5ENSD

Rhodamine bound structure of bacterial efflux pump.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
b'GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 48
structure length 156
sequence length 156
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5ensD00
5HRYA 2P2CP 4BETA 5ITZF 3V2OA 4G8KA 4J7WA 2DWZA 4HQDA 5KNGA 1IKND 1SVXA 3HG0D 4K5CA 5CBNA 5EIDA 2RFAA 5CECB 1D9SA 1UOHA 4GMRA 2BKKB 2VGEA 3LJNA 4U8VD 2B0OE 5ENSD 4HBDA 2L6BA 1MX2A 3B7BA 4DX7D 5KWDA 3ZU7B 2NYJA 2RFMA 4DX1A 3SO8A 4HRMB 4ATZD 2XEHA 4A63B 3W9GA 5HS0A 1DCQA 2F8XK 1QYMA 5EIBE 4TUMA 2DZNA 1MX6A 4ZHBA 4QQIA 3TWUA 3ZKJA 2FO1E 1WDYA 4UUCA 4BEPA 4NIKA 3JXJA 5FINA 5AAOA 3ZNGA 1MYOA 5KBAA 3V31A 4Z68A 3J5QB 5ENQD 3T9KA 2Y0BG 4OAVB 2KBXA 5D66A 3TWXA 4B93B 5AQ9A 4CZ2D 1G3NB 3Q9UC 4HRNA 1YYHA 3C5RA 4U8YD 4BSZB 3KEAA 4J8YA 5AQ7A 1AP7A 3HRAA 1BLXB 1IHBA 4BESA 4HI8A 1OY3D 2HE0A 5FIOA 4O1PA 1N0RA 4GPMA 3TWSA 3V79K 5HKPA 2ETCA 3EHQA 1MJ0A 1MX4A 1OT8A 4HNAD 4OAUC 2QC9A 1K1AA 2XENA 2ZGGA 5JMND 1AWCB 5ENPD 1K1BA 2Y1LE 4HRLA 5EYLA 5CEDB 5KNHD 3UI2A 2J8SD 2DZOA 5EN5D 1N11A 5CEAA 5AQBA 1YCSB 2ZGDA 1SW6A 3T8KA 5ENOD 3JUEA 4U95D 5BXUA 4DX6D 3IXEA 3F6QA 4LNUD 2JABA 2F8YA 4RLYA 3TWTA 5CBOA 5ENRD 1WG0A 2BKGA 2XZDG 3B95A 3Q9NC 5AQAA 3TWVA 3ZUVB 4C48B 4YDWA 5CERB 3AJIA 4LSZE 4HI9A 2F37A 4QFVA 1S70B 4DX5D 2QYJA 2XZTG 3UTMA 4K5AB 4F1PA 4F6RD 3DEOA 3TWRA 5AARA 3AAAC 3J5PA 4DX2A 4BERA 4ZFHA 1A5EA 5ENTD 2ETAA 1DC2A 4O1OA 3NOCD 1BD8A 3NOGD 3EHRA 5EYPF 4O60A 4N5QA 1K3ZD 1N0QA 3JXIA 3W9FA 4CYMD 4HLLA 2DVWA 3TWQA 2V4HC 4K5BA 2AJAA 2XEEA 4DRXE 5JA4D 1BI8B 4G8LA 4DUIA 3NBNB 1BI7B 2KXPC 4LG6A 2MYOA 4YDYA 1BU9A 3TWWA 3EU9A 4HB5A 1IXVA 5BXOA 1YMPA 3DEPA 3V2XA 5AN8A 1TR4A 2PNNA 4U96D 1NFIE 2V5QC 5EILA 3V30A 2A5EA 4JB8P 2ETBA 3D9HA 3UXGA
chains in the Genus database with same CATH superfamily
3CKBA 4FA6A 2NSZA 3CR3A 3QAQA 4PUCA 5ANLA 5JHAA 4LNGA 3ZIMA 4FP7A 4I9EA 2RFMA 4HOSA 4UI9J 3PNLB 4BSXA 4KZCA 1D8EA 4I1MA 2KCKA 1MX6A 4ZHBA 4QQIA 4IYPA 3L82A 3Q15A 4WWPA 3UKRG 3HVEB 2P9KG 1IQUA 4B93B 1Z3XA 3MZLB 5LX8A 3CK8A 3TWSA 4RVBA 4N2SA 3EU5A 3RRUA 3ASNE 2JEKA 4A3TA 2XEVA 3G2TA 4CT4A 2R17C 3CVYA 3TG5A 3L08A 3CKCA 5ENRD 1QNFA 4FHKA 2OEWA 4BT9A 4IULA 1A17A 4Y6WA 4PS8A 1GW6A 2LSUA 1XNFA 4YVOA 3U9WA 3JQ1A 4O60A 2XHEA 3L22A 2BEDA 2AJAA 5B1BE 4G8LA 4DUIA 3QWWA 4LG6A 1UJKA 4MS6A 5BV0A 3R7QA 1HU3A 1H2TC 1S63A 3TXNA 4GPKA 1NFIE 4AV7A 3B7UX 5E75A 2CG2A 1X5BA 3ZEFA 5CBNA 5EIDA 4OYSA 3FUFA 2J4DA 2VGEA 1B89A 4CT0A 4CDRA 3D9OA 3RAUA 4J6IA 5HS0A 2RKKA 2YNQA 2DZNA 4DI4A 1QBQA 5E76A 4B8CB 3JXJA 3J5QB 3VLEA 3D9JA 5FQ6A 3SBTB 4UWGA 5AQ7A 4HI8A 4I17A 3Q75A 2DYRE 2CFZA 3I5PA 4URKA 3TGOA 1AWCB 1N11A 1H19A 1SW6A 5FQ7A 4U95D 5BXUA 3IXEA 3LEWA 3B95A 4G24A 3UT7A 2HO1A 3AJIA 4OVVA 3EIJA 3ISMC 2WXRA 4C9BB 1D8DA 1PC2A 4TRQA 3BG0B 1OUVA 4AY6A 3N71A 3ULYA 2J4BA 2XS1A 2WXHA 3JYSA 2V5QC 3BUAA 4E6HA 5G55A 3ESKA 3QC1A 1N4SA 3TAXA 2VTBA 4Q96A 3FUHA 2Y4UA 3Q47B 4DX1A 2WQ7A 5C2YA 1KT1A 2H6GA 1HF8A 3FTYA 4YNDA 4A63B 4Q69A 3AS4A 3UM1A 2YHCA 3PZ3A 1W3BA 2KBXA 4U8HA 3SBSA 1FCHA 4UI9K 3ULQA 4AEZC 4AY5A 2HE0A 4HLEA 2LXMA 2UY1A 2MRIA 3B7RL 3S7BA 3E4BA 1OWLA 3PZ4A 2P9IG 4GYOA 1HG5A 2ZGDA 2WQHA 1JWGA 4CRWA 3CK7A 3KD7A 4WWNA 4O6FA 1BPOA 5CMWA 3U66A 1DVPA 4LSZE 3ZPJA 1PY1A 4HVBA 3NF1A 4BERA 4RG6A 3PEUB 4I6JA 4GTTA 3C72A 3PRZA 1SZAA 3CK9A 3W9FA 4UWKA 4K5BA 4UWHA 4BFRA 3SFYA 4GTRA 3SI5A 4XIFA 1HFAA 5FQ8A 3D9NA 3PZ2A 4J7WA 4DLOA 5LP0A 3MX3A 3AS5A 1UOHA 5JJ6A 4N3AA 3AG2E 4N5CA 1EF1C 1E7VA 2KC7A 1HE8A 4GYYA 2EILE 3FHEA 2F8XK 1X81A 4FHJA 5G05C 4HS2A 2I1JA 1JCQA 1UG3A 2P9UG 4WUYA 4OAVB 5BPPA 5KCMA 1U2VG 4KXKB 4XKBA 3Q7FA 4RSYA 1KZOA 2Q7FA 3L17A 3CHOA 3UQ3A 3SHFA 4HRLA 1TN6A 3UI2A 2Y3AA 2XGSA 3NZSA 1YA0A 5A23A 5CBOA 5AIJA 1QQEA 2WXQA 