5EO3A

Crystal structure of pelota c terminal domain from human
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
102
structure length
101
Chain Sequence
AGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein pelota homolog
publication title Purification, crystallization and crystallographic analysis of the Pelota C terminal domian from human
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 35
structure length 101
sequence length 102
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03465 eRF1_3 eRF1 domain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5eo3A00
4TZZA 2BO1A 3CCRF 1RLGA 3G6EF 3LWOC 3J81M 3N4YA 3G71F 1Q81H 3JCMM 5G4UC 3CC4F 1H7MA 3V7QA 1M1KH 3OBYA 2I6DA 3LWPC 3CPWF 3MCAB 3I56F 3NVKE 1K8AH 1GZ0A 1VQKF 1VQLF 3NMUC 1YITF 1QVGF 1YIJF 3CXCF 1VQ7F 1VQ5F 1N8RH 2WALA 3GYQA 1DT9A 2VGMA 2OTJF 3CD6F 1CN7A 1K9MH 1CK2A 3JAMM 2QI2A 1W42A 1S72F 1M90H 3FFMA 2KTVA 3I55F 5EO3A 1VQMF 2JNBA 3CC2F 3SIVA 1W3EX 3CCLF 1GO0A 5G4VC 1W40A 4X3MA 2LBXA 3O85A 1NMUB 1IPAA 3AGKA 3LFOA 3ON1A 1VQ8F 3CMAF 1E7KA 5FJ4C 3J80M 1VQ6F 3NVIB 4BW0B 3LWRC 1VQ9F 3CG6A 2OTLF 3CCEF 3HAXD 3VMFB 3CC7F 3J7AR 1SDSA 5GINC 3NK6A 2LBWA 1VQPF 1XBIA 2QEXF 3LWQC 1T0KB 1KD1H 1X7PA 4BY9D 3OW2F 1KQSF 2HVYD 5GIOC 3G4SF 1W2BF 5GIPC 4LCKA 5DCVA 5IT9M 3OBWA 2KTUA 3RA6A 3VI6A 2OHWA 2AIFA 3SIUA 1K73H 4X3LA 3PLAC 3CPQA 3CCUF 3PAFA 2ALEA 1YI2F 1GO1A 1PXWA 5EWRA 3CCMF 2QA4F 2OZBA 1YJWF 1X7OA 1RA4A 1W41A 2VGNA 3NK7A 3LWVC 1Q86H 1VQNF 3E20B 3WXMB 3E1YA 4C4WC 3CCVF 1KC8H 1VQ4F 3RA5A 3CCJF 1NJIH 5A2QM 4NUTA 3N4ZA 1VQOF 1X52A 1Q82H 1JJ2F 3V7EA 5GAPK 3CCQF 1Q7YH 2FC3A 5GANK 1ZWZA 5FLXM 3CCSF 1YJNF 2CZWA 2KG4A 1QVFF 3HJWC 1YJ9F 1YHQF 3CMEF 3IR9A
chains in the Genus database with same CATH superfamily
2BTOA 3TD5A 2K1SA 4X1IB 4G4YA 3BYQA 1FFXB 4FFBB 4U3JA 2GLZA 2UYPA 3JAWB 3I3FA 1Q81H 5G4UC 3CC4F 5CA0A 5HY2A 2ZODA 4TV9B 3WPWA 3NVKE 3MCAB 1K8AH 2H6LA 4LNUB 3NMUC 1VQ5F 2HP3A 4O2AA 3JALB 5JCOA 1Z5WA 2HS4A 2OTJF 1SZQA 5GONB 4IIJB 5EZYA 1S72F 1M90H 3I55F 2W8BC 5EAZA 1VK3A 3CYPB 2ZF8A 5G4VC 4DRXB 1UFYA 4X1IA 3F0FA 2AIZP 2Z1UA 1NMUB 3AGKA 