5EOQH

Structure of the murine fab 1g6 bound to the vaccinia virus a27 peptide 31-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
217
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDKYYNPSLQSQLTISKDTSRNQVFLKITSVDTADSATYYCAHDRGYYAMDYWGQGISVTVSSAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule keywords Anti vaccinia virus A27 antibody Fab 1G6 heavy chain
molecule tags Viral protein/immune system
total genus 45
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqH01
2F58L 4L29A 4NO5A 4RAUA 4ODWB 3W11D 3SDYH 3ZE2F 4H25A 4ENEC 5JW5A 4HUVB 3GI9L 1OOAA 5C2BL 2D7TH 4TUKL 4GBXB 5KW9L 4ODUB 1TVHB 4CDGC 1I9RH 3RNKA 4EI5A 4NDMA 3BKJH 4E41B 2PUQT 1QTYT 1B2WH 4X5XA 1MI5E 5BRZA 2XZQL 4Z7UB 2LAGB 3BZEB 3O3AB 1A7PL 3IFPA 1A3RH 1FE8L 2FHBA 3CFEB 4KHXH 2R23A 3MO1B 3MGAA 3KDMB 1EEZB 4PUBL 5D5MA 1AI1L 1B9ZA 2UZXB 4JN2B 4HWEL 3LQAC 3TIDB 3O45B 4YBHA 1NFDA 3ARGB 3H7BA 3MREA 1PY9A 3NFSL 4LQFL 4M6MH 3Q1SH 1TDQA 2ZUVA 3DETD 3MJGX 4HS6B 3JUYA 1K3ZA 4PGZA 4R7NA 4MSWB 4M61A 3L3GA 4QTHA 1OTSD 5GS0C 2DBJA 4FP8L 1YNLL 2BC4A 3MGOB 4IS6A 3F7RA 4MAYC 4P99A 2ITDB 2R29H 3K81A 3U83A 1JK8B 5F7DB 1BECA 4DKFH 2CQVA 1DEDA 1J12A 2LE9A 5FO7A 1LEIB 3GJFA 1KUMA 3RWEA 2BZDA 3HNVH 1FL6A 3VFOB 2ICWB 3EJYD 4XI5D 1M05A 4TRPH 1I7TB 1T0NB 1E27B 4OKVB 5T1KA 5FKPB 1EXUB 1G9NC 4BQCA 3IDYC 2E7MA 3PWPD 3TBYA 3SE8L 4YC2C 4XCEB 3CDFA 3DNKA 4YHLL 4CJ1A 3W9EA 5FHBL 1TZGL 4XCFL 3DVIA 1YY9C 1BD2E 4XNXL 2R8SH 4ZDHB 5JQ6L 3MSPA 2EZ0D 3IT8D 3FONA 1T80A 5HYJA 4I5BA 5F9OH 3FFCA 2UWEE 2OSLA 2EKSB 5EOCL 1R3IL 1FO0A 2JELH 3QCTH 3X13A 4K8RL 4L3EE 2ATPB 2DTMH 2C7UB 1KG0A 4HUWB 2HG5B 4Z76B 3HNSH 1HXMB 5CJ5A 4Y2DA 4OZGA 5T3XE 4LSUH 1FORH 1QBML 3WD5H 1MCPL 5B38A 4Z7NE 5BQ7B 4YR6A 3SDXB 3V4PL 3WKNA 1R24B 3B9VA 1MRCL 4JB9L 5J13C 4P9MH 4L3CB 3S96A 1EZVX 1T6WA 4EN3A 3L3JB 2FECI 3G5VA 5AZ2L 4WHTA 4YNYA 3I84A 3IFLH 5C0GB 1ZEAH 4YO0B 4LDEB 1LHZA 4HW6A 1INDL 1H3VA 2VAAB 4OGXL 2R2EB 3R0MA 3B8YA 5TH2A 2YD5A 4Y16B 6FABL 4K3DL 4KK6C 3Q3GB 3T8XA 3SDCB 4PD4J 1Z0MA 4MD0B 3Q2CA 4ODWA 5F96L 4YWGH 3EDJA 2EXYD 2CLRB 4HUVA 2LV4A 2JLLA 4Y4HB 2PR4L 4KDTA 3SBWA 3T2NH 4GBXA 4UOW0 4ODUA 5HDBE 5GGVL 1F2QA 1TVHA 1MQKH 4R26H 4KK8D 2MQ0A 5F1IB 4OM1L 4AZ8A 2R9HD 2AABH 3O3DB 3S88L 5IFJB 1N6VA 2JJWA 4JJHA 4U3HA 4S2SB 3TYGL 4Z7UA 3BZEA 2A6IA 1LP9F 2KDGA 3AREB 4UTAL 3CFEA 4JG0L 5GZOC 2AEQH 3MO1A 1UJ3B 5KS9F 3KDMA 5EU6D 3U4BH 1EEZA 4RQQB 3LPWA 2YZ1A 2ZPKH 4AEHH 4Y5YA 2VDLH 3LDBC 1YEJH 3KAAA 4M1DL 3SPVB 1KEML 4JN2A 1WAAE 5LGKA 2IH1B 1MCJA 2QQKL 3RWHB 3O45A 4RGNE 2I9LB 3TIDA 3ARGA 1ZLWH 2MCG1 1IC4H 3EIFA 1WWBX 1F8TH 2OMBA 2D9QB 4HS6A 2H9GA 1ZGLP 3T0EE 1WAAF 3BWAB 2DIBA 2VZSA 3M45A 3MGOA 2HWZH 4KVCH 4TULL 3KYNA 3A67L 4MX7B 4GSDH 2ITDA 2A0LC 3KS0J 4P2OC 1JK8A 5DK2B 3AM8C 5DLMH 4HEME 4URTB 1GRWA 3P9WB 4YFDB 4L3ED 5AD0B 3OKEB 5FUCC 3G6JF 4BSWB 1LEIA 1NLDH 5KSAB 2HRLA 3QUXB 3VFOA 2ICWA 1KFAL 1I7TA 1T0NA 1E27A 5FKPA 1D6EB 4QRRE 1EXUA 5ESQB 1A22B 3CH8A 