5ENSD

Rhodamine bound structure of bacterial efflux pump.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 48
structure length 156
sequence length 156
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5ensD00
2Y1LE 2F8YA 4J7WA 5AQ9A 3V31A 4LG6A 4BEPA 2ETBA 2DZNA 4U95D 1OT8A 1BU9A 2PNNA 4RLYA 4DX5D 5KNHD 5AARA 4GPMA 2F37A 3F6QA 4G8LA 3J5PA 3TWSA 3ZKJA 3DEOA 2QC9A 4TUMA 1N11A 3AAAC 4ZHBA 5ENSD 4B93B 5AN8A 3JXJA 2NYJA 2MYOA 3T9KA 3ZU7B 3SO8A 4DUIA 1N0QA 1IKND 4G8KA 2HE0A 1AP7A 2ETCA 3Q9NC 1OY3D 4U96D 2XZTG 2P2CP 2KXPC 3D9HA 4U8VD 5AQAA 1NFIE 5ENQD 5FIOA 3T8KA 4U8YD 2QYJA 4DX1A 4DX6D 4YDYA 3W9FA 3V2OA 5FINA 4GMRA 4Z68A 2XZDG 2BKKB 4QQIA 3JXIA 3NOGD 3B95A 2DZOA 1UOHA 3JUEA 4J8YA 4F1PA 3ZUVB 1IHBA 4LSZE 4F6RD 4OAVB 5D66A 4O60A 2KBXA 5EIDA 4QFVA 5HRYA 4HBDA 5ENRD 1QYMA 5BXOA 2RFMA 2VGEA 2ZGDA 3HG0D 1YMPA 5ENTD 2J8SD 3ZNGA 4BETA 5EYPF 1DCQA 5JMND 4A63B 5CBNA 2ZGGA 1BI7B 1BLXB 1DC2A 1SVXA 5ENPD 4OAUC 5AQ7A 3Q9UC 5HS0A 3KEAA 5KNGA 1MYOA 2XENA 4HQDA 1S70B 5CBOA 5CERB 1TR4A 3TWXA 4HRLA 2JABA 1AWCB 1BD8A 4K5BA 3DEPA 4K5AB 1D9SA 1YYHA 3TWUA 2Y0BG 5ENOD 4ATZD 1K3ZD 4HB5A 3B7BA 4N5QA 4HRMB 5KBAA 4HLLA 2B0OE 5HKPA 4JB8P 2RFAA 5CEDB 2XEEA 5JA4D 5EIBE 4O1PA 4DX7D 5ITZF 5CEAA 3TWRA 5EILA 2V4HC 2FO1E 1K1BA 3V2XA 4DX2A 2DWZA 1G3NB 3TWTA 5EYLA 2F8XK 3EHRA 3V30A 4ZFHA 1N0RA 5CECB 1MX2A 4O1OA 3TWVA 3EU9A 2ETAA 4K5CA 1IXVA 4UUCA 2AJAA 4HI8A 4C48B 2V5QC 1K1AA 3AJIA 3HRAA 1SW6A 2A5EA 2XEHA 4HNAD 4CYMD 1MX4A 4LNUD 3NBNB 3V79K 3NOCD 3IXEA 2DVWA 1MX6A 3TWQA 4HI9A 5AQBA 4CZ2D 3EHQA 5EN5D 4BERA 1BI8B 4NIKA 2L6BA 1WDYA 3J5QB 1YCSB 4DRXE 3W9GA 2BKGA 4BSZB 5AAOA 5KWDA 1MJ0A 3TWWA 3UXGA 1A5EA 3UI2A 1WG0A 3UTMA 4BESA 5BXUA 4HRNA 4YDWA 3C5RA 3LJNA
chains in the Genus database with same CATH superfamily
2XHEA 4WWNA 3UPVA 3MJWA 3CVQA 4EBAA 2LUHA 4DI4A 3FTSA 5LP0A 3R9AB 3IEGA 1OCZE 3FUNA 5T4YA 3D9HA 5ENQD 4IN3B 2I9CA 4N2QA 3UIOC 3DSTA 1NA3A 2IY0C 4AIFA 4A3TA 3FFLA 4J8EA 2R03A 4N3BA 4G23A 2WQ7A 5FQ7A 4XI9A 3R7RA 1NL4A 3CIAA 5JJ6A 3RRNB 5CCLA 2ZGGA 5KJLA 1S0PA 2XGMA 5HS0A 4HS2A 3UKRG 1V54E 3CKBA 5FWQA 2ZXWE 5KBAA 3E34A 5EIBE 4V3IA 3L16A 4O1PA 4JZYA 3UM2A 5EILA 2PM6A 3ZXSA 4DX2A 2WB2A 2F8XK 3WG7E 2F0YA 3R9MA 2A5EA 4A1GA 3QJZA 4F7AA 2YHCA 2WXQA 4NACA 4I6JA 3P2BA 3RJVA 2WXFA 1IYGA 2XGSA 3CR3A 4HRNA 3C5RA 2F8YA 4I1OB 4BEPA 3PZ2A 4RLYA 4YVQC 1E7VA 4K03A 4EQFA 1Q2ZA 3DSXA 3G2SA 3BG1B 2OVFA 4TXRA 2LAIA 3LVRE 2YHEA 3OAWA 5KJNA 2R59A 2CG2A 3ZYKA 4NQ0A 4U96D 2LXLA 2OOEA 2Y69E 3ZN3A 4QQIA 5FZRA 2L9BA 3QNKA 3O4ZA 2PZIA 1UW4B 4ANWA 2ZGDA 3DSVA 2Q7FA 4YVOA 3MKQA 4KVOA 3QWWA 5CERB 4HQDA 2IF4A 2VGXB 3LDZA 4URKA 2BEDA 2YQ8A 1E7UA 3GZSA 4B8AA 4JB8P 2RFAA 2XEEA 3D9JA 4UQZA 2DBAA 2V4HC 3LJ3A 2MRIA 4M3OA 1S63A 5EYLA 3FUDA 4RVBA 4CDMA 3FU5A 4O1OA 3ISMC 4FJYA 3ULQA 2V5FA 4DLOA 4CYMD 4HNAD 4U8HA 1OUVA 4IRUA 4LCTA 4N39A 2V0PA 3UT4A 2WMOA 1H6KA 1HH8A 3TAXA 2BUGA 5G2NA 4YDWA 1TJCA 2BF0X 4CT4A 3KEZA 2ETBA 3SFZA 2PM7A 5CMWA 2GRMA 2CFZA 3CQGB 5ENSD 3NAWA 3PZ3A 5EDSA 4G25A 2XPZA 1Y8MA 4EZLA 3Q9NC 2XZTG 4CCAA 4U8VD 4I2WA 3DXKG 1E8YA 2LNIA 3Q15A 4N2SA 2I6HA 3RK6A 4J8SA 5FTPA 4AJWA 4F6RD 1TNUA 4G26A 5EIDA 2H6FA 3LVQE 2VTBA 3RRUA 3FU3A 4YDEA 2FF4A 2IO2C 4GZDA 2ILRA 3DXMG 1N4QA 1Z6TA 3IV0A 5ARGA 4BT9A 3TWUA 2Y0BG 2WXMA 4L2LA 3B7BA 3CVYA 3CVVA 4WNGA 5JA4D 4CEMA 2KCLA 3IBEA 4ZFHA 4ILIA 2LXMA 4UUCA 2I1KA 3UIPC 2XEHA 3MYVA 2L0IA 4WAFA 3LY9A 3FDHA 4FC8A 3HVEA 1SA5A 3ML8A 2E0IA 1WDYA 3J5QB 4U0UA 4Y6WA 3SI5A 4GTQA 3PE4A 3FEXA 4HLEA 3RKVA 4UWKA 2J07A 3J5PA 4GZ6A 4XKBA 1NI1A 4EZKA 4I6GA 1JWGA 3ZU7B 4UWLA 1OY3D 4J8DA 5AQAA 2WXJA 5FINA 3RO3A 2P9SG 4I6EA 3JQ0A 2RFMA 1U3CA 3FH8A 2X6KA 5CBNA 2VGYA 1SVXA 2XCBA 1LD8A 2OV8A 4GCNA 1YYHA 2AXUA 3SBTB 4AEZC 3ZIMA 3APFA 2RD0A 3SNXA 3FUIA 2FO1E 