3LFOA 4O4IB 1FFXA 4FFBA 1VQ8F 3CMAF 2L26A 1FNJA 3JAWA 1VQ6F 2B33A 1W581 1SA0B 3LWRC 3ZOPA 3VMFB 3J7AR 4TV9A 3EORA 2LBWA 1VQPF 1TUBB 2QEXF 1IV1A 4LNUA 1X7PA 1W57A 3ERNA 5JQGB 2RHOA 3JALA 3QUWA 3G4SF 5GONA 1W2BF 5BMVA 4HNAB 4X1YB 2HRYA 3P0ZA 1W5EA 1JY8A 2QTPA 4X3LA 4DRXA 4O4HB 3PAFA 3UT5B 3F6MA 4ZHVA 2QA4F 4O4IA 2F9ZC 1XHOA 2AMTA 2HP0B 1SA0A 2OZBA 1X7OA 1PF5A 1W41A 3NK7A 2GZLA 2ZOVA 3FPIA 4TUYB 1TUBA 1RLUA 3C8LA 3JATB 4NUTA 5LP6C 4F6RB 3V7EA 1FSZA 1OAPA 3JVHA 4RQOA 4HNAA 3CCQF 4X1YA 2MQEA 1ZWZA 3WJPA 1YQNA 3GHZA 3QHDA 3RYCB 5JH7B 3JASB 4O4HA 3FD5A 3RA5A 4ZOLB 4X1KB 3RYIB 2HP0A 3N2KB 3LWOC 5LXTB 4DXDA 3J81M 3N4YA 1YGYA 4TUYA 3G71F 4BVTA 1J7HA 2CWJA 2FGYA 2I6DA 3LWPC 3CPWF 3P10A 3ZP4A 1VQKF 3WGKA 4C8GA 3GTZA 1YITF 1QVGF 3K14A 1VQ7F 3KHNA 4F6RA 3IMPA 5B8FA 5KMGB 1KNKA 4ZI7B 1QD9A 1CN7A 2QI2A 1XRGA 2DYYA 2KTVA 3FFMA 3IKFA 3WJQA 1VQMF 3RYCA 5JH7A 3SIVA 3JASA 1VQVA 1UI9A 4I55B 2R6R1 4ZOLA 4G4VA 1GO0A 4X1KA 2DT4A 3RYIA 5LP6B 4O4JB 2Z1TA 3K12A 1X25A 2ZVYA 3MQWA 2LBXA 3O85A 3N2KA 4I50B 4EI9A 3TD4A 5LXTA 4KWEA 2GVIA 4U39A 1E7KA 1TVKB 4X20B 1W55A 4BW0B 1VQ9F 4YJ3A 5HP8A 3IEWA 3S0YA 3NK6A 4ZHQB 1XBIA 1IV2A 1U3PA 4BY9D 3OW2F 2HVYD 3VOAA 3ESJA 4C8IA 4ZI7A 2ZAUA 5GIPC 4LCKA 1R1MA 3L7QA 3OBWA 2KTUA 5CA1B 4C81A 2AIFA 5ITZB 5LOVB 4I55A 5LP6A 5MN5A 4O4JA 1Z5VA 3JARB 5LYJB 2ALEA 1YI2F 1PXWA 5EWRA 3ZP7A 3HKCB 3K2XA 1TVKA 4X20A 1U3LA 1YJWF 5MN4A 3CYQA 5EIBD 3HKBB 4EB6B 2VGNA 3LWVC 4EI7A 5JVDB 3K0TA 3CMEF 3B6NA 3P4EA 2UYJA 3E20B 3E1YA 3LDTA 4B62A 5HXZA 4C4WC 4YJ2B 5FNVB 1KC8H 4IIJA 5J2UB 3VOBA 1NJIH 3LMEA 1VQOF 3MCQA 3C9RA 4B5CA 1Q82H 1JJ2F 5EIBC 5GAPK 5CA1A 1VH8A 2KGWA 5HY0A 5ITZA 5LOVA 5GANK 5IYZB 3CCSF 2CZWA 2KG4A 1YJNF 1QVFF 3LYBA 3WJRA 2UYKA 3JARA 5LYJA 3ZO8A 2N48A 5HP7A 4BVRA 2BTQB 2BO1A 3C9UA 3HKCA 3G6EF 5CB4B 5HWEA 4ZHWA 3HKBA 4EB6A 2VXYA 5JQGA 5JVDA 1W5FA 1RQ7A 5HXUA 2ZVZA 1KNJA 3Q8HA 5LA6B 1GZ0A 5J2UA 2NMUA 3TD3A 3WGMA 1VQLF 5JCOC 1YIJF 3S0HA 3CB2A 4ERHA 3RYFB 3GYQA 1DT9A 2VGMA 3MDOA 1T0AA 1CK2A 5C8YB 1W42A 3UT5A 3VYUC 5IYZA 2HQSC 5EO3A 2VAWA 2P6YA 2YXZA 3CCLF 4I4TB 2VAMA 1W40A 3DC2A 3E22B 2UZHA 1QU9A 3R0PA 