2EIKE 3QDNA 2HYZA 4C0EA 3UX4A 2ETAA 4GU5A 4AM9A 3L54A 3X2QE 2WXNA 4CEMA 2LSVA 3ABKE 3APDA 1OXJA 3FDHA 3PE4A 4UI9C 4I2ZA 2IY0C 3V2OA 4JXTA 3ASFA 4YDEA 3D9LA 4BTBA 4GMRA 2R03A 2B0OE 4FADA 2NYJA 4L23A 1OCCE 2IQCA 3SFZA 4I9CA 4EQFA 3TL5A 5KJLA 2VGXB 1DNPA 5C1DA 4Z68A 4X8QA 3ENEA 4HFGA 3UUXA 1IHBA 4WNDA 4JHJA 2WXJA 2NXPA 2ZGGA 1K1AA 3DPDA 1K1BA 4A1GA 1N94A 4JC8A 2XRYA 3C3QA 2VSXE 1OCZE 3GYZA 3FUJA 3FTUA 4EHMA 2Y4TA 1FT2A 3QB2A 5CERB 1HO8A 3FTXA 2PL2A 2XZTG 1O1TA 3E32A 1TN7A 5IY5E 3FEYA 4TXPA 5BT1A 3HDXA 1Z3YA 3DEPA 1IYGA 3RO2A 2LAHA 2VGYA 4TXRA 5CMYA 2RFAA 2RD0A 2PZIA 2E0IA 3LJNA 4PH4B 2GRRB 1INZA 3AG4E 3R7RA 5KJNA 4A1SA 4TUUA 3FEXA 3B7TA 1WM5A 3D9KA 5FWQA 1H6OA 3Q79A 4ANUA 5ENQD 4G1TA 5JHBA 3Q9UC 1OWMA 3CHSA 4L7TA 1HX8A 2RG8A 2Y69E 3EHQA 2QC9A 1N9AA 3U3WA 2IOSA 2XQ0A 1VDYA 3FUIA 3E34A 2KM4A 2VJ8A 3HXEA 3FU0A 5AJLA 3ZUVB 4JD2G 3OXLA 5BNWA 3AAAC 1S0PA 5ENTD 1DC2A 4GTMA 3PREA 4PS7A 4XEIG 3PUJA 3C98A 5FTPA 2ZXWE 2XPYA 3UINC 2VSYA 3MCXA 5LFAA 1K8KG 2GROB 1WY6A 4J8EA 2FI7A 4BETA 4GZ5A 4HXIA 2OVFA 4HOTA 3FY4A 5ENSD 1LD8A 1N4QA 4F53A 1ELKA 3HXBA 2XCBA 4ACKA 3W9GA 2CHZA 1DCQA 1IHGA 1Z5SC 3NB2A 4GZCA 1OCRE 3P1UA 3G2VA 1OWNA 2Y0BG 4MKTA 2UWJG 3KEAA 4J8YA 3DXKG 2FBNA 4G11A 2FO7A 3IEGA 4OAUC 3FUMA 3LY8A 3FTZA 2X6HA 3VLFA 2XCCA 3FTVA 1TN8A 1N52A 3NZUA 4EECA 1NL4A 4KMOA 3AS8A 1TYQG 4BX9A 3MKRA 5B1AE 4HI9A 1H0AA 2DYSE 2CG3A 5AARA 3ZGQA 3R9AB 4LEUA 3OAWA 2IOLA 4R7LA 1TEZA 1N0QA 4LRZA 3TWQA 3C3OA 1ELWA 1KLXA 4GTQA 1BI7B 2AVPA 1KPSB 2MYOA 5BXOA 1FVFA 3V2XA 2XGOA 3K9IA 2YQ8A 2L0IA 3UXGA 4G8KA 4GCNA 4KT6B 3G2SA 4PDXA 2BKKB 2WQ6A 2IU1A 4ATZD 3LJ3A 2XEHA 1QZ2A 3LCAA 3PUKA 3QKYA 4DJAA 3Q5MA 1E7UA 4U07A 3R9MA 4U04A 2FO1E 1WDYA 2AWIA 5KJKA 4BEPA 3ZNGA 2A5UA 1HH8A 3MA5A 5AQ9A 1UW4B 4ABNA 2IFUA 1RZ4A 1JWFA 5ENNA 4IN3B 4WNFA 4HOUA 4G2VA 3FUDA 4WAFA 2I1KA 2DZOA 3CVNA 4ILHB 1JCSA 3PE3A 3WG7E 1O1RA 2WXOA 2JABA 1DCEA 3FUKA 1WG0A 2XZDG 4C48B 2LAIA 3T5VA 4ILGA 2QYJA 3UTMA 3Q78A 4KYOB 1BD8A 1HZ4A 3LS8A 3ZXSA 2V4HC 1MHQA 2B6CA 4GTSA 3GZ2A 5AJDA 4YDYA 1O5MA 4HB5A 1OCOE 3SNXA 4U96D 1TNBA 3RO3A 2VSNA 2ZISA 4EPZA 5JJ7A 1E96B 1SVXA 3ABME 5FZQA 1D9SA 5CECB 4M3OA 5EDSA 4ACLA 3SO8A 4B8AA 3FH5A 3OXFA 3UM2A 2VSOE 2C0LA 1QYMA 2WXFA 4BWRA 2H6IA 3QWVA 1N4RA 3S7DA 3UM0A 2KCVA 4CZ2D 2I9CA 4N2QA 3EHNA 4I2WA 5G04J 1NP7A 4O1PA 2XS8A 5HKPA 1JUQA 1Z6TA 1RW2A 3MJWA 2XENA 4XX5A 1E90A 5ENPD 3L9TA 3LXUX 3ZFWA 4M7CA 5J08A 5EN5D 5CRVA 3PDNA 1YCSB 2PQRA 5HI7A 1UJJA 4F7AA 3CV0A 4RLYA 3TWTA 4JL0A 3TJPA 3Q9NC 1LD7A 3RJVA 1TJFA 2VGXA 2WPVA 4F1PA 2DCPA 4ZFHA 5CHEE 3EIQC 1OWPA 4BT8A 4NRHB 1FT1A 3FTSA 4J8DA 1HXIA 4N5QA 3ZW3A 4H7YA 4B89A 3HHMA 4HLLA 2IO2C 3ZYKA 4JZYA 1HS6A 2KXPC 3CGHA 1XGWA 3MKQA 4BTAA 2X3MA 2DIWA 3AG3E 4FJZA 1NA3A 5EILA 2GW1A 2P2CP 4MLPA 3IHVA 1IKND 3HG0D 3DPYA 4L2LA 3L6AA 3ONKA 4UQYA 2L6BA 3DWLG 4GMJA 2AW6A 2WXKA 2ZIRA 3I4RB 3IKOB 3IBEA 2YHEA 4U7EB 3U4TA 2BTDA 3SQVA 3HYMB 3DSXA 4N3BA 4NIKA 5FINA 3LY9A 4I6GA 4CGVA 3QNKA 1EYHA 4AXHA 2QY7A 5D0QD 3DRAA 1JPLA 3ABLE 4GTOA 2ETCA 2WXLA 3CHMA 5JMND 5T4YA 3HIZA 5KNHD 3MEKA 4LUNU 4CGWA 1ELRA 2WM9A 3RU0A 2WXIA 3RSEG 1E8XA 1FPPA 1Y6IA 1UN9A 3MKQB 4XKCA 4KVMA 3Q4AB 3DEOA 4N39A 3CEQA 3ZYMA 4KZ0A 5LCWJ 3IHYA 4A3VA 3NOGD 2BF0X 2BUGA 4JHRA 4FJYA 2CHXA 2P9PG 3VTXA 2PM7A 3PEVB 4P29A 3I4GA 4U0UA 1IXVA 1YMPA 1U3CA 2LO6A 3QWPA 4EZJA 4JHKA 5M72A 2HR2A 3G2WA 4A55A 4FC8A 3APFA 2QZAA 2JLBA 3VTYA 2E2EA 2F0YA 3KS2A 2P9NG 3CVWA 2OOEA 4U0SA 4FLBA 2GRLA 2J07A 4HORA 2KCLA 4WNEA 4L1BA 3LY7A 1O1SA 4F3VA 3FU5A 5D66A 3TWXA 3VLDA 3C5RA 4TV3A 1TJCA 1KZPA 3PH0C 2NC9A 4LERA 5FIOA 4N3CA 3ASOE 4GPMA 3DSWA 3GZSA 3RRNB 2AXZA 4CDMA 2GGFA 3DSSA 5DBKA 4XI0A 3BEEA 2WXGA 5CEAA 3ESLA 1TNZA 3S7JA 2QFCA 4IRUA 1SA5A 5ENOD 3EDTB 4LNUD 2EINE 3TG4A 3DSTA 5AQAA 5HQ8A 4RQIA 