQZ A;  3RKV A;  1TNU A;  2Y3A A;  3B7T A;  3HXE A;  4LRZ A;  3DST A;  1FCH A;  4RQI A;  3D9N A;  3HXC A;  1OCR E;  3PH0 C;  2J09 A;  5EYP F;  1JCS A;  2YHE A;  3FH7 A;  3DBS A;  3V2O A;  2I1J A;  1N9A A;  4J6I A;  2J08 A;  2Y0B G;  1TNO A;  3EHQ A;  2KAT A;  4FLB A;  5ARF A;  3S7B A;  5BNW A;  4IN3 B;  3OTN A;  3KEZ A;  4FA6 A;  4OVU A;  5ENR D;  3Q9U C;  3TXN A;  1K1A A;  3FH8 A;  1E8Z A;  3PZ1 A;  5BXO A;  1SW6 A;  3AU5 A;  5ANL A;  3FTW A;  3KAE A;  5CBN A;  3C98 A;  4PS3 A;  1KLX A;  4G24 A;  1OCO E;  2BKG A;  2XHE A;  4E6H A;  1NZN A;  2DCP A;  2L0I A;  3PZD A;  5FT9 A;  3MYV A;  2EIM E;  4LNU D;  3ZYM A;  2B6C A;  5D66 A;  4KZ0 A;  3DSW A;  3L08 A;  1BI7 B;  3L6A A;  2IY0 C;  4WUY A;  2IO3 C;  4APO A;  2ZXW E;  3CKB A;  3FHE A;  2R02 A;  4GTV A;  5KBA A;  5FIO A;  4N3B A;  2PNN A;  3GZS A;  3T8K A;  3CSF A;  3RSE G;  4TXR A;  4MBG A;  5AJD A;  5KJN A;  3FTZ A;  3OXL A;  3G2U A;  1KT0 A;  2V8S E;  2XS8 A;  1MQS A;  1JCQ A;  2PQN A;  5E75 A;  4APF A;  2R17 C;  4DX1 A;  2OVB A;  4U04 A;  4JHJ A;  5BW8 C;  4KVM A;  5A23 A;  3JYS A;  4XKC A;  5J90 A;  4ILG A;  3U66 A;  4X8Q A;  2VGX B;  2AW6 A;  4J8Y A;  5E76 A;  4Y6C A;  4A3T A;  1IXV A;  3JUI A;  4JL0 A;  3CVQ A;  3RU0 A;  1TNZ A;  4B89 A;  2I2O A;  2DBA A;  1SA4 A;  4O6F A;  3LVR E;  1OWL A;  4G2V A;  3UIO C;  4C48 B;  1S70 B;  4GZ3 A;  4DX6 D;  4ANU A;  4IYP A;  3TAX A;  3BEE A;  3JXJ A;  4GTM A;  1OY3 D;  2GRO B;  5A7D B;  3I4R B;  4G1T A;  5ENS D;  5FQ4 A;  3HYM B;  3ZU7 B;  2H6F A;  2LAI A;  3ESL A;  1ELW A;  1OCC E;  4ACL A;  3MX3 A;  3LY8 A;  4BEP A;  1H2V C;  3FEY A;  3AAA C;  3FEX A;  3CHM A;  5G2N A;  3KSQ A;  4NQ0 A;  2VSX E;  4I6J A;  4C0M A;  3ZRH A;  3VTY A;  4CGW A;  3DXM G;  1N94 A;  2C0L A;  1AWC B;  2IOS A;  3LXU X;  2X6F A;  4EPZ A;  1TYQ G;  4G11 A;  1X81 A;  3SFY A;  3ZKJ A;  1MHQ A;  2C2L A;  3URZ A;  3B7U X;  5FZR A;  4GTO A;  4JEU A;  5B1B E;  3T9K A;  1H6O A;  1SQM A;  2KCK A;  2WXF A;  4WNE A;  2LXM A;  4BET A;  4U63 A;  4MLP A;  4N5Q A;  1N0R A;  5AQ9 A;  4XE0 A;  2J8S D;  2FUL A;  2OOE