1IPAA 3D00A 5CB4A 3IEQA 3ON1A 2CW4A 3FD6A 1ONIA 3WPXA 3HAXD 3JATA 4BT4A 5EB1B 1DBFA 4R40B 1T0KB 3LWQC 5LA6A 5KX5B 5HY1A 1KD1H 3RE3A 3RYFA 5GIOC 2Z1FA 1QAHA 5C8YA 4NWOB 3VYSC 4C8EA 3VIUA 5DCVA 5IT9M 2CVLA 3N2GB 3RA6A 3VI6A 2HS3A 4I4TA 3PLAC 2RHHA 3E22A 1W5AA 3CCUF 3QTYA 4O4LB 4E6EA 1GO1A 2Z1EA 3RYHB 3VCZA 4M8IA 4C82A 3F0EA 1CLIA 3FBAA 2LBTA 4BT2A 5J2TB 4G4WA 5IJ0B 5KMGA 4BVSA 5KX5A 1VQNF 3WXMB 4BT6A 3VTIC 3CCVF 1VQ4F 2G9IA 2EWCA 3S0WA 5IJ9B 1U40A 3KJKA 4PWTA 1Q8RA 1Q7YH 2IQQA 4XCQA 1VHAA 3N2GA 4BT7A 2FC3A 2R751 3HJWC 4I50A 2HRUA 4ZK7A 1YJ9F 1FNKA 2IG8A 1YHQF 3IKEA 4O4LA 4B45A 3NVIB 5BMVB 3RYHA 4EI8A 3S06A 2Z01A 4TZZA 3CCRF 2Q1YA 1U43A 1RLGA 4ZHQA 2PMPA 3D01A 2YYEA 5J2TA 4IHJB 3JCMM 5IJ0A 3F0GA 3MBMA 1OFUA 1H7MA 5HY4A 3V7QA 1M1KH 2VAPA 5EYPB 3OBYA 2HX0A 3I56F 2UYNB 3CXCF 5IJ9A 3HWUA 1N8RH 2WALA 1IV3A 2RHJA 4RHAA 3HKEB 3CD6F 1K9MH 3JAMM 1GX1A 4BT5A 2LCAA 3KE1A 2I6RA 3OONA 2JNBA 3V3TA 3CC2F 1W3EX 4TV8B 3S03A 4G4XA 3M4SA 3KIZA 4X3MA 1W59A 3JAKB 2RHLA 3VO8A 5FJ4C 4YJ2A 5FNVA 3U0OA 4ZHYB 3J80M 2H8CA 2CHSA 3C9SA 1COMA 4IHJA 3CG6A 2OTLF 3CCEF 3CC7F 3V4DA 1SDSA 5GINC 3HKDB 5EYPA 4NQ3A 1JD1A 3I7TA 2UYNA 1KQSF 4O2BB 3HKEA 1JFFB 3M84A 3M1XA 2PHNA 3ELCA 3D54A 2OHWA 1XV2A 4TV8A 3SIUA 1K73H 2H8EA 3CPQA 4WBNB 4BVQA 3WGLA 3VYTC 4BT3A 3CCMF 2HS0A 3JAKA 2OTMA 2Q1XA 2CHTA 3F0DA 4U3JB 1RA4A 2RB9A 3T80A 3HKDA 1IV4A 1Q86H 2CSLA 1H47A 5AVMA 5CA0B 2V9YA 4G4ZA 4O2BA 4YJ3B 3CCJF 2IAFA 5A2QM 3N4ZA 1JN1A 1ODEA 1RQ2A 3S02A 3C9TA 1X52A 1JFFA 3KJJA 4B46A 2BTUA 4O2AB 3WGNA 5MN6A 5EB0A 3DDNA 5EZYB 5FLXM 1W5BA 4G88A 4WBNA 1NQ3A 1H48A 3IR9A 3HTNA 3WGJA
chains in the Genus database with same CATH topology
4EI8A 4BVRA 4TZZA 2BO1A 3CCRF 1RLGA 3G6EF 3LWOC 3J81M 5HWEA 2GLZA 3N4YA 3G71F 1Q81H 3JCMM 4BVTA 5G4UC 3CC4F 1H7MA 5HY2A 5HXUA 5HY4A 3V7QA 1M1KH 2FGYA 3OBYA 2I6DA 3LWPC 3CPWF 3MCAB 3I56F 3NVKE 1K8AH 1GZ0A 1VQKF 1VQLF 3NMUC 1YITF 1QVGF 1YIJF 3CXCF 1VQ7F 1VQ5F 1N8RH 2WALA 3GYQA 1DT9A 2VGMA 2OTJF 3CD6F 1CN7A 1K9MH 1CK2A 3JAMM 2QI2A 1W42A 1S72F 1M90H 3FFMA 2KTVA 3I55F 5EO3A 1VQMF 2JNBA 3V3TA 3CC2F 3SIVA 1W3EX 3CCLF 1GO0A 5G4VC 