5EO3A

Crystal structure of pelota c terminal domain from human
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
102
structure length
101
Chain Sequence
b'AGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein pelota homolog
molecule tags Cell cycle
source organism Homo sapiens
publication title Purification, crystallization and crystallographic analysis of the Pelota C terminal domian from human
rcsb
total genus 35
structure length 101
sequence length 102
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5eo3A00
3LWVC 1VQMF 1YHQF 1VQ4F 5GINC 1ZWZA 1VQOF 1W42A 3CG6A 1M90H 1VQ8F 4LCKA 3I56F 3FFMA 3SIUA 1Q82H 1IPAA 3N4ZA 3CCJF 3CCEF 3CCSF 1KQSF 3CCVF 1SDSA 5A2QM 2QEXF 2OHWA 1W2BF 1VQPF 3CMAF 3G6EF 1GO0A 3NMUC 1K9MH 3O85A 4TZZA 2BO1A 3CC2F 3CPQA 3E20B 3VMFB 5GANK 3NVKE 1H7MA 5GIOC 1QVGF 3RA5A 1M1KH 1S72F 3JCMM 5FJ4C 3J81M 2OTLF 3N4YA 3J80M 1N8RH 3PLAC 3I55F 3OBYA 3CXCF 2CZWA 1Q81H 3E1YA 3G4SF 5IT9M 1X52A 2HVYD 1Q86H 1RLGA 1W41A 2ALEA 3CCQF 3LFOA 1GO1A 3HAXD 1QVFF 1YI2F 4X3LA 4X3MA 1YIJF 3V7EA 1RA4A 3OBWA 3CPWF 3MCAB 3CCLF 1YJNF 1VQKF 3V7QA 5EO3A 3CCRF 1CN7A 5EWRA 3HJWC 3ON1A 1KC8H 3LWRC 2AIFA 4C4WC 3VI6A 1NMUB 2KTUA 1DT9A 1X7OA 1NJIH 4NUTA 5DCVA 2KTVA 3JAMM 3WXMB 2QI2A 3CC7F 2JNBA 3CCUF 1YITF 1VQ9F 1GZ0A 4BY9D 1X7PA 1YJWF 5GAPK 5FLXM 3J7AR 2LBWA 2WALA 2VGNA 5G4VC 1E7KA 3LWOC 2OZBA 3NK6A 4BW0B 3CCMF 1JJ2F 1K8AH 1VQ7F 2OTJF 3CC4F 2I6DA 1XBIA 2VGMA 3PAFA 1W40A 2KG4A 3NK7A 1K73H 1CK2A 1VQLF 3NVIB 3IR9A 2LBXA 1KD1H 1VQNF 1T0KB 1VQ6F 1W3EX 2FC3A 3RA6A 3LWQC 1YJ9F 3AGKA 3OW2F 3LWPC 3CD6F 3G71F 1PXWA 3SIVA 2QA4F 1Q7YH 5G4UC 3CMEF 5GIPC 1VQ5F 3GYQA
chains in the Genus database with same CATH superfamily
1VQMF 2ZAUA 5KX5B 2CHTA 2P6YA 1M90H 5LOVB 5JVDA 3MBMA 3IKFA 3SIUA 3HKCA 1Q82H 1IPAA 5JQGA 3CCSF 1KQSF 3KJJA 2QEXF 2OHWA 4X1YB 2IQQA 3NMUC 3S03A 4TZZA 3CPQA 4X1KB 5GANK 1VH8A 1U40A 4G4XA 4TUYB 2QTPA 1QVGF 5HXUA 3JCMM 3Q8HA 2HRYA 4DRXB 5LXTA 3J80M 4ZOLA 3IEWA 4M8IA 3VCZA 1PF5A 5J2UB 1IV3A 4ZOLB 3CXCF 5CB4B 5IT9M 4BVSA 4ZHWA 1W41A 2ALEA 4RQOA 3LFOA 1GO1A 3WJQA 3JAWB 2VAPA 5HXZA 4E6EA 3OBWA 