2OCCE 4DX5D 5T3RA 4FU3A 3GW4A 3FULA 3EUVA 4Q94A 3UMVA 3PVLA 2KZTA 2P9SG 2YINA 3JXIA 3QOUA 1H2VC 2DBAA 5EX0A 4ATGA 2C2LA 1E8ZA 2P9LG 2R05A 5HRYA 4GAAA 4Y6CA 2DWZA 4ANWA 4K5CA 3LVQE 4HBDA 3SY2A 5KWDA 2R59A 4GA1A 4XE0A 1H2UA 5B3SE 4J8FA 2LNIA 5H7PA 3CVVA 2IEJA 1MYOA 5CCMA 4WWOA 3SF4A 4B0ZA 4B94A 4BSZB 3MYVA 5D2MC 3FU3A 3DXMG 3UT8A 1N0RA 3KAEA 3FUEA 4AJWA 1MX4A 3FFLA 2ETBA 1H6KA 3OTNA 5FJYA 3JUIA 1N54A 2H6HA 4JW1A 5AQBA 2X38A 4RG9A 4TXQA 2WMNA 3Q49B 1SZ9A 4GTPA 4DX6D 2KZTB 4G25A 2ONDA 3HXCA 4YDWA 4LNBA 1P5QA 4QFVA 2V8SE 4YDOA 2V4LA 5T8IA 2A4ZA 4U0ZA 3ZYQA 2FF4A 3EHRA 4K0RA 3D9IA 2L0TB 5BV1A 2MHKA 1MZCA 3PZDA 3URZA 4YVQC 5ARGA 3ZVVA 3ZN3A 3ASGA 3ZXPA 3FWVA 2PNNA 3CQGB 3V30A 4JB8P 3MGBA 3D9HA 5KNGA 1PAQA 1ZB1A 4V3IA 3U64A 3UT4A 3PZ1A 2KATA 3OXGA 4ILIA 4UQXA 3B7BA 3L13A 3CSFA 3CVLA 3QJZA 2EQXA 4JPSA 3ZYLA 5G04C 2IF4A 3KEZA 2CFUA 3ZKJA 5KJMA 5AAOA 3FTWA 2CHWA 3T9KA 4JVSA 3ML9A 2V0PA 1TNUA 5BUZA 2IO3C 2I6HA 4GZDA 3ASHA 5ARFA 3V79K 2J49A 4NACA 3CHPA 4LCTA 2Y1LE 4JA7A 4U63A 5EYLA 3NAWA 3S2AA 2J8SD 3UKUG 2WB2A 1JCRA 1E8WA 3CHRA 4DLQA 2LUHA 2WXMA 2F8YA 3LYAA 4I6EA 3O48A 3UIPC 3D3MA 3CSTA 3O4ZA 3ONLA 3D9MA 3LVRE 3MV2B 4FLHA 1S70B 4MRUA 2J08A 1EPUA 4UWLA 1WAO1 4DX2A 2EIME 3E37A 5EYPF 5ANRA 4L2YA 4GZ3A 1K3ZD 3FH8A 3ZHEA 4CYMD 3T5XA 4DRXE 2XEEA 1E8YA 3NBNB 4C0MA 3TWWA 3KSLA 3ULEG 5AN8A 2X6JA 2HM8A 3AG1E 4HQDA 1L5JA 5FQ4A 2P58C 4DPRA 4U8VD 1MX2A 4GMLA 4EZLA 3QARA 3E30A 3UM3A 3PNTB 4L9PA 4GTVA 3BU8A 1N95A 1Q2ZA 4JA9A 5EIBE 5D0OD 3JCKC 3ASDA 4XI9A 4UUCA 2ZU6B 1LF8A 3SD5A 5A7DB 3LKUA 5CCLA 2OVBA 1G3NB 1YYHA 3I3NA 4PS3A 5FT9A 1OY3D 4BY6A 1NZNA 1UN8A 1MJ0A 2FULA 3GZ1A 1KT0A 4K03A 3C3RA 2VTBB 4G23A 3AU5A 3JUEA 5LCWC 3FH7A 3DSUA 4ME2A 3ZHEB 4JEUA 5FZRA 3TWVA 2J09A 5BW8C 2PM6A 2GRQB 2XRZA 3JQ0A 3RKVA 1LTXA 4EZKA 2L6JA 2OV8A 1MQSA 4J0UA 1N4PA 2C0MA 2WVIA 2FEZA 4I43A 5EX3A 5JA4D 2J9QA 3SGHA 3KSQA 2OEVA 2IJGX 1BU9A 4DK5A 2WMOA 3EU9A 3FU6A 3Q7AA 2UY1B 3CQCB 1SA4A 4AIFA 5ITZF 3IV0A 3ZRHA 3DSVA 1EDUA 2ILRA 3RIBA 2EIJE 3L16A 5DIZA 3ZU7B 5J90A 4HRMB 2QYUA 1H6PA 3HXDA 3CVUA 1IQRA 3WXXA 2XGMA 4TUMA 4W9RA 3CLJA 1ZU2A 3LPZA 5KBAA 3V31A 4GCOA 1V54E 2VYIA 3CVPA 4I1OB 2AXVA 4HRNA 5AENA 2R02A 3HRAA 3CIAA 1U3DA 2XPIA 3HXFA 2M63A 3EJNA 2VQ2A 2PQNA 3BQOA 3AU4A 4HNAD 3BG1B 5G2NA 2V5FA 4BX8A 5CEDB 5LOZA 4ANXA 4MBGA 3P2BA 3QK0A 4HOQA 3NQPA 1OWOA 4AP2A 3B13A 2GRMA 5AYWD 3UPVA 3CVXA 3LDZA 4CCAA 1ZBPA 4F6RD 3TWRA 3J5PA 2GRNB 3CHQA 4EBAA 3NOCD 4NURA 5EKQD 2AXUA 3TXMA 2X6IA 1HG2A 4J8SA 3EHMA 2GRPB 1BI8B 3SZ7A 4D10C 1Y8MA 4AVXA 5FZSA 2A5EA 1NI1A 4EBAG 2MOWA 3S7FA 4XZ4A 2LXLA 1SQMA 4DX7D 2X6FA 3FUNA 4AOFA 3MV3B 5A6CA 3D9PA 1TNOA 2I2OA 3DBSA 4DI3A 3G2UA 3T8MA 2R5SA 3TWUA 4E85A 2H6FA 4GZ6A 2L9BA 3B7SA 3Q73A 4APFA 4ANVA 3RK6A 4FULA 3SFXA 4U8YD 1AP7A 4BESA 1BLXB 2XPZA 4JEHA 4OVUA 5G05J 1S64A 2WXPA 1OT8A 3ML8A 3UIOC 4GB9A 5JJTA 3HVEA 4G26A 3FP3A 4CDNA 3E33A 4GYWA 3T8KA 1NA0A 3PS6A 3F6QA 4H7XA 2BKGA 4GA0A 2F37A 2IONA 4I1AA 4K5AB 4UWFA 3CVQA 5CRUA 1A5EA 4GA2A 3RRMB 4O1OA 2R2LA 4NQ0A 1V55E 3APCA 4UQZA 2DVWA 4WNGA 4APOA 2X6KA 1FVHA 1TNYA 1TR4A 4F1SA 4KVOA 4KBQA
chains in the Genus database with same CATH topology
5HRYA 2P2CP 4BETA 5ITZF 3V2OA 4G8KA 4J7WA 2DWZA 4HQDA 5KNGA 1IKND 1SVXA 3HG0D 4K5CA 5CBNA 5EIDA 2RFAA 5CECB 1D9SA 1UOHA 4GMRA 2BKKB 2VGEA 3LJNA 4U8VD 2B0OE 5ENSD 4HBDA 2L6BA 1MX2A 3B7BA 4DX7D 5KWDA 3ZU7B 2NYJA 2RFMA 4DX1A 3SO8A 4HRMB 4ATZD 2XEHA 4A63B 3W9GA 5HS0A 1DCQA 2F8XK 1QYMA 5EIBE 4TUMA 2DZNA 1MX6A 4ZHBA 4QQIA 3TWUA 3ZKJA 2FO1E 1WDYA 4UUCA 4BEPA 4NIKA 3JXJA 5FINA 5AAOA 3ZNGA 1MYOA 5KBAA 3V31A 4Z68A 3J5QB 5ENQD 3T9KA 2Y0BG 4OAVB 2KBXA 5D66A 3TWXA 4B93B 5AQ9A 4CZ2D 1G3NB 3Q9UC 4HRNA 1YYHA 3C5RA 4U8YD 4BSZB 3KEAA 4J8YA 5AQ7A 1AP7A 3HRAA 1BLXB 1IHBA 4BESA 