1W40A 4X3MA 2LBXA 3O85A 1NMUB 1IPAA 3AGKA 3LFOA 3D00A 4EI9A 3ON1A 1VQ8F 3CMAF 1E7KA 5FJ4C 3J80M 1VQ6F 3NVIB 4BW0B 3LWRC 1VQ9F 3CG6A 2OTLF 3CCEF 3HAXD 3VMFB 3CC7F 3J7AR 1SDSA 5GINC 3NK6A 2LBWA 1VQPF 1XBIA 2QEXF 4NQ3A 3LWQC 1T0KB 5HY1A 1KD1H 1X7PA 4BY9D 3OW2F 1KQSF 2HVYD 5GIOC 3G4SF 1W2BF 5GIPC 4LCKA 5DCVA 5IT9M 3OBWA 2KTUA 3RA6A 3VI6A 2OHWA 2AIFA 3SIUA 1K73H 4X3LA 3PLAC 3CPQA 4BVQA 3CCUF 3PAFA 2ALEA 1YI2F 1GO1A 1PXWA 5EWRA 3CCMF 2QA4F 2F9ZC 2OZBA 1YJWF 1X7OA 1RA4A 1W41A 2VGNA 3NK7A 3LWVC 4EI7A 1Q86H 4BVSA 1VQNF 3E20B 3WXMB 3E1YA 4C4WC 5HXZA 3CCVF 1KC8H 1VQ4F 3RA5A 3CCJF 1NJIH 4NUTA 5A2QM 3N4ZA 1VQOF 1X52A 1Q82H 1JJ2F 3V7EA 5GAPK 3CCQF 1Q7YH 4XCQA 2FC3A 5HY0A 5FLXM 1ZWZA 5GANK 3CCSF 1YJNF 2CZWA 2KG4A 1QVFF 3HJWC 1YJ9F 1YHQF 3CMEF 3IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZZ A;  2BO1 A;  3CCR F;  1RLG A;  3G6E F;  3LWO C;  3J81 M;  3N4Y A;  3G71 F;  1Q81 H;  3JCM M;  5G4U C;  3CC4 F;  1H7M A;  3V7Q A;  1M1K H;  3OBY A;  2I6D A;  3LWP C;  3CPW F;  3MCA B;  3I56 F;  3NVK E;  1K8A H;  1GZ0 A;  1VQK F;  1VQL F;  3NMU C;  1YIT F;  1QVG F;  1YIJ F;  3CXC F;  1VQ7 F;  1VQ5 F;  1N8R H;  2WAL A;  3GYQ A;  1DT9 A;  2VGM A;  2OTJ F;  3CD6 F;  1CN7 A;  1K9M H;  1CK2 A;  3JAM M;  2QI2 A;  1W42 A;  1S72 F;  1M90 H;  3FFM A;  2KTV A;  3I55 F;  5EO3 A;  1VQM F;  2JNB A;  3CC2 F;  3SIV A;  1W3E X;  3CCL F;  1GO0 A;  5G4V C;  1W40 A;  4X3M A;  2LBX A;  3O85 A;  1NMU B;  1IPA A;  3AGK A;  3LFO A;  3ON1 A;  1VQ8 F;  3CMA F;  1E7K A;  5FJ4 C;  3J80 M;  1VQ6 F;  3NVI B;  4BW0 B;  3LWR C;  1VQ9 F;  3CG6 A;  2OTL F;  3CCE F;  3HAX D;  3VMF B;  3CC7 F;  3J7A R;  1SDS A;  5GIN C;  3NK6 A;  2LBW A;  1VQP F;  1XBI A;  2QEX F;  3LWQ C;  1T0K B;  1KD1 H;  1X7P A;  4BY9 D;  3OW2 F;  1KQS F;  2HVY D;  5GIO C;  3G4S F;  1W2B F;  5GIP C;  4LCK A;  5DCV A;  5IT9 M;  3OBW A;  2KTU A;  3RA6 A;  3VI6 A;  2OHW A;  2AIF A;  3SIU A;  1K73 H;  4X3L A;  3PLA C;  3CPQ A;  3CCU F;  3PAF A;  2ALE A;  1YI2 F;  1GO1 A;  1PXW A;  5EWR A;  3CCM F;  2QA4 F;  2OZB A;  1YJW F;  1X7O A;  1RA4 A;  1W41 A;  2VGN A;  3NK7 A;  3LWV C;  1Q86 