2F9BT 1U93B 3ILQD 4NRZA 2ZCHL 2AEPH 4NCDA 4PIRF 4XCEA 5F6HJ 3UJTH 4XMPH 3UAJD 4LSVL 2X42A 4DTGH 2AVGA 5GS0D 3G6DH 5DC4B 2EDXA 5DEGB 1BVLB 5IB3B 4BZ1L 5MP6L 5C0BB 4JFFB 3SKJH 1AC0A 4HIEB 5DDHA 3MV7B 1PSKL 5TDPB 3STLB 4H20L 4PREB 2MKWA 5C0IA 4K2UH 4KZDH 2L7UA 3WKML 1T03L 2EKSA 4LOUC 4S1DC 2A2QT 4Y7MA 5CINL 1KCSH 3TV3H 1SY6L 4D9RD 1LDPH 2ATPA 5EBWB 1SEQH 2C7UA 2D3VA 4HUWA 3SDDD 4Z76A 4UZGA 1BPVA 1HXMA 4YXHH 5T3ZE 2BOBB 3FMGH 5DEZA 4IIQB 4LNRB 1CF8H 4OFPA 2NY0B 1M7IB 5BQ7A 3SDXA 4U1LB 2YMXL 3QXVA 4FQ1H 1R24A 3QP3A 1CK0H 4ZTPL 4L3CA 4H1LB 1AXTL 5GSVA 1AKJD 3L3JA 4ZTOL 2GITB 2C5DC 3MRCB 4OZIB 4QCIB 4YO0A 1GH7A 4HLZG 2P46B 4ESKA 2K3TA 1WBYA 3SO5A 3SGJC 5AAWA 4IDJL 4UBDC 4Y4FD 1JPST 2VAAA 2R2EA 4Y16A 2PETA 5IFHH 1CXKA 4OBSA 3SDCA 4GH7B 3JWOL 4MD0A 3O41B 4DN3H 2DQDH 3R0NA 2AGJL 2CLRA 3VXME 4Y4HA 2HFGH 3SE3A 2H26B 3T0ED 3LRGA 1CL7I 5KAQG 3BX7C 4LVOC 4UV7H 5LQBH 4LQ1A 1OL0A 4PP2B 2CGRL 4M48H 5F1IA 4X83A 2OJZH 3O3DA 4J4PA 5IFJA 2B8OT 4NC1C 3B3IB 3W5MA 1KCRH 2DKUA 4MA1B 4JRXE 1JGLH 3AREA 5C6TL 4Z95H 5D6DA 1UJ3A 3DIFB 4XBEL 5BOPA 4QHNB 4XPGL 4Y5VC 4EJ1C 2W9DH 3TCXA 4OQTH 4CADB 4IOIB 4H88L 5T3XH 4IEFB 1IKNA 4PBWD 1CGUA 4FQXB 2VL4A 2X40A 4TVPE 1RIVH 5B3NA 4M7LL 1ZHLB 1MY7A 2IH1A 3RWHA 5IROA 3UTOA 2I9LA 2NXYB 4XP5H 4ZMAT 3TWCH 4YBQD 1XEDA 3DXAB 3ULUE 3N85L 5GRUH 5BV7L 4LHUG 4PV9B 1WSST 4EDWL 3BWAA 1UADC 1MFCL 2I5YL 5K9JL 4HWBL 3GNML 4KROD 3QAZC 5DURB 4MX7A 1JHLL 3ARRA 4PG9B 2Q76B 2VDKH 5DK2A 4YFEA 5E56A 4MMXC 5DVNA 3F65A 1A7QL 2DM4A 5AD0A 3OKEA 1TTGA 1KJ2B 5D1XB 4BSWA 4G7YL 4ELMF 5KSAA 4NC0B 3UTQB 2PN5A 3BN9C 3OHXB 2W38A 2D7MA 4KJQC 1MVFA 4IRJC 1D6EA 1OW0C 2OTWB 3ECBB 4R90H 5ESQA 5J3HC 3RAJL 1MUJB 1U93A 3N0PB 3PUCA 3OXSB 5I1KL 1PW3A 3PABB 1W72B 3MLRL 5KBNC 2J88L 1IFHL 3EO9L 1K2DB 3QHTC 2A1WL 1T66C 3G5ZA 4GRLD 5DEGA 1BVLA 5IB3A 4HFUH 4NGHH 2XZCL 5C0BA 4JFFA 3U1SL 4OZ4B 5F89B 3FQWB 5TDPA 3STLA 2OS7A 4PREA 3O6KH 4P2OD 2G5BB 2P5EE 2XV6B 3HN3A 3ZTJG 5DGRA 5H37G 4J3VA 2FD6H 1GGBL 35C8L 4OCSL 4QHLB 2WBJC 5GS1B 4OZFH 5EBWA 4NRYB 4MQXD 4F80A 3L5JA 1B0WA 3B9KA 2IADB 1UM5L 1RUML 1FZJA 3IKCB 3VXMD 2BOBA 2F53D 4IIQA 3PHSA 1UM4H 4LNRA 1XIWB 2NZ9D 4OGYH 4PJHB 3V6ZB 1M7IA 5E08L 1XGPA 5I75B 3S35H 1S7QB 2ADGB 4H5SB 4LU5H 5D1QC 4H1LA 2HKHH 3H9HB 3CFCH 4N0UE 4F2MB 4EIZC 2GITA 2IMNA 3MRCA 5I19H 2BNQB 2VXTL 2BVQB 3FQNA 4MJIB 4OLEA 4P46A 4AT6B 1B4RA 3CPLB 4RGOH 2NY3D 4X6BB 3WHE1 4MXVF 4ONGL 3QEQD 3T04D 3ARSA 2CR3A 5SX4I 3CFKB 3VCLB 1E4XH 1AJ7L 5I1GH 4D9LL 2QBWA 1BEYL 4F7MB 4MHHG 2W9LA 2ZUWA 2AJYH 2J5LB 2QR0B 2WLYA 3M07A 5DR5L 2H26A 1MRFL 5K9OA 4HV8A 5FYLD 4H0IA 4X6DF 1C1EH 4PP2A 4R2GC 1U8KB 1QLRB 4XP9H 5EO0B 3B4NA 1IEBA 1EUUA 3B3IA 4X9GA 3MLUL 3GBNH 1D5ZA 5JR1L 4ODBD 5HHXH 4OCRH 3DIFA 2NY2B 4UBDD 3H9ZA 4LMQE 3OKMA 3S35X 1H8NA 4QHNA 1F02I 4MAUH 4X5WB 3IXAB 4IOIA 4CADA 1RZIB 4FQXA 4HEPG 5LGHH 3W0WD 3EOBB 4KJPC 4MJ2A 1ZHLA 3PP4L 43CAB 1ERNA 3U7WL 1FO0L 3DXAA 3UJIH 4JFOB 4PV9A 4FG6D 1EGJA 2YRZA 1BM3H 