1HS6A 1E8ZA 1HFAA 2VQ2A 2ETAA 5G05J 4JEUA 1SZ9A 3NOCD 3IXEA 1JCSA 1HG5A 1TYQG 4ANXA 4U07A 4Q96A 4U7EB 2J4DA 3MA5A 4GTTA 1TNYA 3L08A 4PDXA 1KT0A 4B0ZA 3FULA 1EPUA 3FUMA 4N3AA 2PQNA 4JC8A 1H6PA 1ELKA 4U04A 3U66A 3D9OA 3QK0A 3I4RB 1A17A 2GW1A 4J8FA 5KCMA 3SF4A 3CK9A 3ASOE 4XEIG 1NA0A 3O48A 4FLBA 4ACKA 3FUFA 4ILHB 3VLEA 4KXKB 4PS7A 5BT1A 5FIOA 4U8YD 4DX6D 5A6CA 1K8KG 2KCVA 3Q79A 3BUAA 3URZA 2DZOA 3CEQA 4F1PA 3C98A 2B6CA 4OAVB 5T8IA 1O5MA 4JD2G 3CHOA 5ENRD 3CK8A 3K9IA 3X2QE 2UY1B 5EYPF 5JMND 2VGXA 1BLXB 4I2ZA 3CHQA 4GA1A 2XENA 4HRLA 3DEPA 4DPRA 1D9SA 4D10C 2L6JA 2IEJA 1K3ZD 1Y6IA 4EPZA 4ANVA 2IO3C 4JEHA 4TRQA 3MV3B 1D8DA 4XI0A 4ACLA 3V30A 5KJMA 1MX2A 3L17A 3EHNA 4K5CA 2ZIRA 3V79K 4G24A 1LTXA 3CHMA 4JPSA 5AQBA 1HO8A 3KAEA 5EN5D 1BI8B 2CG3A 3OXLA 4AVXA 3HXDA 1A5EA 2WXKA 3CVXA 4H7XA 5ARFA 5CRVA 3GW4A 4GB9A 3QWPA 1D8EA 2WQHA 1OWMA 2F37A 1U2VG 1OCRE 5G05C 3ULEG 3UQ3A 4DJAA 3TGOA 2ZISA 3ASFA 3JQ1A 3JYSA 1NFIE 3HVEB 5T3RA 4IULA 2Y3AA 4ATGA 4OVUA 2KCKA 2H6GA 2XZDG 3CVWA 4NURA 1TJFA 3B7TA 3JUIA 1FPPA 3DSUA 1RZ4A 2IOSA 2GROB 5LX8A 2ONDA 1YMPA 5JHAA 3EIQC 4I1AA 2I2OA 5E76A 1XGWA 4J6IA 3TXMA 3L6AA 2P9KG 2IU1A 5B1AE 1V55E 3PREA 3PNLB 2HM8A 5CEAA 4N3CA 2IONA 1G3NB 4GAAA 2Y4UA 4ME2A 5ENNA 3ESKA 2X38A 2I1JA 1FVFA 4GTSA 4XX5A 4MLPA 3PRZA 2PQRA 5G55A 4L23A 3TWQA 2XCCA 1FCHA 3S7DA 3ENEA 4GZ3A 3QB2A 3L22A 2BKGA 3AS5A 1X5BA 4GU5A 3FH5A 3ABME 3UTMA 5CRUA 5FZQA 2AXVA 4LG6A 2X6IA 3GZ2A 1HU3A 4U95D 1OT8A 2PNNA 4DX5D 5KNHD 3LY8A 1TNBA 5IY5E 5KJKA 2OEVA 5JHBA 2MOWA 4GZCA 2V4LA 2EINE 3CVNA 4YDYA 3KD7A 4CDNA 4BFRA 4X8QA 4BT8A 4EBAG 3FY4A 1N54A 4LSZE 5EX0A 5HRYA 4RG6A 3GZ1A 3UM3A 2IJGX 2J8SD 1O1TA 3PEVB 3Q4AB 4AOFA 2X6HA 3EUVA 3T8MA 3N71A 3NB2A 3TWXA 3P1UA 1QQEA 3FUJA 1UN9A 3OTNA 2QFCA 4K0RA 3CGHA 4ATZD 1Z5SC 5EX3A 5HKPA 3FP3A 5CEDB 5BV0A 3CK7A 1WAO1 4MS6A 2AVPA 1K1BA 2WM9A 3D9NA 3FTYA 1N0RA 5M72A 3TWVA 4UI9K 3FEYA 1SW6A 4IYPA 1MQSA 4JHRA 3OXFA 4TV3A 1HF8A 4YDOA 3UXGA 3BG0B 1WG0A 3EU5A 4B93B 4EECA 2BTDA 2Y1LE 3HXBA 3V31A 3E32A 1RW2A 3DSSA 1XNFA 3UUXA 3FTUA 1JPLA 4GA0A 4F53A 2H6IA 3AU5A 3TWSA 4F3VA 3ONKA 4ZHBA 5AIJA 3D9LA 3JXJA 1PAQA 3ZW3A 2RKKA 4G8KA 3PS6A 3KSQA 2P2CP 2Y4TA 3T8KA 2QYJA 2JEKA 3W9FA 3RRMB 4GMRA 2CHZA 3BEEA 3JUEA 2UY1A 3ZGQA 3ZUVB 1JWFA 3IHYA 3VLDA 2XS8A 3E37A 4FLHA 4E6HA 3ZNGA 1BI7B 3SGHA 2LAHA 3DBSA 2X6JA 4A1SA 4UWGA 2R17C 3UKUG 4GTOA 4APOA 2CFUA 3NZUA 4PS3A 3LCAA 4GTRA 3CSFA 2J9QA 4XE0A 1FT1A 4GMJA 4G11A 3LYAA 4XZ4A 1N4SA 3QWVA 2WXOA 4LRZA 3ZPJA 4UI9J 1TNOA 2CHWA 1P5QA 1NP7A 2L6BA 2R05A 2XEVA 4BSZB 2GRRB 3TWWA 3NQPA 3NZSA 1E96B 2X6FA 1HG2A 4CGVA 2M63A 3Q75A 4W9RA 2DZNA 3VLFA 1N52A 3CHPA 4MRUA 5AARA 4KYOB 1PY1A 3HHMA 3LXUX 3DSWA 2EILE 4I17A 3Q73A 3D9IA 3IHVA 2WXNA 3Q7FA 4DX1A 2GRLA 4I9EA 3CVLA 3DRAA 4L1BA 3D9MA 1NZNA 1HX8A 3UINC 3MKRA 1OCOE 3PZ4A 1H6OA 2KBXA 4Q69A 2VSXE 3LY7A 2R5SA 2QY7A 4C9BB 3L54A 3SBSA 4GZ5A 2VYIA 3AG4E 5KNGA 3TXNA 1U3DA 3ASDA 4K5BA 3Q5MA 1EYHA 3FTZA 4U63A 1OCCE 4B94A 2L0TB 1Z3YA 5AJDA 2WPVA 3B13A 4BX9A 4A3VA 5CECB 3LKUA 4A55A 3KSLA 5AENA 3NBNB 4KT6B 5JJTA 5BV1A 4BERA 3D9KA 5EKQD 1KPSB 1OXJA 5BXUA 1QBQA 1DVPA 4FHKA 3ABKE 4B89A 3FUKA 3DWLG 3AAAC 3BQOA 5ANRA 4UI9C 3SY2A 4UWFA 3QARA 4UQXA 3CVPA 3JXIA 3B95A 1UOHA 1S64A 2WXPA 3ESLA 5D66A 3QAQA 3B7RL 4HBDA 1QYMA 4UQYA 1N94A 3ZEFA 5AJLA 3R7QA 2GGFA 4GYOA 3QC1A 3FTVA 2LSVA 4C0EA 2WXHA 3NF1A 3UX4A 3HDXA 2X3MA 5CCMA 2HR2A 4AM9A 3GYZA 1HE8A 4HB5A 4LUNU 3HXFA 4FHJA 2P9IG 2P9NG 3V2XA 5LOZA 3FH7A 1H2UA 4NRHB 2J08A 3EU9A 4L7TA 4G2VA 3FWVA 1JUQA 4OYSA 4C0MA 3C72A 4LEUA 1OWPA 3PNTB 3B7SA 5DIZA 1OWNA 1MX6A 3DPYA 3WXXA 5FQ4A 1E8XA 1SQMA 3E4BA 3MX3A 3T5VA 5FT9A 4KZ0A 1ELRA 2IQCA 4AY5A 3SQVA 2OCCE 1BU9A 1SZAA 4FU3A 2KZTB 5BW8C 2H6HA 3G2TA 2J49A 5D0OD 2NYJA 3Q49B 4UWHA 