H;  1VQN F;  3E20 B;  3WXM B;  3E1Y A;  4C4W C;  3CCV F;  1KC8 H;  1VQ4 F;  3RA5 A;  3CCJ F;  1NJI H;  5A2Q M;  4NUT A;  3N4Z A;  1VQO F;  1X52 A;  1Q82 H;  1JJ2 F;  3V7E A;  5GAP K;  3CCQ F;  1Q7Y H;  2FC3 A;  5GAN K;  1ZWZ A;  5FLX M;  3CCS F;  1YJN F;  2CZW A;  2KG4 A;  1QVF F;  3HJW C;  1YJ9 F;  1YHQ F;  3CME F;  3IR9 A; 
#chains in the Genus database with same CATH topology
 2BTO A;  3TD5 A;  2K1S A;  4X1I B;  4G4Y A;  3BYQ A;  1FFX B;  4FFB B;  4U3J A;  2GLZ A;  2UYP A;  3JAW B;  3I3F A;  1Q81 H;  5G4U C;  3CC4 F;  5CA0 A;  5HY2 A;  2ZOD A;  4TV9 B;  3WPW A;  3NVK E;  3MCA B;  1K8A H;  2H6L A;  4LNU B;  3NMU C;  1VQ5 F;  2HP3 A;  4O2A A;  3JAL B;  5JCO A;  1Z5W A;  2HS4 A;  2OTJ F;  1SZQ A;  5GON B;  4IIJ B;  5EZY A;  1S72 F;  1M90 H;  3I55 F;  2W8B C;  5EAZ A;  1VK3 A;  3CYP B;  2ZF8 A;  5G4V C;  4DRX B;  1UFY A;  4X1I A;  3F0F A;  2AIZ P;  2Z1U A;  1NMU B;  3AGK A;  3LFO A;  4O4I B;  1FFX A;  4FFB A;  1VQ8 F;  3CMA F;  2L26 A;  1FNJ A;  3JAW A;  1VQ6 F;  2B33 A;  1W58 1;  1SA0 B;  3LWR C;  3ZOP A;  3VMF B;  3J7A R;  4TV9 A;  3EOR A;  2LBW A;  1VQP F;  1TUB B;  2QEX F;  1IV1 A;  4LNU A;  1X7P A;  1W57 A;  3ERN A;  5JQG B;  2RHO A;  3JAL A;  3QUW A;  3G4S F;  5GON A;  1W2B F;  5BMV A;  4HNA B;  4X1Y B;  2HRY A;  3P0Z A;  1W5E A;  1JY8 A;  2QTP A;  4X3L A;  4DRX A;  4O4H B;  3PAF A;  3UT5 B;  3F6M A;  4ZHV A;  2QA4 F;  4O4I A;  2F9Z C;  1XHO A;  2AMT A;  2HP0 B;  1SA0 A;  2OZB A;  1X7O A;  1PF5 A;  1W41 A;  3NK7 A;  2GZL A;  2ZOV A;  3FPI A;  4TUY B;  1TUB A;  1RLU A;  3C8L A;  3JAT B;  4NUT A;  5LP6 C;  4F6R B;  3V7E A;  1FSZ A;  1OAP A;  3JVH A;  4RQO A;  4HNA A;  3CCQ F;  4X1Y A;  2MQE A;  1ZWZ A;  3WJP A;  1YQN A;  3GHZ A;  3QHD A;  3RYC B;  5JH7 B;  3JAS B;  4O4H A;  3FD5 A;  3RA5 A;  4ZOL B;  4X1K B;  3RYI B;  2HP0 A;  3N2K B;  3LWO C;  5LXT B;  4DXD A;  3J81 M;  3N4Y A;  1YGY A;  4TUY A;  3G71 F;  4BVT A;  1J7H A;  2CWJ A;  2FGY A;  2I6D A;  3LWP C;  3CPW F;  3P10 A;  3ZP4 A;  1VQK F;  3WGK A;  4C8G A;  3GTZ A;  1YIT F;  1QVG F;  3K14 A;  1VQ7 F;  3KHN A;  4F6R A;  3IMP A;  5B8F