1RQ7A 2I6RA 3MCAB 1X25A 3V7QA 2HP3A 4G4VA 4NWOB 3JARA 5HY2A 3LWRC 1NQ3A 4IHJA 3JAKA 5CA0A 1NMUB 3VI6A 3K14A 3WGNA 3CYQA 5DCVA 3VO8A 3WXMB 2QI2A 3CCUF 3P10A 1YITF 2LCAA 1VQ9F 1IV2A 5CA0B 1X7PA 4LNUB 5FLXM 3UT5B 4X1IB 5G4VC 2VGNA 5EB1B 3RE3A 2CSLA 1Q8RA 2IAFA 2HS4A 4O2BA 5CA1B 3HKEA 1K8AH 5IJ0B 3LDTA 5JCOA 1K73H 4I4TA 1VQLF 1W57A 3IR9A 3NVIB 3D54A 3KHNA 1VQNF 1JFFB 2W8BC 3ZP4A 3HKDA 3RA6A 4XCQA 1VK3A 3C9SA 1FFXA 1ONIA 3MDOA 3SIVA 3MCQA 4O4LB 2QA4F 5EIBC 5G4UC 4EB6A 3N2GA 5JQGB 1TVKB 3GYQA 3LWVC 4TV9A 1VQ4F 4BVQA 5LYJA 3OONA 1VQ8F 3FFMA 1QU9A 3N4ZA 1XHOA 1YGYA 3CCJF 5LA6A 4O4HB 5KMGA 1SDSA 5LYJB 3BYQA 3C8LA 1R1MA 1W2BF 1VQPF 1Z5WA 1GO0A 2UZHA 2BO1A 3S06A 3NVKE 1H7MA 5IYZB 5GIOC 3RA5A 3V4DA 3FPIA 4O4IA 3RYIA 5HP8A 4WBNB 4G4YA 1S72F 2HRUA 4ZHQB 1T0AA 3I7TA 3J81M 3IKEA 3WPXA 4EB6B 3N4YA 1QAHA 3S0YA 4ZHYB 2R751 5FNVB 2CHSA 5JCOC 4G4WA 4C8EA 3M1XA 4U39A 4EI9A 4O2AB 4YJ3B 1X52A 2HVYD 1FFXB 1Q86H 1RLGA 3JVHA 3ZO8A 3HAXD 4X3MA 3E22A 3K2XA 2KGWA 5CA1A 4ZHVA 3VYSC 1RA4A 1VQKF 4BVRA 4O4JB 3ZOPA 4F6RB 3ON1A 1KC8H 2AIFA 2UYKA 4TUYA 2KTUA 2Q1XA 4I50B 4YJ2A 3F0GA 4NUTA 5ITZA 3FD6A 5GONB 3CC7F 4BVTA 4RHAA 4X1YA 4BY9D 4FFBB 4I55A 4C82A 3HWUA 2PMPA 4C8IA 3GHZA 4O4JA 3J7AR 2LBWA 2WALA 1TVKA 1E7KA 5EIBD 3LWOC 3RYFA 2UYJA 1RQ2A 3IMPA 4C8GA 5KX5A 2OTJF 3CC4F 1JD1A 4U3JA 2I6DA 3WJPA 3C9UA 4ZHQA 1W40A 2KG4A 2HP0B 3TD3A 1RLUA 1U3LA 3U0OA 1KD1H 3ERNA 3JALA 4B45A 1VQ6F 3TD4A 3B6NA 1QD9A 2ZODA 2LBTA 3JALB 3HKEB 4PWTA 2DYYA 2H8EA 4O4IB 3RYIB 1FNKA 1PXWA 3JATA 3FD5A 4X1IA 5EYPB 1Q7YH 2ZVZA 3CMEF 5GIPC 5IJ9A 1VQ5F 4I50A 3UT5A 1YHQF 3RYCB 5GINC 3KJKA 1JY8A 1VQOF 2FGYA 2AMTA 3ESJA 3CCEF 2BTUA 4TV8A 3WGLA 3CCVF 3QTYA 1YQNA 1W55A 2CVLA 1XRGA 3CMAF 3G6EF 1IV1A 2UYNA 1J7HA 3O85A 4BT7A 1H47A 3HKDB 3CC2F 2HS3A 3IEQA 4BT4A 2F9ZC 1M1KH 5FJ4C 2H6LA 4WBNA 1N8RH 4G4ZA 3PLAC 2CZWA 3E22B 4I4TB 3E1YA 2Z01A 3ZP7A 3WPWA 5MN4A 3CCQF 5IJ0A 3CYPB 3L7QA 2VAMA 4X3LA 3RYFB 2H8CA 3T80A 5C8YA 3S02A 4X1KA 2HP0A 3CPWF 4DXDA 3CCLF 2UYNB 2CWJA 3JASB 2Z1UA 5EZYA 3GTZA 3CCRF 1CN7A 5EWRA 2UYPA 4C4WC 2AIZP 1UI9A 1NJIH 3VYUC 2RB9A 2KTVA 4TV8B 2BTQB 