3T9KA 3SO8A 2WXRA 1IHGA 3UMVA 3ASHA 2J09A 1JCQA 3AU4A 3ZHEB 5J08A 5FZSA 3UT7A 1IQUA 5AYWD 3ML9A 4JL0A 5ENTD 4BETA 4XKCA 3ZYMA 3JCKC 3MCXA 5ENPD 3KEAA 2EQXA 5CBOA 1JCRA 1AWCB 4KZCA 4K5AB 4WNEA 4HRMB 2B0OE 3EDTB 1FVHA 5ITZF 5FQ8A 3SHFA 2IFUA 3EJNA 3ULYA 2JLBA 1QNFA 2AXZA 1MX4A 4LNBA 4KVMA 4HI9A 5H7PA 5CMYA 3Q47B 4GTMA 4MKTA 4NIKA 3CHRA 4GCOA 4DRXE 3DPDA 3PVLA 3HIZA 3TG5A 4BTBA 4PS8A 3UM1A 3S7JA 4J7WA 3ZFWA 5AQ9A 2C0MA 4HOQA 2WXIA 3DEOA 2LO6A 1N11A 4JW1A 2DCPA 5AN8A 3CLJA 4DUIA 3LS8A 2A4ZA 3APDA 2AWIA 4JHJA 1SA4A 5E75A 2EIME 3SFXA 2WQ6A 2XPIA 3I5PA 1N95A 4BTAA 5BUZA 1E8WA 4GA2A 2VSOE 3L9TA 3S2AA 2XS1A 4JXTA 4I9CA 3ASGA 1O1SA 5BPPA 5ANLA 2FEZA 4APFA 2KC7A 1TEZA 1ZBPA 4JHKA 5AQ7A 3Q9UC 2YINA 2DYRE 4CRWA 2OEWA 3C3RA 5ENOD 4R7LA 4EHMA 3OXGA 4N5QA 5LCWJ 2V8SE 3D9PA 4ABNA 3I3NA 1ZU2A 3CV0A 2MHKA 4L2YA 1Z3XA 1H2TC 3IKOB 4HI8A 4C48B 2WMNA 3SFYA 4N5CA 1UN8A 2DIWA 3LEWA 2P9LG 1VDYA 2HO1A 2AW6A 2P9UG 1TN7A 4BSXA 4H7YA 3E30A 4KBQA 3UT8A 3CQCB 4HXIA 2NSZA 2XGOA 3PE3A 4CT0A 3ABLE 2QC9A 4O6FA 4TUMA 5HI7A 1PC2A 2C2LA 2CHXA 3PUJA 3L82A 3U4TA 1KZPA 3FU6A 3SD5A 3RSEG 1MZCA 1INZA 4WUYA 3QDNA 3ASNE 2BKKB 4J8YA 2IOLA 4FADA 3MEKA 3ZYLA 4DK5A 3FU0A 2XPYA 4HOUA 1N4PA 1UJKA 3D3MA 3MV2B 1DC2A 5J90A 4OAUC 4DI3A 5B1BE 4JA9A 4P29A 3UM0A 4JVSA 4GYWA 3TWRA 2XQ0A 1H2VC 1IXVA 4RSYA 2DVWA 2OVBA 3APCA 3MZLB 5D2MC 4U0ZA 2R2LA 1GW6A 4GTVA 1MJ0A 3U3WA 1KLXA 2QYUA 3E33A 3UI2A 4WNFA 2KZTA 5LCWC 2FULA 4I1MA 3AS8A 3LPZA 1TNZA 3Q7AA 3AS4A 1UG3A 1ELWA 3ZRHA 3F6QA 3TJPA 3RAUA 4ANUA 1OWOA 3G2WA 4Y6CA 3ZHEA 1N0QA 5CHEE 2QZAA 2HE0A 4DLQA 2C0LA 3SZ7A 4HFGA 4RG9A 4U0SA 3V2OA 2XRZA 3G2VA 4Z68A 3I4GA 4TUUA 3NOGD 1IHBA 3ZXPA 4KMOA 4O60A 1X81A 4WWOA 4HORA 4BX8A 2WXGA 2VSNA 3T5XA 4B8CB 2VSYA 1QZ2A 4M7CA 1BD8A 1H19A 3TG4A 4CGWA 3PUKA 3VTXA 4GTPA 5A23A 3CSTA 3EHRA 5C2YA 3PDNA 2GRPB 1DCEA 1O1RA 4LNUD 4WWPA 3RO2A 4LERA 3FUEA 4BWRA 1TN6A 2HYZA 4CZ2D 3PZ1A 2FBNA 3CVUA 3W9GA 5AAOA 5KWDA 2FI7A 3AG3E 4XIFA 4QFVA 3PZDA 3C3OA 1L5JA 4GPMA 4HOSA 4G1TA 3ZKJA 3HXCA 1LF8A 1OWLA 3B7UX 3ONLA 3Q78A 3AG1E 4JA7A 1IKND 1AP7A 5JJ7A 1UJJA 4E85A 3AG2E 3BU8A 4LNGA 5G04J 2NC9A 2PL2A 1MHQA 3FUHA 2EIJE 1ZB1A 5BXOA 4CDRA 3HG0D 1DCQA 1EDUA 1KZOA 2NXPA 4F1SA 3PH0C 4PH4B 3QKYA 4TXQA 4MBGA 1MYOA 1B89A 1S70B 3MKQB 4TXPA 2JABA 1LD7A 1N9AA 2VJ8A 4RQIA 1W3BA 3G2UA 4FULA 2GRQB 2DWZA 2E2EA 5FQ6A 1K1AA 3AJIA 2EIKE 3HRAA 3VTYA 1HZ4A 3TL5A 3S7BA 4GYYA 3HYMB 1TN8A 3EHQA 4GMLA 5C1DA 2KATA 3FHEA 4BESA 4FJZA 4YNDA 1KT1A 3C3QA 3FTXA 1WY6A 3EIJA 4AV7A 1E90A 4AY6A 4AXHA 1IQRA 4FA6A 3PEUB 4G8LA 2YNQA 3EHMA 4FP7A 5A7DB 5HQ8A 2P58C 3S7FA 2MYOA 1DNPA 2GRNB 4OVVA 4HOTA 2ETCA 2P9PG 4WNDA 4PUCA 2KXPC 4I43A 4Q94A 3U64A 1EF1C 1WM5A 2WVIA 4ILGA 5D0QD 3U9WA 3CKCA 2WXLA 5B3SE 1N4RA 2VGEA 3FTWA 1HXIA 4A63B 2KM4A 2DYSE 2VTBB 4GPKA 1FT2A 1TR4A 3CHSA 2R02A 3KS2A 5FJYA 2XRYA 3MGBA 3HXEA 4HLLA 1H0AA 5G04C 4AP2A 2FO7A 3QOUA 3L13A 4DX7D 4EZJA 5DBKA 3ZYQA 3TWTA 3RU0A 2ZU6B 3RIBA 2AJAA 2J4BA 2V5QC 3ZVVA 4HVBA 2A5UA 4J0UA 4L9PA 1BPOA 5LFAA 2LSUA 1YCSB 2UWJG 1YA0A 4BY6A 5BNWA 2RG8A 3LJNA
chains in the Genus database with same CATH topology
2Y1LE 2F8YA 4J7WA 5AQ9A 3V31A 4LG6A 4BEPA 2ETBA 2DZNA 4U95D 1OT8A 1BU9A 2PNNA 4RLYA 4DX5D 5KNHD 5AARA 4GPMA 2F37A 3F6QA 4G8LA 3J5PA 3TWSA 3ZKJA 3DEOA 2QC9A 4TUMA 1N11A 3AAAC 4ZHBA 5ENSD 4B93B 5AN8A 3JXJA 2NYJA 2MYOA 3T9KA 3ZU7B 3SO8A 4DUIA 1N0QA 1IKND 4G8KA 2HE0A 1AP7A 2ETCA 3Q9NC 1OY3D 4U96D 2XZTG 2P2CP 2KXPC 3D9HA 4U8VD 5AQAA 1NFIE 5ENQD 5FIOA 3T8KA 4U8YD 2QYJA 4DX1A 4DX6D 4YDYA 3W9FA 3V2OA 5FINA 4GMRA 4Z68A 2XZDG 2BKKB 4QQIA 3JXIA 3NOGD 3B95A 2DZOA 1UOHA 3JUEA 4J8YA 4F1PA 3ZUVB 1IHBA 4LSZE 4F6RD 4OAVB 5D66A 4O60A 2KBXA 5EIDA 4QFVA 5HRYA 4HBDA 5ENRD 1QYMA 5BXOA 2RFMA 2VGEA 2ZGDA 3HG0D 1YMPA 