A;  5KMG B;  1KNK A;  4ZI7 B;  1QD9 A;  1CN7 A;  2QI2 A;  1XRG A;  2DYY A;  2KTV A;  3FFM A;  3IKF A;  3WJQ A;  1VQM F;  3RYC A;  5JH7 A;  3SIV A;  3JAS A;  1VQV A;  1UI9 A;  4I55 B;  2R6R 1;  4ZOL A;  4G4V A;  1GO0 A;  4X1K A;  2DT4 A;  3RYI A;  5LP6 B;  4O4J B;  2Z1T A;  3K12 A;  1X25 A;  2ZVY A;  3MQW A;  2LBX A;  3O85 A;  3N2K A;  4I50 B;  4EI9 A;  3TD4 A;  5LXT A;  4KWE A;  2GVI A;  4U39 A;  1E7K A;  1TVK B;  4X20 B;  1W55 A;  4BW0 B;  1VQ9 F;  4YJ3 A;  5HP8 A;  3IEW A;  3S0Y A;  3NK6 A;  4ZHQ B;  1XBI A;  1IV2 A;  1U3P A;  4BY9 D;  3OW2 F;  2HVY D;  3VOA A;  3ESJ A;  4C8I A;  4ZI7 A;  2ZAU A;  5GIP C;  4LCK A;  1R1M A;  3L7Q A;  3OBW A;  2KTU A;  5CA1 B;  4C81 A;  2AIF A;  5ITZ B;  5LOV B;  4I55 A;  5LP6 A;  5MN5 A;  4O4J A;  1Z5V A;  3JAR B;  5LYJ B;  2ALE A;  1YI2 F;  1PXW A;  5EWR A;  3ZP7 A;  3HKC B;  3K2X A;  1TVK A;  4X20 A;  1U3L A;  1YJW F;  5MN4 A;  3CYQ A;  5EIB D;  3HKB B;  4EB6 B;  2VGN A;  3LWV C;  4EI7 A;  5JVD B;  3K0T A;  3CME F;  3B6N A;  3P4E A;  2UYJ A;  3E20 B;  3E1Y A;  3LDT A;  4B62 A;  5HXZ A;  4C4W C;  4YJ2 B;  5FNV B;  1KC8 H;  4IIJ A;  5J2U B;  3VOB A;  1NJI H;  3LME A;  1VQO F;  3MCQ A;  3C9R A;  4B5C A;  1Q82 H;  1JJ2 F;  5EIB C;  5GAP K;  5CA1 A;  1VH8 A;  2KGW A;  5HY0 A;  5ITZ A;  5LOV A;  5GAN K;  5IYZ B;  3CCS F;  2CZW A;  2KG4 A;  1YJN F;  1QVF F;  3LYB A;  3WJR A;  2UYK A;  3JAR A;  5LYJ A;  3ZO8 A;  2N48 A;  5HP7 A;  4BVR A;  2BTQ B;  2BO1 A;  3C9U A;  3HKC A;  3G6E F;  5CB4 B;  5HWE A;  4ZHW A;  3HKB A;  4EB6 A;  2VXY A;  5JQG A;  5JVD A;  1W5F A;  1RQ7 A;  5HXU A;  2ZVZ A;  1KNJ A;  3Q8H A;  5LA6 B;  1GZ0 A;  5J2U A;  2NMU A;  3TD3 A;  3WGM A;  1VQL F;  5JCO C;  1YIJ F;  3S0H A;  3CB2 A;  4ERH A;  3RYF B;  3GYQ A;  1DT9 A;  2VGM A;  3MDO A;  1T0A A;  1CK2 A;  5C8Y B;  1W42 A;  3UT5 A;  3VYU C;  5IYZ A;  2HQS C;  5EO3 A;  2VAW A;  2P6Y A;  2YXZ A;  3CCL F;  4I4T B;  2VAM A;  1W40 A;  3DC2 A;  3E22 B;  2UZH A;  1QU9 A;  3R0P A;  1IPA A;  3D00 A;  5CB4 A;  3IEQ A;  3ON1 A;  2CW4 A;  3FD6 A;  1ONI A;  3WPX A;  3HAX D;  3JAT A;  4BT4 A;  5EB1 B;  1DBF