4HI8A 1OY3D 2HE0A 5FIOA 4O1PA 1N0RA 4GPMA 3TWSA 3V79K 5HKPA 2ETCA 3EHQA 1MJ0A 1MX4A 1OT8A 4HNAD 4OAUC 2QC9A 1K1AA 2XENA 2ZGGA 5JMND 1AWCB 5ENPD 1K1BA 2Y1LE 4HRLA 5EYLA 5CEDB 5KNHD 3UI2A 2J8SD 2DZOA 5EN5D 1N11A 5CEAA 5AQBA 1YCSB 2ZGDA 1SW6A 3T8KA 5ENOD 3JUEA 4U95D 5BXUA 4DX6D 3IXEA 3F6QA 4LNUD 2JABA 2F8YA 4RLYA 3TWTA 5CBOA 5ENRD 1WG0A 2BKGA 2XZDG 3B95A 3Q9NC 5AQAA 3TWVA 3ZUVB 4C48B 4YDWA 5CERB 3AJIA 4LSZE 4HI9A 2F37A 4QFVA 1S70B 4DX5D 2QYJA 2XZTG 3UTMA 4K5AB 4F1PA 4F6RD 3DEOA 3TWRA 5AARA 3AAAC 3J5PA 4DX2A 4BERA 4ZFHA 1A5EA 5ENTD 2ETAA 1DC2A 4O1OA 3NOCD 1BD8A 3NOGD 3EHRA 5EYPF 4O60A 4N5QA 1K3ZD 1N0QA 3JXIA 3W9FA 4CYMD 4HLLA 2DVWA 3TWQA 2V4HC 4K5BA 2AJAA 2XEEA 4DRXE 5JA4D 1BI8B 4G8LA 4DUIA 3NBNB 1BI7B 2KXPC 4LG6A 2MYOA 4YDYA 1BU9A 3TWWA 3EU9A 4HB5A 1IXVA 5BXOA 1YMPA 3DEPA 3V2XA 5AN8A 1TR4A 2PNNA 4U96D 1NFIE 2V5QC 5EILA 3V30A 2A5EA 4JB8P 2ETBA 3D9HA 3UXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRY A;  2P2C P;  4BET A;  5ITZ F;  3V2O A;  4G8K A;  4J7W A;  2DWZ A;  4HQD A;  5KNG A;  1IKN D;  1SVX A;  3HG0 D;  4K5C A;  5CBN A;  5EID A;  2RFA A;  5CEC B;  1D9S A;  1UOH A;  4GMR A;  2BKK B;  2VGE A;  3LJN A;  4U8V D;  2B0O E;  5ENS D;  4HBD A;  2L6B A;  1MX2 A;  3B7B A;  4DX7 D;  5KWD A;  3ZU7 B;  2NYJ A;  2RFM A;  4DX1 A;  3SO8 A;  4HRM B;  4ATZ D;  2XEH A;  4A63 B;  3W9G A;  5HS0 A;  1DCQ A;  2F8X K;  1QYM A;  5EIB E;  4TUM A;  2DZN A;  1MX6 A;  4ZHB A;  4QQI A;  3TWU A;  3ZKJ A;  2FO1 E;  1WDY A;  4UUC A;  4BEP A;  4NIK A;  3JXJ A;  5FIN A;  5AAO A;  3ZNG A;  1MYO A;  5KBA A;  3V31 A;  4Z68 A;  3J5Q B;  5ENQ D;  3T9K A;  2Y0B G;  4OAV B;  2KBX A;  5D66 A;  3TWX A;  4B93 B;  5AQ9 A;  4CZ2 D;  1G3N B;  3Q9U C;  4HRN A;  1YYH A;  3C5R A;  4U8Y D;  4BSZ B;  3KEA A;  4J8Y A;  5AQ7 A;  1AP7 A;  3HRA A;  1BLX B;  1IHB A;  4BES A;  4HI8 A;  1OY3 D;  2HE0 A;  5FIO A;  4O1P A;  1N0R A;  4GPM A;  3TWS A;  3V79 K;  5HKP A;  2ETC A;  3EHQ A;  1MJ0 A;  1MX4 A;  1OT8 A;  4HNA D;  4OAU C;  2QC9 A;  1K1A A;  2XEN A;  2ZGG A;  5JMN D;  1AWC B;  5ENP D;  1K1B A;  2Y1L E;  4HRL A;  5EYL A;  5CED B;  5KNH D;  3UI2 A;  2J8S D;  2DZO A;  5EN5 D;  1N11 A;  5CEA A;  5AQB A;  1YCS B;  2ZGD A;  1SW6 A;  3T8K A;  5ENO D;  3JUE A;  4U95 D;  5BXU A;  4DX6 D;  3IXE A;  3F6Q A;  4LNU D;  2JAB A;  2F8Y A;  4RLY A;  3TWT A;  5CBO A;  5ENR D;  1WG0 A;  2BKG A;  2XZD G;  3B95 A;  3Q9N C;  5AQA A;  3TWV A;  3ZUV B;  4C48 B;  4YDW A;  5CER B;  3AJI A;  4LSZ E;  4HI9 A;  2F37 A;  4QFV A;  1S70 B;  4DX5 D;  2QYJ A;  2XZT G;  3UTM A;  4K5A B;  4F1P A;  4F6R D;  3DEO A;  3TWR A;  5AAR A;  3AAA C;  3J5P A;  4DX2 A;  4BER A;  4ZFH A;  1A5E A;  5ENT D;  2ETA A;  1DC2 A;  4O1O A;  3NOC D;  1BD8 A;  3NOG D;  3EHR A;  5EYP F;  4O60 A;  4N5Q A;  1K3Z D;  1N0Q A;  3JXI A;  3W9F A;  4CYM D;  4HLL A;  2DVW A;  3TWQ A;  2V4H C;  4K5B A;  2AJA A;  2XEE A;  4DRX E;  5JA4 D;  1BI8 B;  4G8L A;  4DUI A;  3NBN B;  1BI7 B;  2KXP C;  4LG6 A;  2MYO A;  4YDY A;  1BU9 A;  3TWW A;  3EU9 A;  4HB5 A;  1IXV A;  5BXO A;  1YMP A;  3DEP A;  3V2X A;  5AN8 A;  1TR4 A;  2PNN A;  4U96 D;  1NFI E;  2V5Q C;  5EIL A;  3V30 A;  2A5E A;  4JB8 P;  2ETB A;  3D9H A;  3UXG A; 
#chains in the Genus database with same CATH topology