5ENTD 2J8SD 3ZNGA 4BETA 5EYPF 1DCQA 5JMND 4A63B 5CBNA 2ZGGA 1BI7B 1BLXB 1DC2A 1SVXA 5ENPD 4OAUC 5AQ7A 3Q9UC 5HS0A 3KEAA 5KNGA 1MYOA 2XENA 4HQDA 1S70B 5CBOA 5CERB 1TR4A 3TWXA 4HRLA 2JABA 1AWCB 1BD8A 4K5BA 3DEPA 4K5AB 1D9SA 1YYHA 3TWUA 2Y0BG 5ENOD 4ATZD 1K3ZD 4HB5A 3B7BA 4N5QA 4HRMB 5KBAA 4HLLA 2B0OE 5HKPA 4JB8P 2RFAA 5CEDB 2XEEA 5JA4D 5EIBE 4O1PA 4DX7D 5ITZF 5CEAA 3TWRA 5EILA 2V4HC 2FO1E 1K1BA 3V2XA 4DX2A 2DWZA 1G3NB 3TWTA 5EYLA 2F8XK 3EHRA 3V30A 4ZFHA 1N0RA 5CECB 1MX2A 4O1OA 3TWVA 3EU9A 2ETAA 4K5CA 1IXVA 4UUCA 2AJAA 4HI8A 4C48B 2V5QC 1K1AA 3AJIA 3HRAA 1SW6A 2A5EA 2XEHA 4HNAD 4CYMD 1MX4A 4LNUD 3NBNB 3V79K 3NOCD 3IXEA 2DVWA 1MX6A 3TWQA 4HI9A 5AQBA 4CZ2D 3EHQA 5EN5D 4BERA 1BI8B 4NIKA 2L6BA 1WDYA 3J5QB 1YCSB 4DRXE 3W9GA 2BKGA 4BSZB 5AAOA 5KWDA 1MJ0A 3TWWA 3UXGA 1A5EA 3UI2A 1WG0A 3UTMA 4BESA 5BXUA 4HRNA 4YDWA 3C5RA 3LJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1L E;  2F8Y A;  4J7W A;  5AQ9 A;  3V31 A;  4LG6 A;  4BEP A;  2ETB A;  2DZN A;  4U95 D;  1OT8 A;  1BU9 A;  2PNN A;  4RLY A;  4DX5 D;  5KNH D;  5AAR A;  4GPM A;  2F37 A;  3F6Q A;  4G8L A;  3J5P A;  3TWS A;  3ZKJ A;  3DEO A;  2QC9 A;  4TUM A;  1N11 A;  3AAA C;  4ZHB A;  5ENS D;  4B93 B;  5AN8 A;  3JXJ A;  2NYJ A;  2MYO A;  3T9K A;  3ZU7 B;  3SO8 A;  4DUI A;  1N0Q A;  1IKN D;  4G8K A;  2HE0 A;  1AP7 A;  2ETC A;  3Q9N C;  1OY3 D;  4U96 D;  2XZT G;  2P2C P;  2KXP C;  3D9H A;  4U8V D;  5AQA A;  1NFI E;  5ENQ D;  5FIO A;  3T8K A;  4U8Y D;  2QYJ A;  4DX1 A;  4DX6 D;  4YDY A;  3W9F A;  3V2O A;  5FIN A;  4GMR A;  4Z68 A;  2XZD G;  2BKK B;  4QQI A;  3JXI A;  3NOG D;  3B95 A;  2DZO A;  1UOH A;  3JUE A;  4J8Y A;  4F1P A;  3ZUV B;  1IHB A;  4LSZ E;  4F6R D;  4OAV B;  5D66 A;  4O60 A;  2KBX A;  5EID A;  4QFV A;  5HRY A;  4HBD A;  5ENR D;  1QYM A;  5BXO A;  2RFM A;  2VGE A;  2ZGD A;  3HG0 D;  1YMP A;  5ENT D;  2J8S D;  3ZNG A;  4BET A;  5EYP F;  1DCQ A;  5JMN D;  4A63 B;  5CBN A;  2ZGG A;  1BI7 B;  1BLX B;  1DC2 A;  1SVX A;  5ENP D;  4OAU C;  5AQ7 A;  3Q9U C;  5HS0 A;  3KEA A;  5KNG A;  1MYO A;  2XEN A;  4HQD A;  1S70 B;  5CBO A;  5CER B;  1TR4 A;  3TWX A;  4HRL A;  2JAB A;  1AWC B;  1BD8 A;  4K5B A;  3DEP A;  4K5A B;  1D9S A;  1YYH A;  3TWU A;  2Y0B G;  5ENO D;  4ATZ D;  1K3Z D;  4HB5 A;  3B7B A;  4N5Q A;  4HRM B;  5KBA A;  4HLL A;  2B0O E;  5HKP A;  4JB8 P;  2RFA A;  5CED B;  2XEE A;  5JA4 D;  5EIB E;  4O1P A;  4DX7 D;  5ITZ F;  5CEA A;  3TWR A;  5EIL A;  2V4H C;  2FO1 E;  1K1B A;  3V2X A;  4DX2 A;  2DWZ A;  1G3N B;  3TWT A;  5EYL A;  2F8X K;  3EHR A;  3V30 A;  4ZFH A;  1N0R A;  5CEC B;  1MX2 A;  4O1O A;  3TWV A;  3EU9 A;  2ETA A;  4K5C A;  1IXV A;  4UUC A;  2AJA A;  4HI8 A;  4C48 B;  2V5Q C;  1K1A A;  3AJI A;  3HRA A;  1SW6 A;  2A5E A;  2XEH A;  4HNA D;  4CYM D;  1MX4 A;  4LNU D;  3NBN B;  3V79 K;  3NOC D;  3IXE A;  2DVW A;  1MX6 A;  3TWQ A;  4HI9 A;  5AQB A;  4CZ2 D;  3EHQ A;  5EN5 D;  4BER A;  1BI8 B;  4NIK A;  2L6B A;  1WDY A;  3J5Q B;  1YCS B;  4DRX E;  3W9G A;  2BKG A;  4BSZ B;  5AAO A;  5KWD A;  1MJ0 A;  3TWW A;  3UXG A;  1A5E A;  3UI2 A;  1WG0 A;  3UTM A;  4BES A;  5BXU A;  4HRN A;  4YDW A;  3C5R A;  3LJN A; 
#chains in the Genus database with same CATH topology