A;  4P29 A;  5LOZ A;  3TG4 A;  3QWP A;  4XI0 A;  3B7R L;  3GZ2 A;  3JUE A;  3ML8 A;  3L54 A;  1O1S A;  4L9P A;  2C0M A;  2LSV A;  1NA0 A;  4N5C A;  3FUD A;  3CVW A;  3MV2 B;  4BFR A;  1DCQ A;  3UIN C;  3PRE A;  3ZYL A;  4G8K A;  4FC8 A;  5HQ8 A;  1Z3Y A;  4A55 A;  4ZHB A;  3Q49 B;  3NBN B;  2HYZ A;  2R2L A;  3SBT B;  1WDY A;  3AS4 A;  1TN7 A;  2XPY A;  5KNG A;  2RKK A;  3O4Z A;  3PZ3 A;  1IKN D;  2WQ7 A;  2XZD G;  1QZ2 A;  3G2V A;  2XGO A;  4UI9 J;  4DK5 A;  2VSY A;  1V54 E;  5FWQ A;  4GTS A;  3ABL E;  2VSO E;  4DUI A;  3ZYQ A;  2LSU A;  3PRZ A;  2P58 C;  5ANR A;  3DSX A;  4UQX A;  5A6C A;  2VGY A;  2WXM A;  2RFM A;  1L5J A;  1IQU A;  4A3V A;  2KCL A;  4A1S A;  3TWW A;  1E7V A;  1WY6 A;  4N3C A;  4FU3 A;  3CR3 A;  2J4B A;  3ASG A;  4HLE A;  4GTP A;  4ABN A;  2BED A;  3E32 A;  1E8W A;  2NC9 A;  4WNG A;  2EIJ E;  2XCC A;  2IOL A;  3ZXP A;  5CBO A;  4GPK A;  4L7T A;  5EID A;  4Q94 A;  1HE8 A;  5EYL A;  4GA1 A;  1OUV A;  4HS2 A;  5EIB E;  4N2S A;  5LP0 A;  4F1S A;  4YDW A;  3MJW A;  2I9C A;  5KJL A;  2AWI A;  3V2X A;  4EZK A;  2PQR A;  2R59 A;  4C9B B;  1KT1 A;  4BT8 A;  2HE0 A;  3UPV A;  1NFI E;  5G04 J;  3E37 A;  3UKR G;  3APD A;  3L17 A;  4L23 A;  3R9A B;  2IU1 A;  1B89 A;  3PEV B;  3E33 A;  2GRM A;  3PUJ A;  5G55 A;  3DRA A;  3CKC A;  4TUM A;  3CK9 A;  3HG0 D;  4OVV A;  5ITZ F;  4DX7 D;  3T5V A;  5FIN A;  5CRV A;  1SZ9 A;  2RFA A;  2ZIR A;  1WM5 A;  1NP7 A;  4QQI A;  4MKT A;  5AAR A;  4B0Z A;  1SVX A;  4PUC A;  3MV3 B;  4GTR A;  4F7A A;  3IBE A;  3CHP A;  5EN5 D;  5JA4 D;  2JLB A;  3U4T A;  5D0O D;  2J49 A;  3N71 A;  3C72 A;  4H7Y A;  3DSU A;  3ABK E;  4JHK A;  1SZA A;  3SZ7 A;  1UN9 A;  1DNP A;  3V79 K;  2NSZ A;  3UT7 A;  2WXH A;  3UQ3 A;  3MKR A;  4PH4 B;  1U3D A;  2V0P A;  4HQD A;  1D8E A;  3UUX A;  3PDN A;  5J08 A;  2QY7 A;  4JZY A;  4FAD A;  1QYM A;  4GMJ A;  3DSS A;  2HO1 A;  4O1O A;  2F0Y A;  3EIQ C;  4UWK A;  4DLQ A;  2CFU A;  2AXV A;  1S64 A;  3QAQ A;  3LEW A;  3CHO A;  1OWP A;  3LJ3 A;  3CK7 A;  1Q2Z A;  2GW1 A;  4KBQ A;  1BD8 A;  4AOF A;  2AXU A;  3QNK