A;  4R40 B;  1T0K B;  3LWQ C;  5LA6 A;  5KX5 B;  5HY1 A;  1KD1 H;  3RE3 A;  3RYF A;  5GIO C;  2Z1F A;  1QAH A;  5C8Y A;  4NWO B;  3VYS C;  4C8E A;  3VIU A;  5DCV A;  5IT9 M;  2CVL A;  3N2G B;  3RA6 A;  3VI6 A;  2HS3 A;  4I4T A;  3PLA C;  2RHH A;  3E22 A;  1W5A A;  3CCU F;  3QTY A;  4O4L B;  4E6E A;  1GO1 A;  2Z1E A;  3RYH B;  3VCZ A;  4M8I A;  4C82 A;  3F0E A;  1CLI A;  3FBA A;  2LBT A;  4BT2 A;  5J2T B;  4G4W A;  5IJ0 B;  5KMG A;  4BVS A;  5KX5 A;  1VQN F;  3WXM B;  4BT6 A;  3VTI C;  3CCV F;  1VQ4 F;  2G9I A;  2EWC A;  3S0W A;  5IJ9 B;  1U40 A;  3KJK A;  4PWT A;  1Q8R A;  1Q7Y H;  2IQQ A;  4XCQ A;  1VHA A;  3N2G A;  4BT7 A;  2FC3 A;  2R75 1;  3HJW C;  4I50 A;  2HRU A;  4ZK7 A;  1YJ9 F;  1FNK A;  2IG8 A;  1YHQ F;  3IKE A;  4O4L A;  4B45 A;  3NVI B;  5BMV B;  3RYH A;  4EI8 A;  3S06 A;  2Z01 A;  4TZZ A;  3CCR F;  2Q1Y A;  1U43 A;  1RLG A;  4ZHQ A;  2PMP A;  3D01 A;  2YYE A;  5J2T A;  4IHJ B;  3JCM M;  5IJ0 A;  3F0G A;  3MBM A;  1OFU A;  1H7M A;  5HY4 A;  3V7Q A;  1M1K H;  2VAP A;  5EYP B;  3OBY A;  2HX0 A;  3I56 F;  2UYN B;  3CXC F;  5IJ9 A;  3HWU A;  1N8R H;  2WAL A;  1IV3 A;  2RHJ A;  4RHA A;  3HKE B;  3CD6 F;  1K9M H;  3JAM M;  1GX1 A;  4BT5 A;  2LCA A;  3KE1 A;  2I6R A;  3OON A;  2JNB A;  3V3T A;  3CC2 F;  1W3E X;  4TV8 B;  3S03 A;  4G4X A;  3M4S A;  3KIZ A;  4X3M A;  1W59 A;  3JAK B;  2RHL A;  3VO8 A;  5FJ4 C;  4YJ2 A;  5FNV A;  3U0O A;  4ZHY B;  3J80 M;  2H8C A;  2CHS A;  3C9S A;  1COM A;  4IHJ A;  3CG6 A;  2OTL F;  3CCE F;  3CC7 F;  3V4D A;  1SDS A;  5GIN C;  3HKD B;  5EYP A;  4NQ3 A;  1JD1 A;  3I7T A;  2UYN A;  1KQS F;  4O2B B;  3HKE A;  1JFF B;  3M84 A;  3M1X A;  2PHN A;  3ELC A;  3D54 A;  2OHW A;  1XV2 A;  4TV8 A;  3SIU A;  1K73 H;  2H8E A;  3CPQ A;  4WBN B;  4BVQ A;  3WGL A;  3VYT C;  4BT3 A;  3CCM F;  2HS0 A;  3JAK A;  2OTM A;  2Q1X A;  2CHT A;  3F0D A;  4U3J B;  1RA4 A;  2RB9 A;  3T80 A;  3HKD A;  1IV4 A;  1Q86 H;  2CSL A;  1H47 A;  5AVM A;  5CA0 B;  2V9Y A;  4G4Z A;  4O2B A;  4YJ3 B;  3CCJ F;  2IAF A;  5A2Q M;  3N4Z A;  1JN1 A;  1ODE A;  1RQ2 A;  3S02 A;  3C9T A;  1X52 A;  1JFF A;  3KJJ A;  4B46 A;  2BTU A;  4O2A B;  3WGN A;  5MN6 A;  5EB0 A;  3DDN A;  5EZY B;  5FLX M;  1W5B A;  4G88 A;  4WBN A;  1NQ3 A;  1H48 A;  3IR9 A;  3HTN A;  3WGJ A; 