4O4LA 5HY4A 3JAMM 2VAWA 3M4SA 1W581 2Z1TA 5JH7A 3DC2A 5EB0A 2JNBA 5C8YB 5HY0A 3I3FA 3N2KA 3RYCA 3D00A 1H48A 3JARB 1YJWF 5GAPK 1SA0B 5EYPA 3D01A 5IJ9B 2PHNA 2OZBA 1JFFA 3NK6A 2GLZA 4X20B 4BW0B 5MN5A 3CCMF 5LXTB 1VQ7F 2VGMA 2YYEA 2EWCA 3NK7A 4EI7A 1VQVA 3HKBA 5J2TA 4ERHA 1GX1A 1CK2A 3LMEA 2LBXA 5MN6A 2RHHA 3VOBA 2B33A 1Z5VA 3MQWA 1W3EX 4ZI7B 3F0DA 2Q1YA 3LWQC 3AGKA 3F0EA 4YJ3A 4B62A 1FSZA 2OTMA 4BT3A 1W5EA 1IV4A 2RHLA 3KE1A 1W5AA 5FNVA 3QUWA 4HNAA 4IIJA 3C9RA 3TD5A 4B5CA 3DDNA 1FNJA 3ELCA 1ZWZA 3P0ZA 4IHJB 2RHJA 1W42A 1JN1A 3CG6A 4X20A 4LCKA 3I56F 2HS0A 2CW4A 2VXYA 3WJRA 5HY1A 3JATB 5ITZB 1SA0A 5A2QM 3K12A 5LP6C 5JVDB 3N2KB 2G9IA 2IG8A 4ZK7A 1K9MH 4F6RA 2V9YA 1TUBB 1CLIA 1SZQA 3E20B 3VMFB 1OFUA 3F6MA 3JAKB 2YXZA 2GZLA 2BTOA 3HTNA 2ZF8A 3VTIC 4TV9B 4BT5A 2OTLF 5BMVA 1COMA 4R40B 2NMUA 3S0HA 1OAPA 4G88A 3VOAA 5J2TB 3I55F 3OBYA 5BMVB 1Q81H 3K0TA 3G4SF 1U3PA 5HWEA 4ZI7A 4EI8A 4U3JB 1QVFF 1YI2F 2ZOVA 1YIJF 3V7EA 3CB2A 3P4EA 3HKBB 1ODEA 3LYBA 1YJNF 3F0FA 4YJ2B 3S0WA 3HKCB 1TUBA 2R6R1 2Z1EA 2GVIA 5EO3A 3HJWC 1KNJA 4FFBA 5JH7B 3WGKA 2HQSC 4O2BB 1DT9A 5B8FA 1X7OA 5LA6B 1W5FA 4BT6A 1XV2A 2K1SA 2N48A 3WGJA 4O4HA 5KMGB 3RYHA 5LP6A 1VHAA 1GZ0A 2RHOA 3R0PA 2L26A 3VIUA 3VYTC 3N2GB 4HNAB 4IIJB 4O2AA 3M84A 3QHDA 2ZVYA 5LOVA 1W5BA 5HP7A 3EORA 1JJ2F 4KWEA 3JASA 1DBFA 5EZYB 1XBIA 3PAFA 1KNKA 2DT4A 1W59A 5J2UA 4NQ3A 5AVMA 4B46A 1T0KB 3JAWA 3KIZA 3FBAA 3V3TA 1U43A 2FC3A 5EAZA 2MQEA 1YJ9F 3OW2F 3C9TA 4I55B 3LWPC 4BT2A 5CB4A 3CD6F 3G71F 3RYHB 3WGMA 5LP6B 5GONA 5IYZA 2HX0A 1UFYA 2Z1FA 4DRXA 4C81A 4LNUA
chains in the Genus database with same CATH topology
3LWVC 1VQMF 1YHQF 1VQ4F 5GINC 1ZWZA 4BVQA 1VQOF 1W42A 3CG6A 1M90H 1VQ8F 4LCKA 2FGYA 3FFMA 3I56F 3SIUA 1Q82H 1IPAA 3N4ZA 5HY1A 3CCEF 3CCJF 3CCSF 1KQSF 3CCVF 1SDSA 5A2QM 2QEXF 2OHWA 1W2BF 1VQPF 3CMAF 3G6EF 1GO0A 3NMUC 1K9MH 3O85A 4TZZA 2BO1A 3CC2F 3CPQA 3E20B 3VMFB 5GANK 3NVKE 2F9ZC 1H7MA 5GIOC 1QVGF 3RA5A 1M1KH 5HXUA 1S72F 3JCMM 5FJ4C 3J81M 2OTLF 3N4YA 3J80M 1N8RH 3PLAC 3I55F 3OBYA 3CXCF 2CZWA 4EI9A 1Q81H 3E1YA 3G4SF 5IT9M 1X52A 2HVYD 4BVSA 5HWEA 1Q86H 1RLGA 1W41A 