 3CKB A;  4FA6 A;  2NSZ A;  3CR3 A;  3QAQ A;  4PUC A;  5ANL A;  5JHA A;  4LNG A;  3ZIM A;  4FP7 A;  4I9E A;  2RFM A;  4HOS A;  4UI9 J;  3PNL B;  4BSX A;  4KZC A;  1D8E A;  4I1M A;  2KCK A;  1MX6 A;  4ZHB A;  4QQI A;  4IYP A;  3L82 A;  3Q15 A;  4WWP A;  3UKR G;  3HVE B;  2P9K G;  1IQU A;  4B93 B;  1Z3X A;  3MZL B;  5LX8 A;  3CK8 A;  3TWS A;  4RVB A;  4N2S A;  3EU5 A;  3RRU A;  3ASN E;  2JEK A;  4A3T A;  2XEV A;  3G2T A;  4CT4 A;  2R17 C;  3CVY A;  3TG5 A;  3L08 A;  3CKC A;  5ENR D;  1QNF A;  4FHK A;  2OEW A;  4BT9 A;  4IUL A;  1A17 A;  4Y6W A;  4PS8 A;  1GW6 A;  2LSU A;  1XNF A;  4YVO A;  3U9W A;  3JQ1 A;  4O60 A;  2XHE A;  3L22 A;  2BED A;  2AJA A;  5B1B E;  4G8L A;  4DUI A;  3QWW A;  4LG6 A;  1UJK A;  4MS6 A;  5BV0 A;  3R7Q A;  1HU3 A;  1H2T C;  1S63 A;  3TXN A;  4GPK A;  1NFI E;  4AV7 A;  3B7U X;  5E75 A;  2CG2 A;  1X5B A;  3ZEF A;  5CBN A;  5EID A;  4OYS A;  3FUF A;  2J4D A;  2VGE A;  1B89 A;  4CT0 A;  4CDR A;  3D9O A;  3RAU A;  4J6I A;  5HS0 A;  2RKK A;  2YNQ A;  2DZN A;  4DI4 A;  1QBQ A;  5E76 A;  4B8C B;  3JXJ A;  3J5Q B;  3VLE A;  3D9J A;  5FQ6 A;  3SBT B;  4UWG A;  5AQ7 A;  4HI8 A;  4I17 A;  3Q75 A;  2DYR E;  2CFZ A;  3I5P A;  4URK A;  3TGO A;  1AWC B;  1N11 A;  1H19 A;  1SW6 A;  5FQ7 A;  4U95 D;  5BXU A;  3IXE A;  3LEW A;  3B95 A;  4G24 A;  3UT7 A;  2HO1 A;  3AJI A;  4OVV A;  3EIJ A;  3ISM C;  2WXR A;  4C9B B;  1D8D A;  1PC2 A;  4TRQ A;  3BG0 B;  1OUV A;  4AY6 A;  3N71 A;  3ULY A;  2J4B A;  2XS1 A;  2WXH A;  3JYS A;  2V5Q C;  3BUA A;  4E6H A;  5G55 A;  3ESK A;  3QC1 A;  1N4S A;  3TAX A;  2VTB A;  4Q96 A;  3FUH A;  2Y4U A;  3Q47 B;  4DX1 A;  2WQ7 A;  5C2Y A;  1KT1 A;  2H6G A;  1HF8 A;  3FTY A;  4YND A;  4A63 B;  4Q69 A;  3AS4 A;  3UM1 A;  2YHC A;  3PZ3 A;  1W3B A;  2KBX A;  4U8H A;  3SBS A;  1FCH A;  4UI9 K;  3ULQ A;  4AEZ C;  4AY5 A;  2HE0 A;  4HLE A;  2LXM A;  2UY1 A;  2MRI A;  3B7R L;  3S7B A;  3E4B A;  1OWL A;  3PZ4 A;  2P9I G;  4GYO A;  1HG5 A;  2ZGD A;  2WQH A;  1JWG A;  4CRW A;  3CK7 A;  3KD7 A;  4WWN A;  4O6F A;  1BPO A;  5CMW A;  3U66 A;  1DVP A;  4LSZ E;  3ZPJ A;  1PY1 A;  4HVB A;  3NF1 A;  4BER A;  4RG6 A;  3PEU B;  4I6J A;  4GTT A;  3C72 A;  3PRZ A;  1SZA A;  3CK9 A;  3W9F A;  4UWK A;  4K5B A;  4UWH A;  4BFR A;  3SFY A;  4GTR A;  3SI5 A;  4XIF A;  1HFA A;  5FQ8 A;  3D9N A;  3PZ2 A;  4J7W A;  4DLO A;  5LP0 A;  3MX3 A;  3AS5 A;  1UOH A;  5JJ6 A;  4N3A A;  3AG2 E;  4N5C A;  1EF1 C;  1E7V A;  2KC7 A;  1HE8 A;  4GYY A;  2EIL E;  3FHE A;  2F8X K;  1X81 A;  4FHJ A;  5G05 C;  4HS2 A;  2I1J A;  1JCQ A;  1UG3 A;  2P9U G;  4WUY A;  4OAV B;  5BPP A;  5KCM A;  1U2V G;  4KXK B;  4XKB A;  3Q7F A;  4RSY A;  1KZO A;  2Q7F A;  3L17 A;  3CHO A;  3UQ3 A;  3SHF A;  4HRL A;  1TN6 A;  3UI2 A;  2Y3A A;  2XGS A;  3NZS A;  1YA0 A;  5A23 A;  5CBO A;  5AIJ A;  1QQE A;  2WXQ A;  2EIK E;  3QDN A;  2HYZ A;  4C0E A;  3UX4 A;  2ETA A;  4GU5 A;  4AM9 A;  3L54 A;  3X2Q E;  2WXN A;  4CEM A;  2LSV A;  3ABK E;  3APD A;  1OXJ A;  3FDH A;  3PE4 A;  4UI9 C;  4I2Z A;  2IY0 C;  3V2O A;  4JXT A;  3ASF A;  4YDE A;  3D9L A;  4BTB A;  4GMR A;  2R03 A;  2B0O E;  4FAD A;  2NYJ A;  4L23 A;  1OCC E;  2IQC A;  3SFZ A;  4I9C A;  4EQF A;  3TL5 A;  5KJL A;  2VGX B;  1DNP A;  5C1D A;  4Z68 A;  4X8Q A;  3ENE A;  4HFG A;  3UUX A;  1IHB A;  4WND A;  4JHJ A;  2WXJ A;  2NXP A;  2ZGG A;  1K1A A;  3DPD A;  1K1B A;  4A1G A;  1N94 A;  4JC8 A;  2XRY A;  3C3Q A;  2VSX E;  1OCZ E;  3GYZ A;  3FUJ A;  3FTU A;  4EHM A;  2Y4T A;  1FT2 A;  3QB2 A;  5CER B;  1HO8 A;  3FTX A;  2PL2 A;  2XZT G;  1O1T A;  3E32 A;  1TN7 A;  5IY5 E;  3FEY A;  4TXP A;  5BT1 A;  3HDX A;  1Z3Y A;  3DEP A;  1IYG A;  3RO2 A;  2LAH A;  2VGY A;  4TXR A;  5CMY A;  2RFA A;  2RD0 A;  2PZI A;  2E0I A;  3LJN A;  4PH4 B;  2GRR B;  1INZ A;  3AG4 E;  3R7R A;  5KJN A;  4A1S A;  4TUU A;  3FEX A;  3B7T A;  1WM5 A;  3D9K A;  5FWQ A;  1H6O A;  3Q79 A;  4ANU A;  5ENQ D;  4G1T A;  5JHB A;  3Q9U C;  1OWM A;  3CHS A;  4L7T A;  1HX8 A;  2RG8 A;  2Y69 E;  3EHQ A;  2QC9 A;  1N9A A;  3U3W A;  2IOS A;  2XQ0 A;  1VDY A;  3FUI A;  3E34 A;  2KM4 A;  2VJ8 A;  3HXE A;  3FU0 A;  5AJL A;  3ZUV B;  4JD2 G;  3OXL A;  5BNW A;  3AAA C;  1S0P A;  5ENT D;  1DC2 A;  4GTM A;  3PRE A;  