A;  3UMV A;  1BI8 B;  2IQC A;  3CEQ A;  3MEK A;  4YDO A;  5AN8 A;  5DIZ A;  3EDT B;  3APF A;  3L9T A;  4UI9 K;  3GW4 A;  4TV3 A;  4CDN A;  5LCW J;  1UW4 B;  3DEO A;  5LX8 A;  4DPR A;  3K9I A;  2MOW A;  4GU5 A;  3RK6 A;  2BKK B;  3NB2 A;  2WQH A;  4I1O B;  5T3R A;  3ONK A;  4IUL A;  3IHV A;  4FHJ A;  2GGF A;  3CVY A;  1XGW A;  1Z6T A;  2IF4 A;  3TWR A;  2XGS A;  4EZJ A;  3CVU A;  4OAV B;  4BTB A;  1QBQ A;  4FP7 A;  3ZVV A;  3QJZ A;  4AEZ C;  4TRQ A;  1E90 A;  2XZT G;  3MKQ A;  4AXH A;  4LUN U;  1BPO A;  4AIF A;  3TJP A;  3VLD A;  5FZQ A;  3FTU A;  3FUF A;  2X6H A;  1S63 A;  1UG3 A;  3ULQ A;  2MYO A;  2FEZ A;  4AY5 A;  4HXI A;  4H7X A;  3FP3 A;  1KPS B;  4RSY A;  4B94 A;  4OAU C;  3OXF A;  1TN6 A;  3D3M A;  4HOS A;  4BT9 A;  1OWO A;  1MX4 A;  1TR4 A;  3UTM A;  4U95 D;  4LEU A;  3RRM B;  2LAH A;  3CGH A;  3PUK A;  4HVB A;  1JCR A;  2YIN A;  4DRX E;  4ATZ D;  3OXG A;  3R7Q A;  2A4Z A;  3KD7 A;  3UM1 A;  2P9U G;  3RAU A;  3PZ4 A;  2DWZ A;  3ZNG A;  1S0P A;  1N95 A;  2YHC A;  1LD8 A;  3PE4 A;  4CDR A;  2QYU A;  4KYO B;  4KXK B;  4ME2 A;  3NOG D;  3NZU A;  4GZ5 A;  2P9N G;  4M3O A;  1UJK A;  4GA0 A;  1N0Q A;  3C3Q A;  3LY9 A;  5CRU A;  2JEK A;  3FDH A;  3FUE A;  2RD0 A;  4ILH B;  2IEJ A;  3LCA A;  4I2Z A;  3ZIM A;  3DPD A;  3CLJ A;  1KZP A;  2WXQ A;  4M7C A;  4J8E A;  2KCV A;  1IYG A;  5EDS A;  3T8M A;  4U0U A;  4F1P A;  5C1D A;  1E8X A;  3Q7F A;  2V5F A;  5CMW A;  3EHM A;  2LUH A;  3FU6 A;  1TJF A;  3ML9 A;  1U3C A;  4TUU A;  4GMR A;  4BSZ B;  4OYS A;  3SGH A;  5BV0 A;  2J9Q A;  3QWW A;  5HRY A;  3Q79 A;  4GCO A;  1IHG A;  4O60 A;  4I9C A;  5ENN A;  1H2T C;  3RIB A;  1WAO 1;  1JPL A;  3AS8 A;  3VLF A;  4C0E A;  5BT1 A;  3Q78 A;  4WAF A;  1IHB A;  2P9S G;  3CVX A;  1XNF A;  3CHS A;  1Y8M A;  3LY7 A;  3X2Q E;  1MJ0 A;  3IV0 A;  3LYA A;  3PVL A;  1N4Q A;  2CG2 A;  2NXP A;  4DI4 A;  5ENQ D;  5FTP A;  4RVB A;  3TG5 A;  3ZHE A;  3MKQ B;  2VYI A;  2LO6 A;  4HRM B;  3RRU A;  5G05 C;  2HR2 A;  1ELK A;  3S7J A;  4HB5 A;  4CYM D;  4I43 A;  3Q15 A;  5AYW D;  3UM3 A;  4UWH A;  3Q9N C;  