3X3GL 4JLRB 4Y8DC 5KOVC 4YHYC 2CLVB 4M1CC 5MEOB 2QSCL 3VXUB 4PG9A 1A21A 2Q76A 5I18H 1F2XK 3JWNC 4TSBL 3HZMB 4YBLC 5E4EB 3I3EA 1NJ9B 4I3SH 1OARL 4RSVA 4WO4D 5D1XA 1WFNA 4XP6L 2WMPA 3UTQA 4NQUA 3OHXA 3LHPL 3IKKA 4OGZA 1QSEB 1AR2A 2VR5A 2OTWA 3MUHL 5JORB 3OXSA 2Y06H 3QRGH 3PABA 1W72A 1NEZB 5AYUH 5DQJB 1DQLL 4XCCL 1V3MA 2AK1L 4CU6A 4Z7WE 1IJ9A 1KIRB 2ILLA 3AS0A 3HG1B 1R3LB 1N3NB 4J6RH 4OZ4A 5F89A 4F58H 2X1OA 3FQWA 1FYTB 1RZFL 2FLRT 2R4RL 2G5BA 4EUPG 3OX8A 3N1PC 1JGUH 5E8PB 1NCBL 3DO3A 4GG6E 2BVPB 5DJ8B 3QXAB 4G8GB 4QHLA 5GS1A 4NRYA 3QG6A 4NN7C 1W0VB 4OTXL 3S4SG 4M3JA 5CKAA 2IADA 3TZVD 4GG6F 2BVOB 4NJAH 3PJSB 4F37F 1XIWA 4RFEB 4PJHA 3V6ZA 5D4QA 4MGXA 5DA0B 1T66D 2N1KA 1H3XA 4H5SA 1IBGH 1FGNL 3V52H 1G1CA 5DVKA 4L1HA 4F2MA 3P30H 2NY5C 2GW5A 2BNQA 1WZKA 2BVQA 5KVEL 5DRZB 2XICA 4KI5C 1UA6H 4EBQH 1LK3L 4EZMA 2FEDC 2WBJD 1CDJA 4X6BA 5A2JH 4WENB 1MPAL 3VCLA 4WUUB 3CFKA 2DM7A 3QPXL 5CJBA 1KV3A 4BQ9A 1C5CL 1KENL 3UBXI 4F7MA 1ZT1A 1G1YA 1XZ0B 3WXWL 2ARJB 4HJGB 2XWTB 3S3SA 4N90D 2FB4L 4M6NH 2XOTA 4R4NC 3FQXA 2P7TB 1ETZB 2XXCB 4NZUH 1QLRA 5D2LB 4PJ5E 5EO0A 1CLOH 1UYWL 1J05B 4JFYB 2FHFA 4FQ2L 3DWTA 1DQJB 4NCC1 4KJWD 4W4OA 2WWMD 1KCKA 1WFUA 1SQ2N 4HPYL 2YA2A 4X5WA 3IXAA 1RZKH 1RZIA 1WICA 4MNGB 1BFTA 1M71B 2JJSA 4PRDB 3EOBA 4MXWH 5DFVD 5E2UH 1A2YB 2QLVB 2Y1VA 3L3IB 3RVWD 1S8DB 2VITB 3JV0A 1T21B 3RGVC 3ARDB 1JPTL 3BD5A 1G9EA 2Q8AH 4ZFZA 5I71B 4UDUB 3N1QC 2V5SA 2Y5TB 3U9UB 1CXHA 5BO1H 4JO3L 2Z35B 4L9LC 1S7SB 5MEOA 3J8F7 3VXUA 4O02L 3GUTA 3DRQB 2F19H 2D9CA 3MLWH 3OPZL 4OIIL 3AB0B 4M43L 5MI0B 3CZJA 3HZMA 4CMHC 1DBBL 1NJ9A 5LBSH 1AY1H 4F33B 5I1HL 1QSEA 1HIML 4X98B 5JORA 4IHOB 1T4KB 4KI5F 2XQYG 3KPSE 3RDTC 1NEZA 5DQJA 4MA7L 4LAJH 3OQ3B 2PTUA 5EWIL 3O2VH 4PRBB 3BPLB 3MNVB 3HG1A 1KIRA 4G5ZL 4IDLA 1R3LA 3HAEH 1A9BA 3U2SB 2DQGL 1FYTA 3QG7H 2O5YH 1CU4L 3V79C 1B0GB 1IC1A 2V9TA 1QACA 5E8PA 4YHKL 4XPHL 1D6VL 3U9PH 4C54A 4HG4K 5FYJU 2BVPA 5DJ8A 1HK6A 1HHGB 4G8GA 1PLGH 1T1XB 4O2FB 1U9KA 3GEWB 3MLTA 2J4WL 4FZ8L 2FECL 1MCOH 2UUDK 4NRXB 3GRWA 1W0VA 1YYMH 3IGAB 1DBKH 4PFEA 2BVOA 5EUOE 1QZ1A 7FABL 3PJSA 4Y19B 4I3GA 1JBJA 1RK0B 2BJML 2WM0A 3O3UN 4UT9H 4A6YB 3H42L 3S36H 4WGWB 5FOBB 5BJTB 1A7BA 4Z7VF 4WW2F 4PJEB 1MJJB 5CEZL 3WYRA 2P24B 4XCYB 1MAMH 3FN0L 4JFHD 3RX5A 4LLUB 2XNAB 5EU6B 1KLFA 3U30B 5DRZA 5D7JC 3HLAB 1WBZA 1BWWA 1F3DJ 2J6EH 3VD7A 4JM4L 3DARA 3VD9A 2VLRB 3KWWA 4WUUA 5I1DB 2OM5A 4NKOB 4GW1A 4GKNB 1R5IA 4RNRB 4CU8A 5DVLA 4OLWL 4I4WB 3DYMA 5IR1B 3ISWA 1RULH 1A6VH 2ARJA 2QTEA 4OF3A 4CVXB 3CFDB 2Y36H 4HJGA 2CRYA 2XWTA 4KRMB 3ARBC 4WWID 4PRPD 1HSAB 2P7TA 4NFCA 4OGAC 2DJUA 4M03A 5D2LA 1V5JA 4LASH 4YFLI 2Q7YB 2EYSB 3SCMD 4JFYA 3K4AA 4AENB 1CLCA 4NO3B 1UVQB 3TBSB 3RHWF 1DQJA 4Z8FH 1DFBL 2HT3D 3KYKH 4HKXB 3CJJA 5I1JH 2FEDD 2KZ1B 2IFFH 2OK0H 3NZ8A 5C0AE 5HXMA 5IESH 1IKFH 2FR4B 1EK3A 4MNGA 1V05A 4PJAF 4PRDA 4P2QD 3UBXA 1IAIM 1N4XH 1A2YA 3RZWA 3L3IA 2XQBH 1S8DA 3NH7L 2VITA 3ARUA 3AS1A 4N9OB 1LE5B 