2ALEA 4EI8A 3CCQF 3LFOA 1GO1A 3HAXD 1QVFF 1YI2F 4X3LA 4X3MA 1YIJF 5HXZA 3V7EA 1RA4A 3OBWA 3CPWF 3MCAB 3CCLF 1YJNF 1VQKF 3V7QA 4BVRA 5EO3A 3CCRF 1CN7A 5EWRA 3HJWC 3ON1A 5HY2A 1KC8H 3LWRC 2AIFA 4C4WC 3VI6A 1NMUB 2KTUA 1DT9A 1X7OA 1NJIH 4NUTA 5DCVA 2KTVA 3JAMM 5HY4A 3WXMB 2QI2A 3CC7F 4BVTA 2JNBA 3CCUF 5HY0A 1YITF 1VQ9F 1GZ0A 4BY9D 1X7PA 3D00A 1YJWF 5GAPK 5FLXM 3J7AR 2LBWA 2WALA 2VGNA 5G4VC 1E7KA 3LWOC 2OZBA 3NK6A 4BW0B 2GLZA 3CCMF 1JJ2F 1K8AH 1VQ7F 2OTJF 3CC4F 2I6DA 1XBIA 2VGMA 3PAFA 1W40A 2KG4A 3NK7A 4EI7A 1K73H 1CK2A 4NQ3A 1VQLF 3NVIB 3IR9A 2LBXA 1KD1H 1VQNF 1T0KB 1VQ6F 3V3TA 1W3EX 2FC3A 4XCQA 3RA6A 3LWQC 1YJ9F 3AGKA 3OW2F 3LWPC 3CD6F 3G71F 1PXWA 3SIVA 2QA4F 1Q7YH 5G4UC 3CMEF 5GIPC 1VQ5F 3GYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV C;  1VQM F;  1YHQ F;  1VQ4 F;  5GIN C;  1ZWZ A;  1VQO F;  1W42 A;  3CG6 A;  1M90 H;  1VQ8 F;  4LCK A;  3I56 F;  3FFM A;  3SIU A;  1Q82 H;  1IPA A;  3N4Z A;  3CCJ F;  3CCE F;  3CCS F;  1KQS F;  3CCV F;  1SDS A;  5A2Q M;  2QEX F;  2OHW A;  1W2B F;  1VQP F;  3CMA F;  3G6E F;  1GO0 A;  3NMU C;  1K9M H;  3O85 A;  4TZZ A;  2BO1 A;  3CC2 F;  3CPQ A;  3E20 B;  3VMF B;  5GAN K;  3NVK E;  1H7M A;  5GIO C;  1QVG F;  3RA5 A;  1M1K H;  1S72 F;  3JCM M;  5FJ4 C;  3J81 M;  2OTL F;  3N4Y A;  3J80 M;  1N8R H;  3PLA C;  3I55 F;  3OBY A;  3CXC F;  2CZW A;  1Q81 H;  3E1Y A;  3G4S F;  5IT9 M;  1X52 A;  2HVY D;  1Q86 H;  1RLG A;  1W41 A;  2ALE A;  3CCQ F;  3LFO A;  1GO1 A;  3HAX D;  1QVF F;  1YI2 F;  4X3L A;  4X3M A;  1YIJ F;  3V7E A;  1RA4 A;  3OBW A;  3CPW F;  3MCA B;  3CCL F;  1YJN F;  1VQK F;  3V7Q A;  5EO3 A;  3CCR F;  1CN7 A;  5EWR A;  3HJW C;  3ON1 A;  1KC8 H;  3LWR C;  2AIF A;  4C4W C;  3VI6 A;  1NMU B;  2KTU A;  1DT9 A;  1X7O A;  1NJI H;  4NUT A;  5DCV A;  2KTV A;  3JAM M;  3WXM B;  2QI2 A;  3CC7 F;  2JNB A;  3CCU F;  1YIT F;  1VQ9 F;  1GZ0 A;  4BY9 D;  1X7P A;  1YJW F;  5GAP K;  5FLX M;  3J7A R;  2LBW A;  2WAL A;  2VGN A;  5G4V C;  1E7K A;  3LWO C;  2OZB A;  3NK6 A;  4BW0 B;  3CCM F;  1JJ2 F;  1K8A H;  1VQ7 F;  2OTJ F;  3CC4 F;  2I6D A;  1XBI A;  2VGM A;  3PAF A;  1W40 A;  2KG4 A;  3NK7 A;  1K73 H;  1CK2 A;  1VQL F;  3NVI B;  3IR9 A;  2LBX A;  1KD1 H;  1VQN F;  1T0K B;  1VQ6 F;  1W3E X;  2FC3 A;  3RA6 A;  3LWQ C;  1YJ9 F;  3AGK A;  3OW2 F;  3LWP C;  3CD6 F;  3G71 F;  1PXW A;  3SIV A;  2QA4 F;  1Q7Y H;  5G4U C;  3CME F;  5GIP C;  1VQ5 F;  3GYQ A; 