 2XHE A;  4WWN A;  3UPV A;  3MJW A;  3CVQ A;  4EBA A;  2LUH A;  4DI4 A;  3FTS A;  5LP0 A;  3R9A B;  3IEG A;  1OCZ E;  3FUN A;  5T4Y A;  3D9H A;  5ENQ D;  4IN3 B;  2I9C A;  4N2Q A;  3UIO C;  3DST A;  1NA3 A;  2IY0 C;  4AIF A;  4A3T A;  3FFL A;  4J8E A;  2R03 A;  4N3B A;  4G23 A;  2WQ7 A;  5FQ7 A;  4XI9 A;  3R7R A;  1NL4 A;  3CIA A;  5JJ6 A;  3RRN B;  5CCL A;  2ZGG A;  5KJL A;  1S0P A;  2XGM A;  5HS0 A;  4HS2 A;  3UKR G;  1V54 E;  3CKB A;  5FWQ A;  2ZXW E;  5KBA A;  3E34 A;  5EIB E;  4V3I A;  3L16 A;  4O1P A;  4JZY A;  3UM2 A;  5EIL A;  2PM6 A;  3ZXS A;  4DX2 A;  2WB2 A;  2F8X K;  3WG7 E;  2F0Y A;  3R9M A;  2A5E A;  4A1G A;  3QJZ A;  4F7A A;  2YHC A;  2WXQ A;  4NAC A;  4I6J A;  3P2B A;  3RJV A;  2WXF A;  1IYG A;  2XGS A;  3CR3 A;  4HRN A;  3C5R A;  2F8Y A;  4I1O B;  4BEP A;  3PZ2 A;  4RLY A;  4YVQ C;  1E7V A;  4K03 A;  4EQF A;  1Q2Z A;  3DSX A;  3G2S A;  3BG1 B;  2OVF A;  4TXR A;  2LAI A;  3LVR E;  2YHE A;  3OAW A;  5KJN A;  2R59 A;  2CG2 A;  3ZYK A;  4NQ0 A;  4U96 D;  2LXL A;  2OOE A;  2Y69 E;  3ZN3 A;  4QQI A;  5FZR A;  2L9B A;  3QNK A;  3O4Z A;  2PZI A;  1UW4 B;  4ANW A;  2ZGD A;  3DSV A;  2Q7F A;  4YVO A;  3MKQ A;  4KVO A;  3QWW A;  5CER B;  4HQD A;  2IF4 A;  2VGX B;  3LDZ A;  4URK A;  2BED A;  2YQ8 A;  1E7U A;  3GZS A;  4B8A A;  4JB8 P;  2RFA A;  2XEE A;  3D9J A;  4UQZ A;  2DBA A;  2V4H C;  3LJ3 A;  2MRI A;  4M3O A;  1S63 A;  5EYL A;  3FUD A;  4RVB A;  4CDM A;  3FU5 A;  4O1O A;  3ISM C;  4FJY A;  3ULQ A;  2V5F A;  4DLO A;  4CYM D;  4HNA D;  4U8H A;  1OUV A;  4IRU A;  4LCT A;  4N39 A;  2V0P A;  3UT4 A;  2WMO A;  1H6K A;  1HH8 A;  3TAX A;  2BUG A;  5G2N A;  4YDW A;  1TJC A;  2BF0 X;  4CT4 A;  3KEZ A;  2ETB A;  3SFZ A;  2PM7 A;  5CMW A;  2GRM A;  2CFZ A;  3CQG B;  5ENS D;  3NAW A;  3PZ3 A;  5EDS A;  4G25 A;  2XPZ A;  1Y8M A;  4EZL A;  3Q9N C;  2XZT G;  4CCA A;  4U8V D;  4I2W A;  3DXK G;  1E8Y A;  2LNI A;  3Q15 A;  4N2S A;  2I6H A;  3RK6 A;  4J8S A;  5FTP A;  4AJW A;  4F6R D;  1TNU A;  4G26 A;  5EID A;  2H6F A;  3LVQ E;  2VTB A;  3RRU A;  3FU3 A;  4YDE A;  2FF4 A;  2IO2 C;  4GZD A;  2ILR A;  3DXM G;  1N4Q A;  1Z6T A;  3IV0 A;  5ARG A;  4BT9 A;  3TWU A;  2Y0B G;  2WXM A;  4L2L A;  3B7B A;  3CVY A;  3CVV A;  4WNG A;  5JA4 D;  4CEM A;  2KCL A;  3IBE A;  4ZFH A;  4ILI A;  2LXM A;  4UUC A;  2I1K A;  3UIP C;  2XEH A;  3MYV A;  2L0I A;  4WAF A;  3LY9 A;  3FDH A;  4FC8 A;  3HVE A;  1SA5 A;  3ML8 A;  2E0I A;  1WDY A;  3J5Q B;  4U0U A;  4Y6W A;  3SI5 A;  4GTQ A;  3PE4 A;  3FEX A;  4HLE A;  3RKV A;  4UWK A;  2J07 A;  3J5P A;  4GZ6 A;  4XKB A;  1NI1 A;  4EZK A;  4I6G A;  1JWG A;  3ZU7 B;  4UWL A;  1OY3 D;  4J8D A;  5AQA A;  2WXJ A;  5FIN A;  3RO3 A;  2P9S G;  4I6E A;  3JQ0 A;  2RFM A;  1U3C A;  3FH8 A;  2X6K A;  5CBN A;  2VGY A;  1SVX A;  2XCB A;  1LD8 A;  2OV8 A;  4GCN A;  1YYH A;  2AXU A;  3SBT B;  4AEZ C;  3ZIM A;  3APF A;  2RD0 A;  3SNX A;  3FUI A;  2FO1 E;  1HS6 A;  1E8Z A;  1HFA A;  2VQ2 A;  2ETA A;  5G05 J;  4JEU A;  1SZ9 A;  3NOC D;  3IXE A;  1JCS A;  1HG5 A;  1TYQ G;  4ANX A;  4U07 A;  4Q96 A;  4U7E B;  2J4D A;  3MA5 A;  4GTT A;  1TNY A;  3L08 A;  4PDX A;  1KT0 A;  4B0Z A;  3FUL A;  1EPU A;  3FUM A;  4N3A A;  2PQN A;  4JC8 A;  1H6P A;  1ELK A;  4U04 A;  3U66 A;  3D9O A;  3QK0 A;  3I4R B;  1A17 A;  2GW1 A;  4J8F A;  5KCM A;  3SF4 A;  3CK9 A;  3ASO E;  4XEI G;  1NA0 A;  3O48 A;  4FLB A;  4ACK A;  3FUF A;  4ILH B;  3VLE A;  4KXK B;  4PS7 A;  5BT1 A;  5FIO A;  4U8Y D;  4DX6 D;  5A6C A;  1K8K G;  2KCV A;  3Q79 A;  3BUA A;  3URZ A;  2DZO A;  3CEQ A;  4F1P A;  3C98 A;  2B6C A;  4OAV B;  5T8I A;  1O5M A;  4JD2 G;  3CHO A;  5ENR D;  3CK8 A;  3K9I A;  3X2Q E;  2UY1 B;  5EYP F;  5JMN D;  2VGX A;  1BLX B;  4I2Z A;  3CHQ A;  4GA1 A;  2XEN A;  4HRL A;  3DEP A;  4DPR A;  1D9S A;  4D10 C;  2L6J A;  2IEJ A;  1K3Z D;  1Y6I A;  4EPZ A;  4ANV A;  2IO3 C;  4JEH A;  4TRQ A;  3MV3 B;  1D8D A;  4XI0 A;  4ACL A;  3V30 A;  5KJM A;  1MX2 A;  3L17 A;  3EHN A;  4K5C A;  2ZIR A;  3V79 K;  4G24 A;  1LTX A;  3CHM A;  4JPS A;  5AQB A;  1HO8 A;  3KAE A;  5EN5 D;  1BI8 B;  2CG3 A;  3OXL A;  4AVX A;  3HXD A;  1A5E A;  2WXK A;  3CVX A;  4H7X A;  5ARF A;  5CRV A;  3GW4 A;  4GB9 A;  3QWP A;  1D8E A;  2WQH A;  1OWM A;  2F37 A;  