1S7VB 4QRQB 1T21A 3ARDA 5ADPL 2VLME 5L2JB 3L5XH 4I0PA 1C5DA 3I6KB 1EHLH 2EDWA 4MAYB 3R06B 1OT1A 4JPVL 2Y5TA 3A0OA 3TJHC 3U9UA 3KS0H 2IPTH 3FB8B 3GKZA 1HZHH 2Z35A 4LRNL 3MRDA 1S7SA 5KANI 3DRQA 1KC5H 2V6HA 4P5KA 1PQZB 1XF2B 4JJ5A 3BKYL 4OLZH 1JZ3A 4QT5B 4PRIE 5E5MB 5CP7B 4F33A 1ZE3C 3IDYB 1YEEH 1EAPA 1BOYA 4U6VH 4WI8A 1EO8H 2R0LH 5EZIL 4X98A 1NDGB 1XCQB 4YC2B 1Q0YL 2NMSA 4IHOA 1T4KA 3MC0A 1VFOA 3FT2B 2EXWD 2OXHA 4ZNEA 4L4VE 4D9QE 1ORQB 1HH6A 5D96B 5KS9B 4WI3A 4JRYA 5I1EL 1FG9C 4PRBA 3U82B 4TTGA 3NIFE 1AKJB 3MNVA 3ZDZE 3MFFA 4NUGH 4P3CL 3U2SA 1FJ1B 2DBLH 2YR3A 5F6IC 1Z6JT 1X5GA 2DB8A 2NXZC 5DTFB 1PG7W 2OJEB 1B0GA 3INUL 3FO2A 3GSUB 1AXSB 4NP4L 1XGTB 3NIFF 1JP5A 1W2KT 2LQRA 3LKRB 1T1XA 4O2FA 4NQXB 4FFVC 1U58A 1CT8A 2XPGB 4NRXA 2L4OA 3EDEA 3IGAA 3OSKA 3T0AA 4L8CB 5FECB 3FFDB 3L95B 2F8XC 1BFSA 4NKIL 3NTCH 3RL2A 2E8YA 4Y19A 5J13B 3KHOA 1HQRA 2VR9A 1RK0A 1KBGH 1YQVH 4Z7QF 2VERN 3G6JB 4A6YA 3BJLA 4GMSL 5BJTA 1MF2H 4PJEA 3HC4L 1MJJA 1BREA 3QWOB 2P24A 5FYJL 4XCYA 1YEIH 2OZ4A 4MA8H 4U0RC 4LLUA 2XNAA 2FHCA 5EU6A 5K9KB 1CL7L 2E9JA 3PV7A 3HLAA 5DUMH 3FB6B 5C0AD 3WNKA 1EGJL 1VSCA 3H2WA 2A6KB 2VLRA 5I1DA 4NKOA 2ZSVB 1VADB 4GKNA 4RNRA 4PGJA 4UINL 2IPUG 3H3PL 5IR1A 3RVVD 2VLMD 4HC1A 4F7CB 4CVXA 3CFDA 2YPLA 3MRQB 4UQ2B 2BHYA 4P4KD 1HSAA 4H8WC 2WAHA 4WI5A 3EKCA 2EYSA 1P9MC 1A6TA 4PS4H 1UVQA 1GOFA 3P0YH 5IM7B 3W81A 4HGKC 4HKXA 2Y25A 5GRVK 3LDBB 4YHOH 4RIRB 3IVKA 2IQAB 4OJFH 1MJ8H 1BGXL 5EZLB 2OI9C 1NDMB 4Y88A 3WHE0 4LIQL 4L4VD 4D9QD 2PXYD 5EZOH 5DJ6B 4H26B 3QULA 1YNKL 4QNPE 1LE5A 5A2LH 1AQKL 1N0LA 4GRLB 5L2JA 1XF1A 2DAVA 3I6KA 5EIVA 1BZQK 1U8HB 1T3FB 4MAYA 3O2DL 3R06A 4PJCE 4FXKB 5HYEA 4P2OB 4GXVH 3FB8A 5IP4A 5T1DH 2UZIH 2QQLH 1C5BH 2NCMA 4WWKC 4WVRA 3MLZL 3JV6A 1XF2A 3BPOC 1MH5A 5E5MA 5CP7A 3VXTB 1I9JL 3L5HA 3RUGE 2F53B 5EOCJ 5CEXB 1XCQA 4G7VL 3OWEA 2JB6B 3OR6B 4NJ9H 4LRIC 4G6FB 5KS9A 3OJDB 3HMWH 3Q5YA 4NN5C 2E7LC 3VWJD 1YJDC 4JZOB 1AKJA 3FZUD 4XVTL 2LAAA 2Z9TA 4E0RB 1I1AC 1FJ1A 2DOCA 1GJIA 2E3VA 3C87A 1UZ6F 5DTFA 5E2VL 1FFQA 2FX9H 2OJEA 5F9AC 3CVHB 1AXSA 3BHBB 3VFPB 1XGTA 2NY3B 3LMJH 1D5IL 4N1HB 4XMLH 2RHEA 1F3JB 2DQTL 4X0KB 5KVFL 1KEGL 2A9NH 2XPGA 5HVHC 1JYXA 5IEHB 5T1LB 3GSOB 4P59L 3VGEA 3MFGB 5FECA 4L8CA 3FFDA 3L95A 2XZAL 1JTTA 1KLUB 2SEBB 3G6JA 3OBAA 4ELMB 5F7EL 3DSFL 5D72L 4XBGB 3RQ3A 3TJEL 3GKWL 1G7HA 4PRNB 3R1GH 4TTDC 5EBGA 3QWOA 3KPMB 4BSJA 4EOWL 5K9KA 1N0XH 3BPNC 2H41A 3TVMD 1YPZF 3WIHA 3Q6GL 5TQ0L 1N5AB 4XTRC 4JGJA 5KJRL 1JF1A 3FB6A 1JPGB 1KJMB 1RK1A 2K9UA 5SWSE 3DHMA 4XC3L 2A6KA 4HHAB 4OF5A 4ZS7H 4LLYB 1KPUB 1VADA 5D7SL 4U31A 5C09E 5JHDE 1RZ8B 4YHNA 3L3KB 3HC3H 4LVOB 2VXQL 1TMCB 4GW5B 4GFTB 4F7CA 2EC9T 1NSNL 3QIBD 4UQ2A 4DKDC 1S7RB 5HHNB 2ADJA 4F7EB 3K8MA 4X7SL 1R3HB 1K9TA 1FIGH 5HPMB 1BBDL 5E6IC 5IM7A 4Y5VB 1V7NH 4J23A 3HE7C 1A3LL 4NO0B 4RIRA 2IQAA 1Y6NR 5EZLA 5AUMA 1J0ZA 4OZFG 1NDMA 3V6BR 1QD0A 2I26N 2BSTB 2WUBH 5DZLA 5HYQB 3DYPA 5E8DH 5ANMB 5DJ6A 4H26A 2G9HB 1UB5B 