#chains in the Genus database with same CATH topology
 1VQM F;  2ZAU A;  5KX5 B;  2CHT A;  2P6Y A;  1M90 H;  5LOV B;  5JVD A;  3MBM A;  3IKF A;  3SIU A;  3HKC A;  1Q82 H;  1IPA A;  5JQG A;  3CCS F;  1KQS F;  3KJJ A;  2QEX F;  2OHW A;  4X1Y B;  2IQQ A;  3NMU C;  3S03 A;  4TZZ A;  3CPQ A;  4X1K B;  5GAN K;  1VH8 A;  1U40 A;  4G4X A;  4TUY B;  2QTP A;  1QVG F;  5HXU A;  3JCM M;  3Q8H A;  2HRY A;  4DRX B;  5LXT A;  3J80 M;  4ZOL A;  3IEW A;  4M8I A;  3VCZ A;  1PF5 A;  5J2U B;  1IV3 A;  4ZOL B;  3CXC F;  5CB4 B;  5IT9 M;  4BVS A;  4ZHW A;  1W41 A;  2ALE A;  4RQO A;  3LFO A;  1GO1 A;  3WJQ A;  3JAW B;  2VAP A;  5HXZ A;  4E6E A;  3OBW A;  1RQ7 A;  2I6R A;  3MCA B;  1X25 A;  3V7Q A;  2HP3 A;  4G4V A;  4NWO B;  3JAR A;  5HY2 A;  3LWR C;  1NQ3 A;  4IHJ A;  3JAK A;  5CA0 A;  1NMU B;  3VI6 A;  3K14 A;  3WGN A;  3CYQ A;  5DCV A;  3VO8 A;  3WXM B;  2QI2 A;  3CCU F;  3P10 A;  1YIT F;  2LCA A;  1VQ9 F;  1IV2 A;  5CA0 B;  1X7P A;  4LNU B;  5FLX M;  3UT5 B;  4X1I B;  5G4V C;  2VGN A;  5EB1 B;  3RE3 A;  2CSL A;  1Q8R A;  2IAF A;  2HS4 A;  4O2B A;  5CA1 B;  3HKE A;  1K8A H;  5IJ0 B;  3LDT A;  5JCO A;  1K73 H;  4I4T A;  1VQL F;  1W57 A;  3IR9 A;  3NVI B;  3D54 A;  3KHN A;  1VQN F;  1JFF B;  2W8B C;  3ZP4 A;  3HKD A;  3RA6 A;  4XCQ A;  1VK3 A;  3C9S A;  1FFX A;  1ONI A;  3MDO A;  3SIV A;  3MCQ A;  4O4L B;  2QA4 F;  5EIB C;  5G4U C;  4EB6 A;  3N2G A;  5JQG B;  1TVK B;  3GYQ A;  3LWV C;  4TV9 A;  1VQ4 F;  4BVQ A;  5LYJ A;  3OON A;  1VQ8 F;  3FFM A;  1QU9 A;  3N4Z A;  1XHO A;  1YGY A;  3CCJ F;  5LA6 A;  4O4H B;  5KMG A;  1SDS A;  5LYJ B;  3BYQ A;  3C8L A;  1R1M A;  1W2B F;  1VQP F;  1Z5W A;  1GO0 A;  2UZH A;  2BO1 A;  3S06 A;  3NVK E;  1H7M A;  5IYZ B;  5GIO C;  3RA5 A;  3V4D A;  3FPI A;  4O4I A;  3RYI A;  5HP8 A;  