1U2V G;  1OCR E;  5G05 C;  3ULE G;  3UQ3 A;  4DJA A;  3TGO A;  2ZIS A;  3ASF A;  3JQ1 A;  3JYS A;  1NFI E;  3HVE B;  5T3R A;  4IUL A;  2Y3A A;  4ATG A;  4OVU A;  2KCK A;  2H6G A;  2XZD G;  3CVW A;  4NUR A;  1TJF A;  3B7T A;  3JUI A;  1FPP A;  3DSU A;  1RZ4 A;  2IOS A;  2GRO B;  5LX8 A;  2OND A;  1YMP A;  5JHA A;  3EIQ C;  4I1A A;  2I2O A;  5E76 A;  1XGW A;  4J6I A;  3TXM A;  3L6A A;  2P9K G;  2IU1 A;  5B1A E;  1V55 E;  3PRE A;  3PNL B;  2HM8 A;  5CEA A;  4N3C A;  2ION A;  1G3N B;  4GAA A;  2Y4U A;  4ME2 A;  5ENN A;  3ESK A;  2X38 A;  2I1J A;  1FVF A;  4GTS A;  4XX5 A;  4MLP A;  3PRZ A;  2PQR A;  5G55 A;  4L23 A;  3TWQ A;  2XCC A;  1FCH A;  3S7D A;  3ENE A;  4GZ3 A;  3QB2 A;  3L22 A;  2BKG A;  3AS5 A;  1X5B A;  4GU5 A;  3FH5 A;  3ABM E;  3UTM A;  5CRU A;  5FZQ A;  2AXV A;  4LG6 A;  2X6I A;  3GZ2 A;  1HU3 A;  4U95 D;  1OT8 A;  2PNN A;  4DX5 D;  5KNH D;  3LY8 A;  1TNB A;  5IY5 E;  5KJK A;  2OEV A;  5JHB A;  2MOW A;  4GZC A;  2V4L A;  2EIN E;  3CVN A;  4YDY A;  3KD7 A;  4CDN A;  4BFR A;  4X8Q A;  4BT8 A;  4EBA G;  3FY4 A;  1N54 A;  4LSZ E;  5EX0 A;  5HRY A;  4RG6 A;  3GZ1 A;  3UM3 A;  2IJG X;  2J8S D;  1O1T A;  3PEV B;  3Q4A B;  4AOF A;  2X6H A;  3EUV A;  3T8M A;  3N71 A;  3NB2 A;  3TWX A;  3P1U A;  1QQE A;  3FUJ A;  1UN9 A;  3OTN A;  2QFC A;  4K0R A;  3CGH A;  4ATZ D;  1Z5S C;  5EX3 A;  5HKP A;  3FP3 A;  5CED B;  5BV0 A;  3CK7 A;  1WAO 1;  4MS6 A;  2AVP A;  1K1B A;  2WM9 A;  3D9N A;  3FTY A;  1N0R A;  5M72 A;  3TWV A;  4UI9 K;  3FEY A;  1SW6 A;  4IYP A;  1MQS A;  4JHR A;  3OXF A;  4TV3 A;  1HF8 A;  4YDO A;  3UXG A;  3BG0 B;  1WG0 A;  3EU5 A;  4B93 B;  4EEC A;  2BTD A;  2Y1L E;  3HXB A;  3V31 A;  3E32 A;  1RW2 A;  3DSS A;  1XNF A;  3UUX A;  3FTU A;  1JPL A;  4GA0 A;  4F53 A;  2H6I A;  3AU5 A;  3TWS A;  4F3V A;  3ONK A;  4ZHB A;  5AIJ A;  3D9L A;  3JXJ A;  1PAQ A;  3ZW3 A;  2RKK A;  4G8K A;  3PS6 A;  3KSQ A;  2P2C P;  2Y4T A;  3T8K A;  2QYJ A;  2JEK A;  3W9F A;  3RRM B;  4GMR A;  2CHZ A;  3BEE A;  3JUE A;  2UY1 A;  3ZGQ A;  3ZUV B;  1JWF A;  3IHY A;  3VLD A;  2XS8 A;  3E37 A;  4FLH A;  4E6H A;  3ZNG A;  1BI7 B;  3SGH A;  2LAH A;  3DBS A;  2X6J A;  4A1S A;  4UWG A;  2R17 C;  3UKU G;  4GTO A;  4APO A;  2CFU A;  3NZU A;  4PS3 A;  3LCA A;  4GTR A;  3CSF A;  2J9Q A;  4XE0 A;  1FT1 A;  4GMJ A;  4G11 A;  3LYA A;  4XZ4 A;  1N4S A;  3QWV A;  2WXO A;  4LRZ A;  3ZPJ A;  4UI9 J;  1TNO A;  2CHW A;  1P5Q A;  1NP7 A;  2L6B A;  2R05 A;  2XEV A;  4BSZ B;  2GRR B;  3TWW A;  3NQP A;  3NZS A;  1E96 B;  2X6F A;  1HG2 A;  4CGV A;  2M63 A;  3Q75 A;  4W9R A;  2DZN A;  3VLF A;  1N52 A;  3CHP A;  4MRU A;  5AAR A;  4KYO B;  1PY1 A;  3HHM A;  3LXU X;  3DSW A;  2EIL E;  4I17 A;  3Q73 A;  3D9I A;  3IHV A;  2WXN A;  3Q7F A;  4DX1 A;  2GRL A;  4I9E A;  3CVL A;  3DRA A;  4L1B A;  3D9M A;  1NZN A;  1HX8 A;  3UIN C;  3MKR A;  1OCO E;  3PZ4 A;  1H6O A;  2KBX A;  4Q69 A;  2VSX E;  3LY7 A;  2R5S A;  2QY7 A;  4C9B B;  3L54 A;  3SBS A;  4GZ5 A;  2VYI A;  3AG4 E;  5KNG A;  3TXN A;  1U3D A;  3ASD A;  4K5B A;  3Q5M A;  1EYH A;  3FTZ A;  4U63 A;  1OCC E;  4B94 A;  2L0T B;  1Z3Y A;  5AJD A;  2WPV A;  3B13 A;  4BX9 A;  4A3V A;  5CEC B;  3LKU A;  4A55 A;  3KSL A;  5AEN A;  3NBN B;  4KT6 B;  5JJT A;  5BV1 A;  4BER A;  3D9K A;  5EKQ D;  1KPS B;  1OXJ A;  5BXU A;  1QBQ A;  1DVP A;  4FHK A;  3ABK E;  4B89 A;  3FUK A;  3DWL G;  3AAA C;  3BQO A;  5ANR A;  4UI9 C;  3SY2 A;  4UWF A;  3QAR A;  4UQX A;  3CVP A;  3JXI A;  3B95 A;  1UOH A;  1S64 A;  2WXP A;  3ESL A;  5D66 A;  3QAQ A;  3B7R L;  4HBD A;  1QYM A;  4UQY A;  1N94 A;  3ZEF A;  5AJL A;  3R7Q A;  2GGF A;  4GYO A;  3QC1 A;  3FTV A;  2LSV A;  4C0E A;  2WXH A;  3NF1 A;  3UX4 A;  3HDX A;  2X3M A;  5CCM A;  2HR2 