4PS7 A;  4XEI G;  3PUJ A;  3C98 A;  5FTP A;  2ZXW E;  2XPY A;  3UIN C;  2VSY A;  3MCX A;  5LFA A;  1K8K G;  2GRO B;  1WY6 A;  4J8E A;  2FI7 A;  4BET A;  4GZ5 A;  4HXI A;  2OVF A;  4HOT A;  3FY4 A;  5ENS D;  1LD8 A;  1N4Q A;  4F53 A;  1ELK A;  3HXB A;  2XCB A;  4ACK A;  3W9G A;  2CHZ A;  1DCQ A;  1IHG A;  1Z5S C;  3NB2 A;  4GZC A;  1OCR E;  3P1U A;  3G2V A;  1OWN A;  2Y0B G;  4MKT A;  2UWJ G;  3KEA A;  4J8Y A;  3DXK G;  2FBN A;  4G11 A;  2FO7 A;  3IEG A;  4OAU C;  3FUM A;  3LY8 A;  3FTZ A;  2X6H A;  3VLF A;  2XCC A;  3FTV A;  1TN8 A;  1N52 A;  3NZU A;  4EEC A;  1NL4 A;  4KMO A;  3AS8 A;  1TYQ G;  4BX9 A;  3MKR A;  5B1A E;  4HI9 A;  1H0A A;  2DYS E;  2CG3 A;  5AAR A;  3ZGQ A;  3R9A B;  4LEU A;  3OAW A;  2IOL A;  4R7L A;  1TEZ A;  1N0Q A;  4LRZ A;  3TWQ A;  3C3O A;  1ELW A;  1KLX A;  4GTQ A;  1BI7 B;  2AVP A;  1KPS B;  2MYO A;  5BXO A;  1FVF A;  3V2X A;  2XGO A;  3K9I A;  2YQ8 A;  2L0I A;  3UXG A;  4G8K A;  4GCN A;  4KT6 B;  3G2S A;  4PDX A;  2BKK B;  2WQ6 A;  2IU1 A;  4ATZ D;  3LJ3 A;  2XEH A;  1QZ2 A;  3LCA A;  3PUK A;  3QKY A;  4DJA A;  3Q5M A;  1E7U A;  4U07 A;  3R9M A;  4U04 A;  2FO1 E;  1WDY A;  2AWI A;  5KJK A;  4BEP A;  3ZNG A;  2A5U A;  1HH8 A;  3MA5 A;  5AQ9 A;  1UW4 B;  4ABN A;  2IFU A;  1RZ4 A;  1JWF A;  5ENN A;  4IN3 B;  4WNF A;  4HOU A;  4G2V A;  3FUD A;  4WAF A;  2I1K A;  2DZO A;  3CVN A;  4ILH B;  1JCS A;  3PE3 A;  3WG7 E;  1O1R A;  2WXO A;  2JAB A;  1DCE A;  3FUK A;  1WG0 A;  2XZD G;  4C48 B;  2LAI A;  3T5V A;  4ILG A;  2QYJ A;  3UTM A;  3Q78 A;  4KYO B;  1BD8 A;  1HZ4 A;  3LS8 A;  3ZXS A;  2V4H C;  1MHQ A;  2B6C A;  4GTS A;  3GZ2 A;  5AJD A;  4YDY A;  1O5M A;  4HB5 A;  1OCO E;  3SNX A;  4U96 D;  1TNB A;  3RO3 A;  2VSN A;  2ZIS A;  4EPZ A;  5JJ7 A;  1E96 B;  1SVX A;  3ABM E;  5FZQ A;  1D9S A;  5CEC B;  4M3O A;  5EDS A;  4ACL A;  3SO8 A;  4B8A A;  3FH5 A;  3OXF A;  3UM2 A;  2VSO E;  2C0L A;  1QYM A;  2WXF A;  4BWR A;  2H6I A;  3QWV A;  1N4R A;  3S7D A;  3UM0 A;  2KCV A;  4CZ2 D;  2I9C A;  4N2Q A;  3EHN A;  4I2W A;  5G04 J;  1NP7 A;  4O1P A;  2XS8 A;  5HKP A;  1JUQ A;  1Z6T A;  1RW2 A;  3MJW A;  2XEN A;  4XX5 A;  1E90 A;  5ENP D;  3L9T A;  3LXU X;  3ZFW A;  4M7C A;  5J08 A;  5EN5 D;  5CRV A;  3PDN A;  1YCS B;  2PQR A;  5HI7 A;  1UJJ A;  4F7A A;  3CV0 A;  4RLY A;  3TWT A;  4JL0 A;  3TJP A;  3Q9N C;  1LD7 A;  3RJV A;  1TJF A;  2VGX A;  2WPV A;  4F1P A;  2DCP A;  4ZFH A;  5CHE E;  3EIQ C;  1OWP A;  4BT8 A;  4NRH B;  1FT1 A;  3FTS A;  4J8D A;  1HXI A;  4N5Q A;  3ZW3 A;  4H7Y A;  4B89 A;  3HHM A;  4HLL A;  2IO2 C;  3ZYK A;  4JZY A;  1HS6 A;  2KXP C;  3CGH A;  1XGW A;  3MKQ A;  4BTA A;  2X3M A;  2DIW A;  3AG3 E;  4FJZ A;  1NA3 A;  5EIL A;  2GW1 A;  2P2C P;  4MLP A;  3IHV A;  1IKN D;  3HG0 D;  3DPY A;  4L2L A;  3L6A A;  3ONK A;  4UQY A;  2L6B A;  3DWL G;  4GMJ A;  2AW6 A;  2WXK A;  2ZIR A;  3I4R B;  3IKO B;  3IBE A;  2YHE A;  4U7E B;  3U4T A;  2BTD A;  3SQV A;  3HYM B;  3DSX A;  4N3B A;  4NIK A;  5FIN A;  3LY9 A;  4I6G A;  4CGV A;  3QNK A;  1EYH A;  4AXH A;  2QY7 A;  5D0Q D;  3DRA A;  1JPL A;  3ABL E;  4GTO A;  2ETC A;  2WXL A;  3CHM A;  5JMN D;  5T4Y A;  3HIZ A;  5KNH D;  3MEK A;  4LUN U;  4CGW A;  1ELR A;  2WM9 A;  3RU0 A;  2WXI A;  3RSE G;  1E8X A;  1FPP A;  1Y6I A;  1UN9 A;  3MKQ B;  4XKC A;  4KVM A;  3Q4A B;  3DEO A;  4N39 A;  3CEQ A;  3ZYM A;  4KZ0 A;  5LCW J;  3IHY A;  4A3V A;  3NOG D;  2BF0 X;  2BUG A;  4JHR A;  4FJY A;  2CHX A;  2P9P G;  3VTX A;  2PM7 A;  3PEV B;  4P29 A;  3I4G A;  4U0U A;  1IXV A;  1YMP A;  1U3C A;  2LO6 A;  3QWP A;  4EZJ A;  4JHK A;  5M72 A;  2HR2 A;  3G2W A;  4A55 A;  4FC8 A;  3APF A;  2QZA A;  2JLB A;  3VTY A;  2E2E A;  2F0Y A;  3KS2 A;  2P9N G;  3CVW A;  2OOE A;  4U0S