4WBN B;  4G4Y A;  1S72 F;  2HRU A;  4ZHQ B;  1T0A A;  3I7T A;  3J81 M;  3IKE A;  3WPX A;  4EB6 B;  3N4Y A;  1QAH A;  3S0Y A;  4ZHY B;  2R75 1;  5FNV B;  2CHS A;  5JCO C;  4G4W A;  4C8E A;  3M1X A;  4U39 A;  4EI9 A;  4O2A B;  4YJ3 B;  1X52 A;  2HVY D;  1FFX B;  1Q86 H;  1RLG A;  3JVH A;  3ZO8 A;  3HAX D;  4X3M A;  3E22 A;  3K2X A;  2KGW A;  5CA1 A;  4ZHV A;  3VYS C;  1RA4 A;  1VQK F;  4BVR A;  4O4J B;  3ZOP A;  4F6R B;  3ON1 A;  1KC8 H;  2AIF A;  2UYK A;  4TUY A;  2KTU A;  2Q1X A;  4I50 B;  4YJ2 A;  3F0G A;  4NUT A;  5ITZ A;  3FD6 A;  5GON B;  3CC7 F;  4BVT A;  4RHA A;  4X1Y A;  4BY9 D;  4FFB B;  4I55 A;  4C82 A;  3HWU A;  2PMP A;  4C8I A;  3GHZ A;  4O4J A;  3J7A R;  2LBW A;  2WAL A;  1TVK A;  1E7K A;  5EIB D;  3LWO C;  3RYF A;  2UYJ A;  1RQ2 A;  3IMP A;  4C8G A;  5KX5 A;  2OTJ F;  3CC4 F;  1JD1 A;  4U3J A;  2I6D A;  3WJP A;  3C9U A;  4ZHQ A;  1W40 A;  2KG4 A;  2HP0 B;  3TD3 A;  1RLU A;  1U3L A;  3U0O A;  1KD1 H;  3ERN A;  3JAL A;  4B45 A;  1VQ6 F;  3TD4 A;  3B6N A;  1QD9 A;  2ZOD A;  2LBT A;  3JAL B;  3HKE B;  4PWT A;  2DYY A;  2H8E A;  4O4I B;  3RYI B;  1FNK A;  1PXW A;  3JAT A;  3FD5 A;  4X1I A;  5EYP B;  1Q7Y H;  2ZVZ A;  3CME F;  5GIP C;  5IJ9 A;  1VQ5 F;  4I50 A;  3UT5 A;  1YHQ F;  3RYC B;  5GIN C;  3KJK A;  1JY8 A;  1VQO F;  2FGY A;  2AMT A;  3ESJ A;  3CCE F;  2BTU A;  4TV8 A;  3WGL A;  3CCV F;  3QTY A;  1YQN A;  1W55 A;  2CVL A;  1XRG A;  3CMA F;  3G6E F;  1IV1 A;  2UYN A;  1J7H A;  3O85 A;  4BT7 A;  1H47 A;  3HKD B;  3CC2 F;  2HS3 A;  3IEQ A;  4BT4 A;  2F9Z C;  1M1K H;  5FJ4 C;  2H6L A;  4WBN A;  1N8R H;  4G4Z A;  3PLA C;  2CZW A;  3E22 B;  4I4T B;  3E1Y A;  2Z01 A;  3ZP7 A;  3WPW A;  5MN4 A;  3CCQ F;  5IJ0 A;  3CYP B;  3L7Q A;  2VAM A;  4X3L A;  3RYF B;  2H8C A;  3T80 A;  5C8Y A;  3S02 A;  4X1K A;  2HP0 A;  3CPW F;  4DXD A;  3CCL F;  2UYN B;  2CWJ A;  3JAS B;  2Z1U A;  5EZY A;  3GTZ A;  3CCR F;  1CN7 A;  5EWR A;  2UYP A;  4C4W C;  2AIZ P;  1UI9 A;  1NJI H;  3VYU C;  2RB9 A;  2KTV A;  4TV8 B;  2BTQ B;  4O4L A;  5HY4 A;  3JAM M;  2VAW A;  3M4S A;  1W58 1;  2Z1T A;  5JH7 A;  