4HBD A;  3BUA A;  1YCS B;  2L6J A;  3U3W A;  2XPI A;  3KSL A;  3EU9 A;  1D8D A;  2F37 A;  3UM2 A;  3NAW A;  1SA5 A;  1V55 E;  2OV8 A;  2WXK A;  2XRZ A;  4UWF A;  2XEE A;  5B1A E;  4BX8 A;  2M63 A;  5D0Q D;  4JEH A;  3FTV A;  1P5Q A;  4UQY A;  2I1K A;  3S2A A;  1EDU A;  3R9M A;  2L9B A;  3FTS A;  5AAO A;  3ASO E;  5CED B;  1FVF A;  5G04 C;  2BUG A;  4JVS A;  3CHR A;  3EJN A;  1MZC A;  2OCC E;  1Z3X A;  4G23 A;  2WXL A;  4A1G A;  1H2U A;  4JA9 A;  4LNG A;  3TWS A;  2ILR A;  1O1R A;  3G2W A;  1HS6 A;  4GYW A;  3NF1 A;  4B8C B;  4JW1 A;  3TWT A;  3KS2 A;  3TGO A;  1H19 A;  4N39 A;  4HI9 A;  2CG3 A;  5JJ6 A;  1RZ4 A;  2L0T B;  3IHY A;  5JMN D;  3PNL B;  1HH8 A;  2MRI A;  1ELR A;  1QNF A;  1G3N B;  3D9P A;  3SHF A;  1IQR A;  3MGB A;  1UJJ A;  3TL5 A;  4K5A B;  3HXB A;  2UY1 A;  4NRH B;  4CZ2 D;  3ZUV B;  2QZA A;  2DIW A;  1UOH A;  4GYO A;  4LG6 A;  1TEZ A;  3G2T A;  4GZ6 A;  3FWV A;  3QDN A;  1KZO A;  3PZ2 A;  3AU4 A;  5CHE E;  2JAB A;  3SQV A;  2XGM A;  2ZGD A;  2YNQ A;  4CEM A;  1K3Z D;  5AIJ A;  5BV1 A;  1FT1 A;  2PZI A;  5T4Y A;  4GZC A;  2AXZ A;  4HOT A;  3EHN A;  3DEP A;  3HRA A;  2Y69 E;  2P9I G;  3ZFW A;  2WXI A;  3Q75 A;  3ZHE B;  2KM4 A;  3IEG A;  4DJA A;  2XS1 A;  3BU8 A;  1O1T A;  3UT4 A;  4PDX A;  2XQ0 A;  5AQA A;  1TN8 A;  4BES A;  5FZS A;  3SFX A;  1H0A A;  4YDE A;  1EPU A;  1X5B A;  2CFZ A;  3ZEF A;  3E30 A;  1A5E A;  2Y4U A;  3PE3 A;  3ESK A;  1MYO A;  2OEW A;  3AG3 E;  1UN8 A;  5LFA A;  2WMO A;  5ENO D;  3WXX A;  4HI8 A;  3JQ1 A;  2F8Y A;  4HFG A;  3UI2 A;  4ACK A;  2EIK E;  4JB8 P;  3ABM E;  3B95 A;  3ASH A;  3EU5 A;  2KBX A;  1ZBP A;  2Y4T A;  1RW2 A;  5T8I A;  2ETA A;  1N54 A;  4B8A A;  4WWN A;  3Q7A A;  5KNH D;  3RO2 A;  1YMP A;  2GRL A;  3CVL A;  2GRQ B;  3RJV A;  4NIK A;  3ZXS A;  4GZD A;  2IO2 C;  3FUN A;  3MZL B;  3VLE A;  4BTA A;  2EIL E;  3QAR A;  4I17 A;  1HXI A;  4I2W A;  4AVX A;  3DPY A;  3ISM C;  4XIF A;  3C3R A;  2A5E A;  2XEH A;  3FUK A;  3B7B A;  3WG7 E;  1DCE A;  3BG0 B;  5JJ7 A;  4MRU A;  4LSZ E;  1A17 A;  3C3O A;  3UT8 A;  3HDX A;  