A;  4AM9 A;  3GYZ A;  1HE8 A;  4HB5 A;  4LUN U;  3HXF A;  4FHJ A;  2P9I G;  2P9N G;  3V2X A;  5LOZ A;  3FH7 A;  1H2U A;  4NRH B;  2J08 A;  3EU9 A;  4L7T A;  4G2V A;  3FWV A;  1JUQ A;  4OYS A;  4C0M A;  3C72 A;  4LEU A;  1OWP A;  3PNT B;  3B7S A;  5DIZ A;  1OWN A;  1MX6 A;  3DPY A;  3WXX A;  5FQ4 A;  1E8X A;  1SQM A;  3E4B A;  3MX3 A;  3T5V A;  5FT9 A;  4KZ0 A;  1ELR A;  2IQC A;  4AY5 A;  3SQV A;  2OCC E;  1BU9 A;  1SZA A;  4FU3 A;  2KZT B;  5BW8 C;  2H6H A;  3G2T A;  2J49 A;  5D0O D;  2NYJ A;  3Q49 B;  4UWH A;  3T9K A;  3SO8 A;  2WXR A;  1IHG A;  3UMV A;  3ASH A;  2J09 A;  1JCQ A;  3AU4 A;  3ZHE B;  5J08 A;  5FZS A;  3UT7 A;  1IQU A;  5AYW D;  3ML9 A;  4JL0 A;  5ENT D;  4BET A;  4XKC A;  3ZYM A;  3JCK C;  3MCX A;  5ENP D;  3KEA A;  2EQX A;  5CBO A;  1JCR A;  1AWC B;  4KZC A;  4K5A B;  4WNE A;  4HRM B;  2B0O E;  3EDT B;  1FVH A;  5ITZ F;  5FQ8 A;  3SHF A;  2IFU A;  3EJN A;  3ULY A;  2JLB A;  1QNF A;  2AXZ A;  1MX4 A;  4LNB A;  4KVM A;  4HI9 A;  5H7P A;  5CMY A;  3Q47 B;  4GTM A;  4MKT A;  4NIK A;  3CHR A;  4GCO A;  4DRX E;  3DPD A;  3PVL A;  3HIZ A;  3TG5 A;  4BTB A;  4PS8 A;  3UM1 A;  3S7J A;  4J7W A;  3ZFW A;  5AQ9 A;  2C0M A;  4HOQ A;  2WXI A;  3DEO A;  2LO6 A;  1N11 A;  4JW1 A;  2DCP A;  5AN8 A;  3CLJ A;  4DUI A;  3LS8 A;  2A4Z A;  3APD A;  2AWI A;  4JHJ A;  1SA4 A;  5E75 A;  2EIM E;  3SFX A;  2WQ6 A;  2XPI A;  3I5P A;  1N95 A;  4BTA A;  5BUZ A;  1E8W A;  4GA2 A;  2VSO E;  3L9T A;  3S2A A;  2XS1 A;  4JXT A;  4I9C A;  3ASG A;  1O1S A;  5BPP A;  5ANL A;  2FEZ A;  4APF A;  2KC7 A;  1TEZ A;  1ZBP A;  4JHK A;  5AQ7 A;  3Q9U C;  2YIN A;  2DYR E;  4CRW A;  2OEW A;  3C3R A;  5ENO D;  4R7L A;  4EHM A;  3OXG A;  4N5Q A;  5LCW J;  2V8S E;  3D9P A;  4ABN A;  3I3N A;  1ZU2 A;  3CV0 A;  2MHK A;  4L2Y A;  1Z3X A;  1H2T C;  3IKO B;  4HI8 A;  4C48 B;  2WMN A;  3SFY A;  4N5C A;  1UN8 A;  2DIW A;  3LEW A;  2P9L G;  1VDY A;  2HO1 A;  2AW6 A;  2P9U G;  1TN7 A;  4BSX A;  4H7Y A;  3E30 A;  4KBQ A;  3UT8 A;  3CQC B;  4HXI A;  2NSZ A;  2XGO A;  3PE3 A;  4CT0 A;  3ABL E;  2QC9 A;  4O6F A;  4TUM A;  5HI7 A;  1PC2 A;  2C2L A;  2CHX A;  3PUJ A;  3L82 A;  3U4T A;  1KZP A;  3FU6 A;  3SD5 A;  3RSE G;  1MZC A;  1INZ A;  4WUY A;  3QDN A;  3ASN E;  2BKK B;  4J8Y A;  2IOL A;  4FAD A;  3MEK A;  3ZYL A;  4DK5 A;  3FU0 A;  2XPY A;  4HOU A;  1N4P A;  1UJK A;  3D3M A;  3MV2 B;  1DC2 A;  5J90 A;  4OAU C;  4DI3 A;  5B1B E;  4JA9 A;  4P29 A;  3UM0 A;  4JVS A;  4GYW A;  3TWR A;  2XQ0 A;  1H2V C;  1IXV A;  4RSY A;  2DVW A;  2OVB A;  3APC A;  3MZL B;  5D2M C;  4U0Z A;  2R2L A;  1GW6 A;  4GTV A;  1MJ0 A;  3U3W A;  1KLX A;  2QYU A;  3E33 A;  3UI2 A;  4WNF A;  2KZT A;  5LCW C;  2FUL A;  4I1M A;  3AS8 A;  3LPZ A;  1TNZ A;  3Q7A A;  3AS4 A;  1UG3 A;  1ELW A;  3ZRH A;  3F6Q A;  3TJP A;  3RAU A;  4ANU A;  1OWO A;  3G2W A;  4Y6C A;  3ZHE A;  1N0Q A;  5CHE E;  2QZA A;  2HE0 A;  4DLQ A;  2C0L A;  3SZ7 A;  4HFG A;  4RG9 A;  4U0S A;  3V2O A;  2XRZ A;  3G2V A;  4Z68 A;  3I4G A;  4TUU A;  3NOG D;  1IHB A;  3ZXP A;  4KMO A;  4O60 A;  1X81 A;  4WWO A;  4HOR A;  4BX8 A;  2WXG A;  2VSN A;  3T5X A;  4B8C B;  2VSY A;  1QZ2 A;  4M7C A;  1BD8 A;  1H19 A;  3TG4 A;  4CGW A;  3PUK A;  3VTX A;  4GTP A;  5A23 A;  3CST A;  3EHR A;  5C2Y A;  3PDN A;  2GRP B;  1DCE A;  1O1R A;  4LNU D;  4WWP A;  3RO2 A;  4LER A;  3FUE A;  4BWR A;  1TN6 A;  2HYZ A;  4CZ2 D;  3PZ1 A;  2FBN A;  3CVU A;  3W9G A;  5AAO A;  5KWD A;  2FI7 A;  3AG3 E;  4XIF A;  4QFV A;  3PZD A;  3C3O A;  1L5J A;  4GPM A;  4HOS A;  4G1T A;  3ZKJ A;  3HXC A;  1LF8 A;  1OWL A;  3B7U X;  3ONL A;  3Q78 A;  3AG1 E;  4JA7 A;  1IKN D;  1AP7 A;  5JJ7 A;  1UJJ A;  4E85 A;  3AG2 E;  3BU8 A;  4LNG A;  5G04 J;  2NC9 A;  2PL2 