1U3HD 1LMKA 5GGRB 1U8HA 1T3FA 3QAZB 4J1UB 4K9EH 2FO1A 1QFWH 4NZTH 5TE6H 5I66B 5E03A 4FXKA 4P2OA 5LG1A 4WFFE 3WCYA 3AM8A 1RURL 4OLXL 3VFMB 2B4CH 3LPGA 5I30H 3LEYL 4MQ7B 4NIKB 3A6CH 5GRJL 1NANI 4IRJB 1KTRL 4X6DB 3VXTA 5SWQB 1I1RA 1I4FA 3PXJA 3O6FC 1V3LA 1YYLL 3B6SB 4E9LA 1PG7H 5CEXA 4RMRA 1EJOH 3DX7B 3KPLA 2HKFH 3DMMC 3MLXL 2JB6A 1PGRB 2I07B 5L7XH 1NMAL 5I8EA 2AKRB 1DN2A 3OJDA 4PJDE 5C2UB 5FGSA 1GL4B 3IFNH 4G6KH 4JZOA 2KZWA 2X9XA 2DWEA 1T0PB 4E0RA 3QWRD 1VHPA 1A7OL 3FCTB 5GHWL 4P49A 3C60C 4Y1AE 2XWJB 2DI8A 1T0MA 2B2XH 3CVHA 2WBJB 3BHBA 1NBVH 4LSRH 3VFPA 1EVUA 43C9B 5BZWA 4LLVB 3WNNA 1F3JA 4U1IA 3NOIA 5F9DC 4F15C 1QBLH 5HI5D 2IBGA 4LSTL 4X0KA 2UYLB 4MHHI 1CLZL 1V7MH 2BRRL 3WE6B 4ZAKD 5C09D 5IEHA 3FO1A 4RWYL 5JHDD 1QPPA 1G0DA 2CRZA 2P49B 3GSOA 5T1LA 4U1MB 2Y07L 4KQ4H 1X5IA 4HJJH 2ICCA 5D2NE 5E99L 2SEBA 1JPSL 2IBZX 1RZJH 4JFDD 5LAXB 3B2VH 4XBGA 1R0AH 1I1AD 4PRNA 4KTYA 3KPQB 4U05A 4G6AD 5T5FH 2EICA 2XKUA 1PYWB 4KWUA 3SGJA 4OI8A 3MRJB 5J11C 4LSSL 4TSAL 1L9NA 5IQ7L 1N5AA 4ZUVB 4Q9RH 2D7PA 3GJEB 1JPGA 3OMZA 4PJGF 4L4TE 5DRWB 1Y6MR 4LLYA 1WUNT 1XGRB 2ZUTA 4YDKH 5BMFL 2IAMC 1IGYB 4WI7A 3VGAB 5HGDB 1RZ8A 4ISVB 3TLRA 3L3KA 2V2WB 3LKOB 1F11B 4GW5A 4DVRH 2KL6A 1UFUA 4R2GB 3EFDL 5IIEB 3BE1H 5L6YL 4DGYL 1S7RA 1IGJB 5HHNA 4GAJL 5JW4R 1MWAB 4F7EA 1B6DA 2GUOA 4TTDD 1Q8MA 4X4ZA 3VE0B 5HDQL 4XP4H 3N9GH 2IANE 1ZXQA 2DDQH 3LS4H 3WO4C 4Y5VA 4M8QB 3GBMH 4NO0A 2ZOLB 3DUSB 3ZTNH 2COQA 5EO9A 1P4LA 5SV3A 5FUOL 1EH9A 1KB5B 3RU8L 3H3KA 3BSZL 2BSTA 4RX4D 5HYQA 3ULUC 5ANMA 2VZ1A 2VC2L 5GZNC 4QHUB 1NL0H 1EEYB 4XBPB 4U1GB 1SEBB 2V5MA 3Q5OA 4UT7H 4K94L 5GGRA 1NAKL 4YHYB 4M6OH 3SJVB 4XNMB 5SWZE 4J1UA 2JJUA 4GMTH 3VXSE 5IW3A 5I66A 4Y1AD 1U6AL 3W2DH 3FB5A 2GTZB 4S1RH 1NQBA 2ESVE 3MX0A 3VFMA 4YBLB 2EKJA 3DV4A 4MQ7A 3HE7D 5AEAA 5ICYA 3VGFA 2VZOA 4IRJA 1OW0A 5SWQA 3WFHB 1QSVA 4ZFGL 3PQYE 4MD5B 2E7CA 1F4YH 3B6SA 4XX1G 4GRWF 4K71C 4QXTB 5B39G 2OZ4L 5JOFB 3DX7A 1ZSDA 4L8DA 3UEZA 3STZB 2I07A 4HFWB 1FFOB 1QKZH 2AKRA 1S5IH 3KXFE 3LV3B 3QFJD 1DBJH 1HOCB 1ZA6B 1TNNA 3QT2A 5ID1B 2X1WL 3FCTA 4QRSB 5MENE 1C7SA 2C1OA 1BQHB 4N5EC 1G6RH 5TE7H 2ZJSL 3LSOB 4YUEH 4HC1L 2WBJA 2VH5L 1J8HA 4PP1C 1XCTB 3R8BB 43C9A 4LLVA 3UPCA 1ADQH 4V2BA 3C5ZC 4NN7B 2OQJB 2UYLA 1UENA 3D3VE 3WE6A 5C86A 4Q9QH 2IQ9L 4N0YH 3GGWB 3BRDA 3TIEB 4G8IB 3TBWA 5A2FA 2DRUA 1CTNA 5D1QA 32C2B 5HHOB 3BH8B 5LAXA 3JZ7A 1L7TL 1SJXA 3SCMB 5HYFA 3RA7L 4G42B 3MJ6A 3KPQA 2IAND 1QP1A 1OP5K 2OTUB 1PYWA 4Z77B 4QXUL 2EE9A 1F3DH 3MRJA 2IMMA 4LSPH 1FSKC 4ZG1A 4QOKB 4ZUVA 2DMCA 3GJEA 2C1PB 3N1MC 3B5GA 1GHFL 3VRLE 5DRWA 3TBVB 3G04A 5CZVL 3K2MC 1I8KB 1EFQA 1IGYA 1W0WB 4U3CA 5HGDA 4ISVA 2ZP0T 2V2WA 3LKOA 1F11A 2CK2A 3VI3F 5FGCE 1TETH 2VWEE 4OLYH 5IIEA 5J9PB 1OGAD 3JXAA 3QUYD 1G9NL 1WC7B 3ALWA 3QB7C 4IRZL 4O2EB 5SWZD 1MNUL 1IGJA 1MWAA 1CE1L 5DC0A 4YHPB 3HAEG 2DL9A 3VE0A 5K59E 4KRPD 5D1ZC 2VYRE 1U3YA 4XPTL 4LP4A 1IQWH 4GG8B 1VEOA 2AJ3A 4FQHB 1A14H 1FNSH 2A6DB 4M8QA 4JEGB 