3S7F A;  2WM9 A;  2FBN A;  1HF8 A;  3W9G A;  3SNX A;  2VSN A;  2WXP A;  4EQF A;  2YQ8 A;  2UWJ G;  2EIN E;  4XEI G;  3ASD A;  4CCA A;  4EBA G;  1MX6 A;  3BQO A;  4LCT A;  4BX9 A;  2IFU A;  3FFL A;  4JD2 G;  1GW6 A;  3ZPJ A;  2H6H A;  4JXT A;  4G26 A;  4B93 B;  2X3M A;  2J07 A;  2PM6 A;  2UY1 B;  4HNA D;  1NI1 A;  3LPZ A;  3EHR A;  1FVH A;  3DWL G;  3JCK C;  1Y6I A;  2F8X K;  2VGE A;  1HFA A;  2DZN A;  5FQ7 A;  4ANV A;  2HM8 A;  1N4R A;  1PC2 A;  1FPP A;  2WXO A;  1HG2 A;  4WWO A;  1N52 A;  4URK A;  4WNF A;  4UUC A;  3QOU A;  2E0I A;  4QFV A;  1OXJ A;  4U07 A;  2A5U A;  3TWV A;  4JA7 A;  3NOC D;  3W9F A;  4YND A;  1HG5 A;  4FHK A;  4BSX A;  1NA3 A;  2LNI A;  3D9L A;  3ULY A;  1ZU2 A;  2P2C P;  2KC7 A;  3D9I A;  2GRR B;  1TJC A;  5CCL A;  3RRN B;  3L16 A;  3R7R A;  1LTX A;  3IXE A;  4ILI A;  1Z5S C;  1HZ4 A;  2WXJ A;  4LNB A;  4CT0 A;  3J5P A;  4XKB A;  3JQ0 A;  3AG2 E;  1NL4 A;  2GRP B;  3BG1 B;  1BU9 A;  3CHQ A;  3ULE G;  4FJZ A;  2FI7 A;  3EUV A;  3J5Q B;  4JPS A;  1OWM A;  2XEV A;  4MS6 A;  3UIP C;  4ANW A;  5CEC B;  2B0O E;  3LJN A;  3FUI A;  2H6I A;  2WQ6 A;  3LDZ A;  3HVE A;  5HI7 A;  5ENP D;  5BXU A;  3GYZ A;  3LVQ E;  3SBS A;  2ZIS A;  3O48 A;  1N11 A;  4GCN A;  1K1B A;  1EF1 C;  2GRN B;  4L2Y A;  2Q7F A;  5FJY A;  4EEC A;  5AQB A;  2X6J A;  3CVP A;  4JC8 A;  4DX5 D;  5KJK A;  4U8V D;  3FTX A;  3PS6 A;  4K03 A;  3CVN A;  3TWQ A;  3I5P A;  2CHW A;  4U0Z A;  1N4S A;  4EHM A;  3TWU A;  4AV7 A;  3FUL A;  3JXI A;  4AJW A;  3E34 A;  3FU0 A;  3I4G A;  3ZYK A;  4W9R A;  3CST A;  2I6H A;  4CRW A;  3C5R A;  5CEA A;  5D2M C;  4AP2 A;  2KZT A;  2V4L A;  5EX3 A;  3AS5 A;  2FF4 A;  4GML A;  4WND A;  4HRL A;  2WB2 A;  3CV0 A;  3ZGQ A;  3DSV A;  4F53 A;  3UXG A;  4LER A;  3SI5 A;  4U8H A;  2XCB A;  3QWV A;  4GAA A;  5IY5 E;  2ETC A; 
#chains in the Genus database with same CATH homology