3DC2 A;  5EB0 A;  2JNB A;  5C8Y B;  5HY0 A;  3I3F A;  3N2K A;  3RYC A;  3D00 A;  1H48 A;  3JAR B;  1YJW F;  5GAP K;  1SA0 B;  5EYP A;  3D01 A;  5IJ9 B;  2PHN A;  2OZB A;  1JFF A;  3NK6 A;  2GLZ A;  4X20 B;  4BW0 B;  5MN5 A;  3CCM F;  5LXT B;  1VQ7 F;  2VGM A;  2YYE A;  2EWC A;  3NK7 A;  4EI7 A;  1VQV A;  3HKB A;  5J2T A;  4ERH A;  1GX1 A;  1CK2 A;  3LME A;  2LBX A;  5MN6 A;  2RHH A;  3VOB A;  2B33 A;  1Z5V A;  3MQW A;  1W3E X;  4ZI7 B;  3F0D A;  2Q1Y A;  3LWQ C;  3AGK A;  3F0E A;  4YJ3 A;  4B62 A;  1FSZ A;  2OTM A;  4BT3 A;  1W5E A;  1IV4 A;  2RHL A;  3KE1 A;  1W5A A;  5FNV A;  3QUW A;  4HNA A;  4IIJ A;  3C9R A;  3TD5 A;  4B5C A;  3DDN A;  1FNJ A;  3ELC A;  1ZWZ A;  3P0Z A;  4IHJ B;  2RHJ A;  1W42 A;  1JN1 A;  3CG6 A;  4X20 A;  4LCK A;  3I56 F;  2HS0 A;  2CW4 A;  2VXY A;  3WJR A;  5HY1 A;  3JAT B;  5ITZ B;  1SA0 A;  5A2Q M;  3K12 A;  5LP6 C;  5JVD B;  3N2K B;  2G9I A;  2IG8 A;  4ZK7 A;  1K9M H;  4F6R A;  2V9Y A;  1TUB B;  1CLI A;  1SZQ A;  3E20 B;  3VMF B;  1OFU A;  3F6M A;  3JAK B;  2YXZ A;  2GZL A;  2BTO A;  3HTN A;  2ZF8 A;  3VTI C;  4TV9 B;  4BT5 A;  2OTL F;  5BMV A;  1COM A;  4R40 B;  2NMU A;  3S0H A;  1OAP A;  4G88 A;  3VOA A;  5J2T B;  3I55 F;  3OBY A;  5BMV B;  1Q81 H;  3K0T A;  3G4S F;  1U3P A;  5HWE A;  4ZI7 A;  4EI8 A;  4U3J B;  1QVF F;  1YI2 F;  2ZOV A;  1YIJ F;  3V7E A;  3CB2 A;  3P4E A;  3HKB B;  1ODE A;  3LYB A;  1YJN F;  3F0F A;  4YJ2 B;  3S0W A;  3HKC B;  1TUB A;  2R6R 1;  2Z1E A;  2GVI A;  5EO3 A;  3HJW C;  1KNJ A;  4FFB A;  5JH7 B;  3WGK A;  2HQS C;  4O2B B;  1DT9 A;  5B8F A;  1X7O A;  5LA6 B;  1W5F A;  4BT6 A;  1XV2 A;  2K1S A;  2N48 A;  3WGJ A;  4O4H A;  5KMG B;  3RYH A;  5LP6 A;  1VHA A;  1GZ0 A;  2RHO A;  3R0P A;  2L26 A;  3VIU A;  3VYT C;  3N2G B;  4HNA B;  4IIJ B;  4O2A A;  3M84 A;  3QHD A;  2ZVY A;  5LOV A;  1W5B A;  5HP7 A;  3EOR A;  1JJ2 F;  4KWE A;  3JAS A;  1DBF A;  5EZY B;  1XBI A;  3PAF A;  1KNK A;  2DT4 A;  1W59 A;  5J2U A;  4NQ3 A;  5AVM A;  4B46 A;  1T0K B;  3JAW A;  3KIZ A;  3FBA A;  3V3T A;  1U43 A;  2FC3 A;  5EAZ A;  2MQE A;  1YJ9 F;  3OW2 F;  3C9T A;  4I55 B;  3LWP C;  4BT2 A;  5CB4 A;  3CD6 F;  3G71 F;  3RYH B;  3WGM A;  5LP6 B;  5GON A;  5IYZ A;  2HX0 A;  1UFY A;  2Z1F A;  4DRX A;  4C81 A;  4LNU A; 