A;  4FLB A;  2GRL A;  2J07 A;  4HOR A;  2KCL A;  4WNE A;  4L1B A;  3LY7 A;  1O1S A;  4F3V A;  3FU5 A;  5D66 A;  3TWX A;  3VLD A;  3C5R A;  4TV3 A;  1TJC A;  1KZP A;  3PH0 C;  2NC9 A;  4LER A;  5FIO A;  4N3C A;  3ASO E;  4GPM A;  3DSW A;  3GZS A;  3RRN B;  2AXZ A;  4CDM A;  2GGF A;  3DSS A;  5DBK A;  4XI0 A;  3BEE A;  2WXG A;  5CEA A;  3ESL A;  1TNZ A;  3S7J A;  2QFC A;  4IRU A;  1SA5 A;  5ENO D;  3EDT B;  4LNU D;  2EIN E;  3TG4 A;  3DST A;  5AQA A;  5HQ8 A;  4RQI A;  2OCC E;  4DX5 D;  5T3R A;  4FU3 A;  3GW4 A;  3FUL A;  3EUV A;  4Q94 A;  3UMV A;  3PVL A;  2KZT A;  2P9S G;  2YIN A;  3JXI A;  3QOU A;  1H2V C;  2DBA A;  5EX0 A;  4ATG A;  2C2L A;  1E8Z A;  2P9L G;  2R05 A;  5HRY A;  4GAA A;  4Y6C A;  2DWZ A;  4ANW A;  4K5C A;  3LVQ E;  4HBD A;  3SY2 A;  5KWD A;  2R59 A;  4GA1 A;  4XE0 A;  1H2U A;  5B3S E;  4J8F A;  2LNI A;  5H7P A;  3CVV A;  2IEJ A;  1MYO A;  5CCM A;  4WWO A;  3SF4 A;  4B0Z A;  4B94 A;  4BSZ B;  3MYV A;  5D2M C;  3FU3 A;  3DXM G;  3UT8 A;  1N0R A;  3KAE A;  3FUE A;  4AJW A;  1MX4 A;  3FFL A;  2ETB A;  1H6K A;  3OTN A;  5FJY A;  3JUI A;  1N54 A;  2H6H A;  4JW1 A;  5AQB A;  2X38 A;  4RG9 A;  4TXQ A;  2WMN A;  3Q49 B;  1SZ9 A;  4GTP A;  4DX6 D;  2KZT B;  4G25 A;  2OND A;  3HXC A;  4YDW A;  4LNB A;  1P5Q A;  4QFV A;  2V8S E;  4YDO A;  2V4L A;  5T8I A;  2A4Z A;  4U0Z A;  3ZYQ A;  2FF4 A;  3EHR A;  4K0R A;  3D9I A;  2L0T B;  5BV1 A;  2MHK A;  1MZC A;  3PZD A;  3URZ A;  4YVQ C;  5ARG A;  3ZVV A;  3ZN3 A;  3ASG A;  3ZXP A;  3FWV A;  2PNN A;  3CQG B;  3V30 A;  4JB8 P;  3MGB A;  3D9H A;  5KNG A;  1PAQ A;  1ZB1 A;  4V3I A;  3U64 A;  3UT4 A;  3PZ1 A;  2KAT A;  3OXG A;  4ILI A;  4UQX A;  3B7B A;  3L13 A;  3CSF A;  3CVL A;  3QJZ A;  2EQX A;  4JPS A;  3ZYL A;  5G04 C;  2IF4 A;  3KEZ A;  2CFU A;  3ZKJ A;  5KJM A;  5AAO A;  3FTW A;  2CHW A;  3T9K A;  4JVS A;  3ML9 A;  2V0P A;  1TNU A;  5BUZ A;  2IO3 C;  2I6H A;  4GZD A;  3ASH A;  5ARF A;  3V79 K;  2J49 A;  4NAC A;  3CHP A;  4LCT A;  2Y1L E;  4JA7 A;  4U63 A;  5EYL A;  3NAW A;  3S2A A;  2J8S D;  3UKU G;  2WB2 A;  1JCR A;  1E8W A;  3CHR A;  4DLQ A;  2LUH A;  2WXM A;  2F8Y A;  3LYA A;  4I6E A;  3O48 A;  3UIP C;  3D3M A;  3CST A;  3O4Z A;  3ONL A;  3D9M A;  3LVR E;  3MV2 B;  4FLH A;  1S70 B;  4MRU A;  2J08 A;  1EPU A;  4UWL A;  1WAO 1;  4DX2 A;  2EIM E;  3E37 A;  5EYP F;  5ANR A;  4L2Y A;  4GZ3 A;  1K3Z D;  3FH8 A;  3ZHE A;  4CYM D;  3T5X A;  4DRX E;  2XEE A;  1E8Y A;  3NBN B;  4C0M A;  3TWW A;  3KSL A;  3ULE G;  5AN8 A;  2X6J A;  2HM8 A;  3AG1 E;  4HQD A;  1L5J A;  5FQ4 A;  2P58 C;  4DPR A;  4U8V D;  1MX2 A;  4GML A;  4EZL A;  3QAR A;  3E30 A;  3UM3 A;  3PNT B;  4L9P A;  4GTV A;  3BU8 A;  1N95 A;  1Q2Z A;  4JA9 A;  5EIB E;  5D0O D;  3JCK C;  3ASD A;  4XI9 A;  4UUC A;  2ZU6 B;  1LF8 A;  3SD5 A;  5A7D B;  3LKU A;  5CCL A;  2OVB A;  1G3N B;  1YYH A;  3I3N A;  4PS3 A;  5FT9 A;  1OY3 D;  4BY6 A;  1NZN A;  1UN8 A;  1MJ0 A;  2FUL A;  3GZ1 A;  1KT0 A;  4K03 A;  3C3R A;  2VTB B;  4G23 A;  3AU5 A;  3JUE A;  5LCW C;  3FH7 A;  3DSU A;  4ME2 A;  3ZHE B;  4JEU A;  5FZR A;  3TWV A;  2J09 A;  5BW8 C;  2PM6 A;  2GRQ B;  2XRZ A;  3JQ0 A;  3RKV A;  1LTX A;  4EZK A;  2L6J A;  2OV8 A;  1MQS A;  4J0U A;  1N4P A;  2C0M A;  2WVI A;  2FEZ A;  4I43 A;  5EX3 A;  5JA4 D;  2J9Q A;  3SGH A;  3KSQ A;  2OEV A;  2IJG X;  1BU9 A;  4DK5 A;  2WMO A;  3EU9 A;  3FU6 A;  3Q7A A;  2UY1 B;  3CQC B;  1SA4 A;  4AIF A;  5ITZ F;  3IV0 A;  3ZRH A;  3DSV A;  1EDU A;  2ILR A;  3RIB A;  2EIJ E;  3L16 A;  5DIZ A;  3ZU7 B;  5J90 A;  4HRM B;  2QYU A;  1H6P A;  3HXD A;  3CVU A;  1IQR A;  3WXX A;  2XGM A;  4TUM A;  4W9R A;  3CLJ A;  1ZU2 A;  3LPZ A;  5KBA A;  3V31 A;  4GCO A;  1V54 E;  2VYI A;  3CVP A;  4I1O B;  2AXV