1RIUL 1JWUB 3NCEB 1IC7L 2ZOLA 3DUSA 5DRNB 1FL3B 3PQYD 4HDIA 1U8QA 4Y8AA 5ACMA 5L2KB 5CIPA 3ZHDA 1YQ2A 4AEIH 1CDIA 1KB5A 2IAMD 1G9MH 3SDAC 2I24N 1CVSC 2C4FT 3KXFD 1Z2KA 3CXDH 1RY7B 2DQEL 3MJ9A 4OQ1A 5KSBF 1EEYA 2VZUA 4XBPA 4IRSC 5JIKA 4GAGL 4GOSA 4AM0B 1SEBA 2AEIT 4HIXH 1AE6L 2R15A 4XNMA 3F62A 3SJVA 2AJSL 4GRMB 1P4BL 1KJ3H 3DJ9A 3JWDC 1OAQL 1JGEA 2GTZA 3CLEL 1RZGB 4CMHB 5JHLL 3QPQD 1Q94B 2NTSP 3D85B 3RL1B 3ARVA 3D3VD 4XAKE 3VDAA 3WFHA 2A77H 4NNPL 3V2AR 3WFBH 3RDTB 1JNNL 2DMBA 4QXTA 4HXBH 4CW1A 1Q0XH 4APQD 5JOFA 1JZ8A 1KGCE 4LCWE 3STZA 3BVNB 4I3RH 4HFWA 1FFOA 3WIHL 3LCYA 1YECL 3LV3A 5CFHA 2DL2A 2R0WH 1HOCA 5MHSE 3TA3D 4PJAB 4R7DA 4YXKL 4QRSA 1DJSA 2AXHA 4NNYB 3FO0L 1BQHA 2CK0H 1NGWA 2XTLA 1MREH 4ZS6C 4ZSOB 3LSOA 1D9KC 3LIZH 1MJ7H 1XCTA 1U8IB 4UNUA 3QNYA 3E1F1 4JM2C 2OQJA 3B83A 5KZCB 5IKCB 1WFOA 3WLWC 4O5LL 2CO6B 3GGWA 3CK0H 4HULB 3TIEA 2W0FB 1RJLB 4G8IA 3O4LB 4K8RD 1DQDL 2VUYA 2ZUYA 32C2A 5HHOA 3BH8A 5HHME 3RJQB 3UO1L 5D7IB 5C2BH 4TUKH 1OTUD 3V6FB 2OTUA 5D7JB 4AEFA 5I76B 4Z77A 3G9VA 3QDME 4P3DB 2ICWJ 3CVIL 4QOKA 4ZNCD 1CIUA 2XZQH 3C5ZD 4NHUB 4PJBF 3V8CA 2C1PA 4MNHA 4D3CL 3MRBB 1FE8H 2W0KA 3VW3H 1SJEB 5KVGL 2O5XH 3TBVA 4F9PC 1FBIL 2X5PA 1I8KA 4GW4B 4PUBH 1X4ZA 5GGSB 3EHBD 1SBBA 1W0WA 3QBTB 2APBA 3ARBB 1AI1H 1PZ5B 1NGZB 4HWEH 4L5FL 3D39E 3PL6C 2AK4B 2IF7A 1WC7A 4O2EA 3NFSH 4LQFH 1IILE 4M5ZL 3QDJE 1ZHBA 1MIMH 4XVSL 4LDLB 2OL3B 1WIPA 2VMFA 1YNLH 5BV7C 2ED8A 1TJGL 2EIDA 4PJXE 4WY7L 5BZDB 2A6DA 5FFLA 1JWUA 5DRNA 4XAKD 3KLHD 1FL3A 5DK3A 5IT2L 5L2KA 5M94B 4W81A 4PY7A 3KYOB 3WDJA 3MJ7B 3O8XD 5IBTL 5C7XL 2MHAA 5J56B 3RGVA 1I7RB 3T0VA 1JVKA 4U2YA 5IB1B 1LO5A 5CS7A 5CD5D 2BNRD 4BZ2L 4HH9A 5MHSD 3SE8H 4L9LA 4GRMA 4BSVB 2HTKC 4YHLH 4C56E 5I8CA 4JFEB 2CMRL 2YA0A 2XRAL 5FHBH 1TZGH 3GSNA 2AXFA 5D1ZD 1RZGA 5CSZB 1P4IL 2VO5A 4XNXH 3MBXL 3DX6B 1Q94A 3QDGB 3D85A 4HCRL 3RL1A 3I50H 1A4JA 1X5AA 2PTTB 3HZVB 5EOCH 4HQQL 3K4ZA 2YHGA 3RDTA 1KTLA 1RMFL 4LHQB 1UWEL 4K8RH 2CPCA 4V1DD 2H1PH 4CVZA 4L8BA 1P84J 4MS8D 3LN5B 4G9FE 2OCFD 4OFKA 3CAFA 1B0RB 4ALAL 2X4UB 1U3ZA 1QBMH 5F6IB 1MCPH 3REVB 1Z5LB 4RMTA 2NXZB 1NCWH 4JR9L 4PJAA 3V4PH 3MLPA 3HMXA 1GYAA 1MRCH 2W9EH 4JB9H 4NNYA 4NQDD 3G5YB 2ERJC 4K3JH 5DVOA 4OT1L 3TVMB 4ZSOA 2F5BL 4EQ3A 3CXHK 5AZ2H 4LDOB 1U8IA 1WITA 4OZHF 5I0ZA 4RBPK 4CJ0A 2I25N 1XT5A 5IKCA 4G6JL 1NC4D 2CKBB 2LVCA 4QY8B 3KLDA 1G7QB 3NCMA 4OGXH 3DV6B 2PYEE 5EIQA 2W0FA 1RJLA 4K3DH 2CXGA 6FABH 3O4LA 4OD3H 5JZ7D 2C26A 4HAGA 3SKNB 3NAAL 2VN7A 4JQXC 2EDYA 3ELAT 1ITBB 3QEGL 3EW3B 1T7YA 2PR4H 2WW8A 5D7IA 4YHZL 4R3SA 4U0RB 4WGVB 3V6FA 1UWGL 1I3UA 4LP5A 5D7JA 5I76A 5IB5B 3D18B 4XPFL 2VDNL 3L9RB 5ENWA 4KKLC 4P3DA 3S88H 3IDNA 1ZVYA 3TPKA 4NHUA 3TYGH 3UYPA 3VU2A 4OV5B 4UTAH 2D7OA 1AR1D 1SJEA 1UH4A 4JG0H 1DVFC 2EDKA 4WV1C 3T4AB 4GW4A 3ARBA 3NCFB 1U3HB 5D9SB 1PZ5A 5DUPL 1KEMH 1MI5B 1NGZA 2QQKH 2ZNXA 2AK4A 3AMLA 3NPZB 4DKEL 4C56D 3EOTL 1FZMB 2YSSA 1RUAL 2CR6A 2VDQL 1YMMA 5BRZE 1HCFX 2D0GA 