#chains in the Genus database with same CATH homology
 3LWV C;  1VQM F;  1YHQ F;  1VQ4 F;  5GIN C;  1ZWZ A;  4BVQ A;  1VQO F;  1W42 A;  3CG6 A;  1M90 H;  1VQ8 F;  4LCK A;  2FGY A;  3FFM A;  3I56 F;  3SIU A;  1Q82 H;  1IPA A;  3N4Z A;  5HY1 A;  3CCE F;  3CCJ F;  3CCS F;  1KQS F;  3CCV F;  1SDS A;  5A2Q M;  2QEX F;  2OHW A;  1W2B F;  1VQP F;  3CMA F;  3G6E F;  1GO0 A;  3NMU C;  1K9M H;  3O85 A;  4TZZ A;  2BO1 A;  3CC2 F;  3CPQ A;  3E20 B;  3VMF B;  5GAN K;  3NVK E;  2F9Z C;  1H7M A;  5GIO C;  1QVG F;  3RA5 A;  1M1K H;  5HXU A;  1S72 F;  3JCM M;  5FJ4 C;  3J81 M;  2OTL F;  3N4Y A;  3J80 M;  1N8R H;  3PLA C;  3I55 F;  3OBY A;  3CXC F;  2CZW A;  4EI9 A;  1Q81 H;  3E1Y A;  3G4S F;  5IT9 M;  1X52 A;  2HVY D;  4BVS A;  5HWE A;  1Q86 H;  1RLG A;  1W41 A;  2ALE A;  4EI8 A;  3CCQ F;  3LFO A;  1GO1 A;  3HAX D;  1QVF F;  1YI2 F;  4X3L A;  4X3M A;  1YIJ F;  5HXZ A;  3V7E A;  1RA4 A;  3OBW A;  3CPW F;  3MCA B;  3CCL F;  1YJN F;  1VQK F;  3V7Q A;  4BVR A;  5EO3 A;  3CCR F;  1CN7 A;  5EWR A;  3HJW C;  3ON1 A;  5HY2 A;  1KC8 H;  3LWR C;  2AIF A;  4C4W C;  3VI6 A;  1NMU B;  2KTU A;  1DT9 A;  1X7O A;  1NJI H;  4NUT A;  5DCV A;  2KTV A;  3JAM M;  5HY4 A;  3WXM B;  2QI2 A;  3CC7 F;  4BVT A;  2JNB A;  3CCU F;  5HY0 A;  1YIT F;  1VQ9 F;  1GZ0 A;  4BY9 D;  1X7P A;  3D00 A;  1YJW F;  5GAP K;  5FLX M;  3J7A R;  2LBW A;  2WAL A;  2VGN A;  5G4V C;  1E7K A;  3LWO C;  2OZB A;  3NK6 A;  4BW0 B;  2GLZ A;  3CCM F;  1JJ2 F;  1K8A H;  1VQ7 F;  2OTJ F;  3CC4 F;  2I6D A;  1XBI A;  2VGM A;  3PAF A;  1W40 A;  2KG4 A;  3NK7 A;  4EI7 A;  1K73 H;  1CK2 A;  4NQ3 A;  1VQL F;  3NVI B;  3IR9 A;  2LBX A;  1KD1 H;  1VQN F;  1T0K B;  1VQ6 F;  3V3T A;  1W3E X;  2FC3 A;  4XCQ A;  3RA6 A;  3LWQ C;  1YJ9 F;  3AGK A;  3OW2 F;  3LWP C;  3CD6 F;  3G71 F;  1PXW A;  3SIV A;  2QA4 F;  1Q7Y H;  5G4U C;  3CME F;  5GIP C;  1VQ5 F;  3GYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...