A;  4HRN A;  5AEN A;  2R02 A;  3HRA A;  3CIA A;  1U3D A;  2XPI A;  3HXF A;  2M63 A;  3EJN A;  2VQ2 A;  2PQN A;  3BQO A;  3AU4 A;  4HNA D;  3BG1 B;  5G2N A;  2V5F A;  4BX8 A;  5CED B;  5LOZ A;  4ANX A;  4MBG A;  3P2B A;  3QK0 A;  4HOQ A;  3NQP A;  1OWO A;  4AP2 A;  3B13 A;  2GRM A;  5AYW D;  3UPV A;  3CVX A;  3LDZ A;  4CCA A;  1ZBP A;  4F6R D;  3TWR A;  3J5P A;  2GRN B;  3CHQ A;  4EBA A;  3NOC D;  4NUR A;  5EKQ D;  2AXU A;  3TXM A;  2X6I A;  1HG2 A;  4J8S A;  3EHM A;  2GRP B;  1BI8 B;  3SZ7 A;  4D10 C;  1Y8M A;  4AVX A;  5FZS A;  2A5E A;  1NI1 A;  4EBA G;  2MOW A;  3S7F A;  4XZ4 A;  2LXL A;  1SQM A;  4DX7 D;  2X6F A;  3FUN A;  4AOF A;  3MV3 B;  5A6C A;  3D9P A;  1TNO A;  2I2O A;  3DBS A;  4DI3 A;  3G2U A;  3T8M A;  2R5S A;  3TWU A;  4E85 A;  2H6F A;  4GZ6 A;  2L9B A;  3B7S A;  3Q73 A;  4APF A;  4ANV A;  3RK6 A;  4FUL A;  3SFX A;  4U8Y D;  1AP7 A;  4BES A;  1BLX B;  2XPZ A;  4JEH A;  4OVU A;  5G05 J;  1S64 A;  2WXP A;  1OT8 A;  3ML8 A;  3UIO C;  4GB9 A;  5JJT A;  3HVE A;  4G26 A;  3FP3 A;  4CDN A;  3E33 A;  4GYW A;  3T8K A;  1NA0 A;  3PS6 A;  3F6Q A;  4H7X A;  2BKG A;  4GA0 A;  2F37 A;  2ION A;  4I1A A;  4K5A B;  4UWF A;  3CVQ A;  5CRU A;  1A5E A;  4GA2 A;  3RRM B;  4O1O A;  2R2L A;  4NQ0 A;  1V55 E;  3APC A;  4UQZ A;  2DVW A;  4WNG A;  4APO A;  2X6K A;  1FVH A;  1TNY A;  1TR4 A;  4F1S A;  4KVO A;  4KBQ A; 
#chains in the Genus database with same CATH homology
 5HRY A;  2P2C P;  4BET A;  5ITZ F;  3V2O A;  4G8K A;  4J7W A;  2DWZ A;  4HQD A;  5KNG A;  1IKN D;  1SVX A;  3HG0 D;  4K5C A;  5CBN A;  5EID A;  2RFA A;  5CEC B;  1D9S A;  1UOH A;  4GMR A;  2BKK B;  2VGE A;  3LJN A;  4U8V D;  2B0O E;  5ENS D;  4HBD A;  2L6B A;  1MX2 A;  3B7B A;  4DX7 D;  5KWD A;  3ZU7 B;  2NYJ A;  2RFM A;  4DX1 A;  3SO8 A;  4HRM B;  4ATZ D;  2XEH A;  4A63 B;  3W9G A;  5HS0 A;  1DCQ A;  2F8X K;  1QYM A;  5EIB E;  4TUM A;  2DZN A;  1MX6 A;  4ZHB A;  4QQI A;  3TWU A;  3ZKJ A;  2FO1 E;  1WDY A;  4UUC A;  4BEP A;  4NIK A;  3JXJ A;  5FIN A;  5AAO A;  3ZNG A;  1MYO A;  5KBA A;  3V31 A;  4Z68 A;  3J5Q B;  5ENQ D;  3T9K A;  2Y0B G;  4OAV B;  2KBX A;  5D66 A;  3TWX A;  4B93 B;  5AQ9 A;  4CZ2 D;  1G3N B;  3Q9U C;  4HRN A;  1YYH A;  3C5R A;  4U8Y D;  4BSZ B;  3KEA A;  4J8Y A;  5AQ7 A;  1AP7 A;  3HRA A;  1BLX B;  1IHB A;  4BES A;  4HI8 A;  1OY3 D;  2HE0 A;  5FIO A;  4O1P A;  1N0R A;  4GPM A;  3TWS A;  3V79 K;  5HKP A;  2ETC A;  3EHQ A;  1MJ0 A;  1MX4 A;  1OT8 A;  4HNA D;  4OAU C;  2QC9 A;  1K1A A;  2XEN A;  2ZGG A;  5JMN D;  1AWC B;  5ENP D;  1K1B A;  2Y1L E;  4HRL A;  5EYL A;  5CED B;  5KNH D;  3UI2 A;  2J8S D;  2DZO A;  5EN5 D;  1N11 A;  5CEA A;  5AQB A;  1YCS B;  2ZGD A;  1SW6 A;  3T8K A;  5ENO D;  3JUE A;  4U95 D;  5BXU A;  4DX6 D;  3IXE A;  3F6Q A;  4LNU D;  2JAB A;  2F8Y A;  4RLY A;  3TWT A;  5CBO A;  5ENR D;  1WG0 A;  2BKG A;  2XZD G;  3B95 A;  3Q9N C;  5AQA A;  3TWV A;  3ZUV B;  4C48 B;  4YDW A;  5CER B;  3AJI A;  4LSZ E;  4HI9 A;  2F37 A;  4QFV A;  1S70 B;  4DX5 D;  2QYJ A;  2XZT G;  3UTM A;  4K5A B;  4F1P A;  4F6R D;  3DEO A;  3TWR A;  5AAR A;  3AAA C;  3J5P A;  4DX2 A;  4BER A;  4ZFH A;  1A5E A;  5ENT D;  2ETA A;  1DC2 A;  4O1O A;  3NOC D;  1BD8 A;  3NOG D;  3EHR A;  5EYP F;  4O60 A;  4N5Q A;  1K3Z D;  1N0Q A;  3JXI A;  3W9F A;  4CYM D;  4HLL A;  2DVW A;  3TWQ A;  2V4H C;  4K5B A;  2AJA A;  2XEE A;  4DRX E;  5JA4 D;  1BI8 B;  4G8L A;  4DUI A;  3NBN B;  1BI7 B;  2KXP C;  4LG6 A;  2MYO A;  4YDY A;  1BU9 A;  3TWW A;  3EU9 A;  4HB5 A;  1IXV A;  5BXO A;  1YMP A;  3DEP A;  3V2X A;  5AN8 A;  1TR4 A;  2PNN A;  4U96 D;  1NFI E;  2V5Q C;  5EIL A;  3V30 A;  2A5E A;  4JB8 P;  2ETB A;  3D9H A;  3UXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...