4MVBC 5C08A 2YPKB 1VGEL 2NY6D 1BHGA 2OL3A 5IF0B 3MRGB 5JOPD 2IGFL 4XT1C 3C8KB 3H9SD 5BZDA 5E8OB 1BQUA 1MCIA 3A67H 3V5HB 1P1ZB 2OI9B 1A6WL 1G6VK 2FGZA 4MZ3A 3O0RL 3KYOA 3LVEA 3O81A 1NFDE 3HTLX 4YGVB 6CGTA 1D5BB 3P11L 5I6XC 3MZTA 2AERT 3NACL 5D5MF 1I7RA 4JHZA 4ZO9A 2O61B 4G43B 4G9FD 3GMPB 4FQCL 1JYNA 5HYSB 1NFDF 3IDMA 2ZCHH 5E6YA 4BSVA 3FO9B 3AY4C 3LKNB 4JFEA 5DK0A 4LSVH 2BY0A 3C2SA 3IB4A 4JPKL 1VPOH 5FKAB 4OCYH 4YJZL 4WWKB 1I1FB 5CSZA 4BZ1H 4KPHL 5MP6H 1CFQB 4KUZL 1J7VR 4OUOA 3DX6A 3QJHB 3QDGA 1PSKH 4H20H 3HZYB 1UM6L 5CGYC 2PTTA 5EPMA 3HZVA 1T03H 3UTTD 4RDQF 5CINH 1AO7B 2PYED 1SY6H 1BD2B 1GAFL 4NN5B 4LVNC 3CCHB 3KGRA 4UILL 4J12A 2HFEB 2RR3A 5GGUB 1MFBL 3LN5A 3BDXA 4HGMA 4JN1L 1JNJA 1QR4A 3KJ4C 1B0RA 1I1AB 2X4UA 2UWEB 1ACZA 1G7MB 3REVA 1Z5LA 5D7LB 1CDBA 3GDBA 3QUZC 4CBPA 4BQBA 2YMXH 5DXWA 4HKBB 5HYJE 5EU7E 3MV8D 4Y4KD 4ZTPH 3T3PE 4LBEB 5TE4L 3EDKA 1I7ZB 1AXTH 1DLFH 4ZTOH 5CLTA 5C07A 4C4KT 5HVHB 2E6PA 1RUPL 1MWAL 2EC9U 4JCMA 3T3PF 4RMUA 5E94B 4PY8I 4IDJH 2CKBA 2HLFC 4X6CE 1TJIL 2V17L 1CGTA 1G7QA 1MCEA 3DV6A 5IBUB 1TFHA 2BRQA 4NQEA 1CXLA 1R3KB 4NQCB 4EI5D 3JWOH 2X05A 3SKNA 2RBLA 1A3QA 4OZGF 5C92A 1YEGH 3O2WL 2BXYA 1YEFL 4QHMB 3KYMA 5J7CC 1KB5L 2LU3A 4WFHD 1F00I 2FIKB 3BPNB 4KHTL 5HPOA 5IB5A 2CGRH 2EC8A 3FB7B 3L9RA 4M62L 3WN5C 2Q20A 1JF5A 4JKPH 1WTGT 1X6LA 5C6TH 1UG9A 2PTVA 3RVTC 4X4XA 5LCVH 5CGMA 5JXAL 3KPOB 4XBEH 2VZ3A 4POUB 4H88H 4KV5F 4NCC2 4DEPC 5D9SA 4M7ZC 4M9OA 1U91B 2YS4A 2Z8VC 1MI5A 3JBG7 1DLHB 1QBAA 2VDMH 4BK4A 2A38A 5D93C 1ONQB 4E41E 5A16A 1FZMA 1P9MA 1MFNA 4Z7UE 3HB3D 3N85H 2YPKA 5E6IB 2R56L 4EDWH 5IF0A 3MRGA 5K9JH 2BDNL 3HE7B 4HWBH 3C09C 3C8KA 4X9IA 2P8LA 3GNMH 5DZNA 5E8OA 4Z0BL 1GC1C 5DJCB 5T1KD 1JHLH 1ZLWK 1P1ZA 3CXHJ 1E4WL 1A7QH 4YGVA 1D5BA 1OTTD 4G7YH 2O61A 4G43A 4J3SA 1N59B 2FBJL 3GMPA 1DQML 1RVFL 3RAJH 2Z31C 2LTQC 2NW3B 3NABL 1SM3L 2C3GA 3MRIA 4FHBD 5HYSA 5I1KH 4TNVF 2EO9A 3FO9A 3MLRH 5HYJD 3LKNA 4N8VG 4CDHA 2J88H 1IFHH 2Y4SA 3EO9H 3FFCD 3L3OB 1FZKA 1T1WB 4Y0GA 4RRPG 4WWKA 2A1WH 1I1FA 1M7XA 1WIOA 4KRLB 4QRRB 2XZCH 1CFQA 3RWFB 4KK5C 3U1SH 2Z0BA 3QJHA 1MAJA 3E8UL 3VH8B 4RA3A 4JO1H 3HZYA 1T7XA 3O6FB 3DX9A 4Y2DD 1NCAL 2NY5L 5ILTL 5EH1A 2E6QA 2XFXB 4U7MA 5KOMC 1AP2B 1AO7A 35C8H 4OCSH 4LRIA 1BD2A 2E7LA 3CCHA 2HFEA 2Y23A 2ADIB 5GGUA 1MCSA 1UXSB 3PIQA 4EN3D 1RUMH 3M17B 4OUUB 3WJLC 2AQ3A 4OAWB 1I1AA 2UWEA 1KYOJ 2ZUUA 1G7MA 2A83B 5D7LA 3C60B 5E08H 1AHWC 4UB0L 2EDNA 4HKBA 1FRGL 4UTBL 4LBEA 1I7ZA 3S5LB 4F15B 4YGAB 3RVUD 5J06A 5F44A 4OFDA 4XXCC 1BQLH 4XAWH 5JIHA 2VXTH 2FIRT 1ZLVH 1T1ZA 2CKNA 3VFVB 3MLSH 2OTPA 2VLJE 5E94A 1CS6A 1DL7L 4POZC 4WEBL 1E6OH 2IPKB 4LGPB 4TOYH 1OGAB 1R3KA 3O6LL 4NQCA 4D9LH 8FABB 4YHML 2WP3T 3BP6B 4B0MM 1CQYA 5L0QC 5F7FA 2W1NA 4GRWB 5I8OL 3SDXF 1PD6A 3GJFH 5J11B 4MZ2A 2DQIL 3FB7A 1CD1B 5HVGB 2QQQA 4KK9D 2YD6A 3QO0B 3MLUH 5KSVB 1I8MB 1T7WA 1UACL 2IAMB 5F72S 4C59B 1PBYA 3ARGD 5JR1H 3KPOA 3GSNL 1DBML 1VKXB 3E6HB 1U91A 3MACH 1DLHA 4L1DA 