 5CEC B;  2B0O E;  4F6R D;  3KEA A;  3LJN A;  5AQA A;  4BES A;  4DX2 A;  1D9S A;  5ENQ D;  4HRN A;  2RFM A;  4J8Y A;  5ENP D;  5BXU A;  4K5B A;  5EN5 D;  5ENR D;  3T9K A;  5JA4 D;  3TWW A;  4B93 B;  1N0Q A;  1N11 A;  1IXV A;  4HI9 A;  4HRM B;  3TWR A;  3Q9U C;  1K1B A;  1A5E A;  2DZO A;  4HB5 A;  4BET A;  4OAV B;  2FO1 E;  4CYM D;  4HNA D;  1AP7 A;  1DC2 A;  1K1A A;  5AQB A;  2QYJ A;  1MYO A;  2DVW A;  2ETB A;  3EHR A;  4N5Q A;  5JMN D;  1N0R A;  5BXO A;  3Q9N C;  5AQ9 A;  2F8X K;  3V79 K;  2VGE A;  2V5Q C;  1G3N B;  4HBD A;  5ENO D;  5HKP A;  1SW6 A;  2J8S D;  4DX5 D;  4HI8 A;  4U8V D;  3TWX A;  5CBN A;  2F8Y A;  4A63 B;  1YCS B;  2XZT G;  4U96 D;  3UI2 A;  3TWQ A;  2DZN A;  4JB8 P;  5AQ7 A;  2KXP C;  5HS0 A;  5CBO A;  4HQD A;  5EID A;  3B95 A;  4C48 B;  4K5A B;  3D9H A;  1S70 B;  4F1P A;  2KBX A;  2BKG A;  5EYL A;  3SO8 A;  3JUE A;  4J7W A;  4DX6 D;  5EIB E;  4U8Y D;  1QYM A;  3TWU A;  1OT8 A;  2ETA A;  1MX6 A;  3ZUV B;  4YDW A;  3JXI A;  4CZ2 D;  3EU9 A;  2V4H C;  2MYO A;  1UOH A;  4O1P A;  2XEN A;  2F37 A;  2ZGG A;  5KNH D;  3V2X A;  4BER A;  4UUC A;  4G8L A;  4LG6 A;  1YMP A;  4LNU D;  4QFV A;  4O1O A;  1WG0 A;  1DCQ A;  4RLY A;  2HE0 A;  5D66 A;  5EIL A;  4GPM A;  4NIK A;  5CER B;  4G8K A;  1BI7 B;  3JXJ A;  1YYH A;  1NFI E;  4GMR A;  3TWV A;  3C5R A;  4BSZ B;  5CEA A;  4OAU C;  1OY3 D;  2JAB A;  2XEE A;  4K5C A;  3NOC D;  3W9F A;  4YDY A;  2ZGD A;  4ZHB A;  5HRY A;  5ENS D;  3NBN B;  4Z68 A;  3ZU7 B;  1MX2 A;  1MX4 A;  1TR4 A;  4ZFH A;  2A5E A;  3UTM A;  1K3Z D;  4U95 D;  3F6Q A;  1WDY A;  2P2C P;  2XEH A;  5ENT D;  2NYJ A;  5KBA A;  4O60 A;  3B7B A;  5FIO A;  4BEP A;  5AAO A;  2PNN A;  3AAA C;  1BD8 A;  5CED B;  3T8K A;  3DEP A;  4HRL A;  5KNG A;  3HRA A;  4LSZ E;  4TUM A;  1IKN D;  4DRX E;  4ATZ D;  1BLX B;  2XZD G;  1BI8 B;  3HG0 D;  3V31 A;  2QC9 A;  5ITZ F;  3IXE A;  5AN8 A;  1IHB A;  2AJA A;  2Y1L E;  4DX7 D;  5EYP F;  2DWZ A;  3ZNG A;  5FIN A;  2L6B A;  3W9G A;  3J5P A;  3V2O A;  3UXG A;  5KWD A;  3TWS A;  1BU9 A;  3DEO A;  4HLL A;  2RFA A;  1AWC B;  2Y0B G;  4DX1 A;  3EHQ A;  4QQI A;  3AJI A;  1MJ0 A;  2BKK B;  5AAR A;  3NOG D;  3TWT A;  3J5Q B;  4DUI A;  3V30 A;  2ETC A;  1SVX A;  3ZKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...