A;  1MHQ A;  3FUH A;  2EIJ E;  1ZB1 A;  5BXO A;  4CDR A;  3HG0 D;  1DCQ A;  1EDU A;  1KZO A;  2NXP A;  4F1S A;  3PH0 C;  4PH4 B;  3QKY A;  4TXQ A;  4MBG A;  1MYO A;  1B89 A;  1S70 B;  3MKQ B;  4TXP A;  2JAB A;  1LD7 A;  1N9A A;  2VJ8 A;  4RQI A;  1W3B A;  3G2U A;  4FUL A;  2GRQ B;  2DWZ A;  2E2E A;  5FQ6 A;  1K1A A;  3AJI A;  2EIK E;  3HRA A;  3VTY A;  1HZ4 A;  3TL5 A;  3S7B A;  4GYY A;  3HYM B;  1TN8 A;  3EHQ A;  4GML A;  5C1D A;  2KAT A;  3FHE A;  4BES A;  4FJZ A;  4YND A;  1KT1 A;  3C3Q A;  3FTX A;  1WY6 A;  3EIJ A;  4AV7 A;  1E90 A;  4AY6 A;  4AXH A;  1IQR A;  4FA6 A;  3PEU B;  4G8L A;  2YNQ A;  3EHM A;  4FP7 A;  5A7D B;  5HQ8 A;  2P58 C;  3S7F A;  2MYO A;  1DNP A;  2GRN B;  4OVV A;  4HOT A;  2ETC A;  2P9P G;  4WND A;  4PUC A;  2KXP C;  4I43 A;  4Q94 A;  3U64 A;  1EF1 C;  1WM5 A;  2WVI A;  4ILG A;  5D0Q D;  3U9W A;  3CKC A;  2WXL A;  5B3S E;  1N4R A;  2VGE A;  3FTW A;  1HXI A;  4A63 B;  2KM4 A;  2DYS E;  2VTB B;  4GPK A;  1FT2 A;  1TR4 A;  3CHS A;  2R02 A;  3KS2 A;  5FJY A;  2XRY A;  3MGB A;  3HXE A;  4HLL A;  1H0A A;  5G04 C;  4AP2 A;  2FO7 A;  3QOU A;  3L13 A;  4DX7 D;  4EZJ A;  5DBK A;  3ZYQ A;  3TWT A;  3RU0 A;  2ZU6 B;  3RIB A;  2AJA A;  2J4B A;  2V5Q C;  3ZVV A;  4HVB A;  2A5U A;  4J0U A;  4L9P A;  1BPO A;  5LFA A;  2LSU A;  1YCS B;  2UWJ G;  1YA0 A;  4BY6 A;  5BNW A;  2RG8 A;  3LJN A; 
#chains in the Genus database with same CATH homology
 2Y1L E;  2F8Y A;  4J7W A;  5AQ9 A;  3V31 A;  4LG6 A;  4BEP A;  2ETB A;  2DZN A;  4U95 D;  1OT8 A;  1BU9 A;  2PNN A;  4RLY A;  4DX5 D;  5KNH D;  5AAR A;  4GPM A;  2F37 A;  3F6Q A;  4G8L A;  3J5P A;  3TWS A;  3ZKJ A;  3DEO A;  2QC9 A;  4TUM A;  1N11 A;  3AAA C;  4ZHB A;  5ENS D;  4B93 B;  5AN8 A;  3JXJ A;  2NYJ A;  2MYO A;  3T9K A;  3ZU7 B;  3SO8 A;  4DUI A;  1N0Q A;  1IKN D;  4G8K A;  2HE0 A;  1AP7 A;  2ETC A;  3Q9N C;  1OY3 D;  4U96 D;  2XZT G;  2P2C P;  2KXP C;  3D9H A;  4U8V D;  5AQA A;  1NFI E;  5ENQ D;  5FIO A;  3T8K A;  4U8Y D;  2QYJ A;  4DX1 A;  4DX6 D;  4YDY A;  3W9F A;  3V2O A;  5FIN A;  4GMR A;  4Z68 A;  2XZD G;  2BKK B;  4QQI A;  3JXI A;  3NOG D;  3B95 A;  2DZO A;  1UOH A;  3JUE A;  4J8Y A;  4F1P A;  3ZUV B;  1IHB A;  4LSZ E;  4F6R D;  4OAV B;  5D66 A;  4O60 A;  2KBX A;  5EID A;  4QFV A;  5HRY A;  4HBD A;  5ENR D;  1QYM A;  5BXO A;  2RFM A;  2VGE A;  2ZGD A;  3HG0 D;  1YMP A;  5ENT D;  2J8S D;  3ZNG A;  4BET A;  5EYP F;  1DCQ A;  5JMN D;  4A63 B;  5CBN A;  2ZGG A;  1BI7 B;  1BLX B;  1DC2 A;  1SVX A;  5ENP D;  4OAU C;  5AQ7 A;  3Q9U C;  5HS0 A;  3KEA A;  5KNG A;  1MYO A;  2XEN A;  4HQD A;  1S70 B;  5CBO A;  5CER B;  1TR4 A;  3TWX A;  4HRL A;  2JAB A;  1AWC B;  1BD8 A;  4K5B A;  3DEP A;  4K5A B;  1D9S A;  1YYH A;  3TWU A;  2Y0B G;  5ENO D;  4ATZ D;  1K3Z D;  4HB5 A;  3B7B A;  4N5Q A;  4HRM B;  5KBA A;  4HLL A;  2B0O E;  5HKP A;  4JB8 P;  2RFA A;  5CED B;  2XEE A;  5JA4 D;  5EIB E;  4O1P A;  4DX7 D;  5ITZ F;  5CEA A;  3TWR A;  5EIL A;  2V4H C;  2FO1 E;  1K1B A;  3V2X A;  4DX2 A;  2DWZ A;  1G3N B;  3TWT A;  5EYL A;  2F8X K;  3EHR A;  3V30 A;  4ZFH A;  1N0R A;  5CEC B;  1MX2 A;  4O1O A;  3TWV A;  3EU9 A;  2ETA A;  4K5C A;  1IXV A;  4UUC A;  2AJA A;  4HI8 A;  4C48 B;  2V5Q C;  1K1A A;  3AJI A;  3HRA A;  1SW6 A;  2A5E A;  2XEH A;  4HNA D;  4CYM D;  1MX4 A;  4LNU D;  3NBN B;  3V79 K;  3NOC D;  3IXE A;  2DVW A;  1MX6 A;  3TWQ A;  4HI9 A;  5AQB A;  4CZ2 D;  3EHQ A;  5EN5 D;  4BER A;  1BI8 B;  4NIK A;  2L6B A;  1WDY A;  3J5Q B;  1YCS B;  4DRX E;  3W9G A;  2BKG A;  4BSZ B;  5AAO A;  5KWD A;  1MJ0 A;  3TWW A;  3UXG A;  1A5E A;  3UI2 A;  1WG0 A;  3UTM A;  4BES A;  5BXU A;  4HRN A;  4YDW A;  3C5R A;  3LJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...