#chains in the Genus database with same CATH homology
 4EI8 A;  4BVR A;  4TZZ A;  2BO1 A;  3CCR F;  1RLG A;  3G6E F;  3LWO C;  3J81 M;  5HWE A;  2GLZ A;  3N4Y A;  3G71 F;  1Q81 H;  3JCM M;  4BVT A;  5G4U C;  3CC4 F;  1H7M A;  5HY2 A;  5HXU A;  5HY4 A;  3V7Q A;  1M1K H;  2FGY A;  3OBY A;  2I6D A;  3LWP C;  3CPW F;  3MCA B;  3I56 F;  3NVK E;  1K8A H;  1GZ0 A;  1VQK F;  1VQL F;  3NMU C;  1YIT F;  1QVG F;  1YIJ F;  3CXC F;  1VQ7 F;  1VQ5 F;  1N8R H;  2WAL A;  3GYQ A;  1DT9 A;  2VGM A;  2OTJ F;  3CD6 F;  1CN7 A;  1K9M H;  1CK2 A;  3JAM M;  2QI2 A;  1W42 A;  1S72 F;  1M90 H;  3FFM A;  2KTV A;  3I55 F;  5EO3 A;  1VQM F;  2JNB A;  3V3T A;  3CC2 F;  3SIV A;  1W3E X;  3CCL F;  1GO0 A;  5G4V C;  1W40 A;  4X3M A;  2LBX A;  3O85 A;  1NMU B;  1IPA A;  3AGK A;  3LFO A;  3D00 A;  4EI9 A;  3ON1 A;  1VQ8 F;  3CMA F;  1E7K A;  5FJ4 C;  3J80 M;  1VQ6 F;  3NVI B;  4BW0 B;  3LWR C;  1VQ9 F;  3CG6 A;  2OTL F;  3CCE F;  3HAX D;  3VMF B;  3CC7 F;  3J7A R;  1SDS A;  5GIN C;  3NK6 A;  2LBW A;  1VQP F;  1XBI A;  2QEX F;  4NQ3 A;  3LWQ C;  1T0K B;  5HY1 A;  1KD1 H;  1X7P A;  4BY9 D;  3OW2 F;  1KQS F;  2HVY D;  5GIO C;  3G4S F;  1W2B F;  5GIP C;  4LCK A;  5DCV A;  5IT9 M;  3OBW A;  2KTU A;  3RA6 A;  3VI6 A;  2OHW A;  2AIF A;  3SIU A;  1K73 H;  4X3L A;  3PLA C;  3CPQ A;  4BVQ A;  3CCU F;  3PAF A;  2ALE A;  1YI2 F;  1GO1 A;  1PXW A;  5EWR A;  3CCM F;  2QA4 F;  2F9Z C;  2OZB A;  1YJW F;  1X7O A;  1RA4 A;  1W41 A;  2VGN A;  3NK7 A;  3LWV C;  4EI7 A;  1Q86 H;  4BVS A;  1VQN F;  3E20 B;  3WXM B;  3E1Y A;  4C4W C;  5HXZ A;  3CCV F;  1KC8 H;  1VQ4 F;  3RA5 A;  3CCJ F;  1NJI H;  4NUT A;  5A2Q M;  3N4Z A;  1VQO F;  1X52 A;  1Q82 H;  1JJ2 F;  3V7E A;  5GAP K;  3CCQ F;  1Q7Y H;  4XCQ A;  2FC3 A;  5HY0 A;  5FLX M;  1ZWZ A;  5GAN K;  3CCS F;  1YJN F;  2CZW A;  2KG4 A;  1QVF F;  3HJW C;  1YJ9 F;  1YHQ F;  3CME F;  3IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...