5DMJB 3PP4H 5C0NC 2K7PA 1ONQA 2MJWA 3SDYL 1OF2B 2O5ZL 1PAMA 1FO0H 5DHVB 3FRPA 1OAZL 4N1EA 5E6IA 3WO4B 3RBSA 2EYTB 1U92A 3HE7A 5CILL 1D5XB 5DD3H 3X3GH 2YN5A 2JK5A 4WFEE 3U46A 2QSCH 4C58B 3HFML 1OAYH 1YEKL 3ORJA 4BKLB 5J1AB 1BP3B 4TSBH 3HMXL 4WJ5B 2XACC 1AGDB 2VLKE 1O5DT 5F3HB 4KHXL 1OP9A 3LEVL 1OARH 3QZWB 4XP6H 1BLNB 1N59A 3LHPH 4HPOL 1H9VA 1A6AB 3FAWA 2NW3A 4ACPA 3QXDB 1WGOA 1Y0LA 1FFRA 1DQLH 4XCCH 2I60L 3L3OA 2D31B 1DANT 1MCWM 5EBMB 2H45A 1GGCL 1T1WA 2AK1H 5FO9B 4XXDB 3NIDF 4RFNC 2AJZB 3ALPA 3EO0B 4QRRA 3RWFA 2WQ8A 2ZKHH 5HI4C 3VH8A 1RJZB 3O6FA 2HAZA 2DJSA 2HH0L 4ZUUA 4K71B 5TQ2L 1NCBH 1CQKA 1VFBB 2XFXA 3PHOB 1AP2A 3KPNB 3DMMA 4UIKL 4DKFL 3OXRB 3AC0A 5FYKL 4YDIL 3SY0B 1UEYA 1UXWB 3H9YA 3AS3A 2ADIA 3LRHA 4XH2B 1UXSA 4E5XB 3I2CH 3HNVL 4OTXH 1EAJA 2Z31D 3M17A 2YUZA 5IB2A 5EZJB 2AI0L 5C0BE 5HVWA 4JFFE 2A83A 5BS0D 1S9VB 3C60A 3MV7E 4MD4B 2GY7B 1FGNH 4PGEB 4ELKB 3S5LA 3C5ZB 2ZWLT 4Y16D 4NBYB 5KSBB 4NFBA 4NQTA 3RIFF 5J6HB 1EDQA 5E00B 5I15H 3SDCD 4EDXB 5KVEH 3VFVA 4ZXBC 4HJ0C 1LK3H 5F9OL 2ZCLH 4Y4HD 5D2NC 2J8UF 2B1AL 1MPAH 2IPKA 3CGTA 3QPXH 1OGAA 4KKCC 8FABA 1C5CH 4MJ6B 1KENH 1HSBB 4J4PD 4HUMB 4ZD3L 1AIFB 1CZ8L 1U41A 3FT4B 1A7NL 3WXWH 1IAKB 2PO6C 3ARED 5DD5L 5LXGL 3IAQA 2GCYA 4LMQI 5FM5M 3FQUB 4OZIE 4G80B 3TH2T 2WANA 2X4PB 1NGXB 1FSKB 2KH2B 3SGDH 5MEPB 1MCNA 3V7AE 1CD1A 2FJHB 1NGQH 4KUCF 1I8IA 3QO0A 3GIVB 4FQ2H 4WU5B 5CEZD 2IAMA 1N26A 5E70A 5IMMB 1ZEAL 3MMEB 4POZD 2VE6B 4XC1H 5E1HB 4HPYH 2D2OA 3B2UC 1LGVA 5IGXL 1VKXA 1LDSA 4FOMA 4RFOL 3E6HA 3X12B 1QRKA 5JW4N 4JRXA 1CLYL 3QDHA 2A73B 5D1ZB 4I18C 2YEZB 1JPTH 5DHVA 4HAFA 4UDTB 1MHPL 3LAFA 4U4BA 3CH1B 4N8PA 2X41A 5DJ0A 2EYTA 4XWOC 1BJ8A 1D5XA 1MCKA 2F15A 4PYGA 2A6JB 5ISZB 1ZVHA 3QO1B 3V4VH 1NKOA 4O02H 3PDOB 4PJ9C 5DYOB 3SDAB 3OPZH 4OIIH 1GPOH 5J1AA 4V1DB 4PTUB 4WJ5A 4R96B 1AGDA 2P5WD 3BIAX 1DBBH 5F3HA 2LABA 1RD6A 3LS5H 3QZWA 4OF7A 3T3ME 4DFIA 3LD8C 5I1HH 5T5NF 4IRSB 4MXQC 4QRUA 2ZPKL 3JTTB 1QVOB 1HIMH 2AV7B 1A6AA 1M6OB 2VDLL 4KY1H 2APXA 4JFFD 2H32B 2X4TB 3QXDA 4MA7H 4NQDB 1IC4L 1QSFE 3E0GA 2D31A 5EBMA 1F8TL 5EWIH 1JMZA 5FO9A 1OP5H 4XXDA 2AJZA 3MRMB 4U6TA 3EO0A 1X6NA 2DQGH 3TN0C 4PRAB 4QTIH 3UTZB 1I9IL 4MYWB 4PLJD 1RJZA 4JCLA 1U3JA 3NGBC 3B9KD 1PEWA 1CU4H 4KVCL 4YHKH 1CFSB 4XPHH 3UYOD 1D6VH 1Z9MA 1VFBA 1HI6A 3PHOA 3KPNA 2OYPA 2NY0D 2WWKT 3BP7B 5DLML 1UXWA 2J4WH 4FZ8H 4XH2A 4KKNA 1NLDL 4CRPA 2VQTA 1DN0A 3X3FL 2VSCA 4KUCD 5EZJA 7FABH 3RWJB 5C9KA 3WIFB 1S9VA 2QSQA 2BJMH 1ZOXA 5AWNH 3MLVL 4P46D 2VQUA 2ZOKB 3H42H 1NAMB 2VOTA 1KCUL 1A6ZA 3FN9A 4MD4A 2EDFA 4WDIA 5HD8D 4PGEA 4DTGL 4ELKA 4YK4C 3VXNB 3C5ZA 4H8WL 5CEZH 2WNGA 4JM2B 3WFCL 2GY5A 5J6HA 5E00A 3FN0H 5E9DD 5E5UB 1O7VA 4EDXA 3SKJL 5GS2D 4NO2B 1KXVC 1H0DB 2EEDA 1JYWA 4KZDL 3QRFM 4WRLA 5F6HI 4JM4H 4LEOB 3IU4L 4CUCA 4MJ6A 1HSBA 1FZOB 1AIFA 4OLWH 1PKOA 5TFSL 3FT4A 4O2CB 4YXHL 1IAKA 1A02N 4M5YH 2NY6B 3BN3B 4PJHF 3W9DB 1MAKA 1S7XB 3RIAF 4G80A 2NY4C 2X4PA 3SE4C 4MJIE 1NGXA 1CTOA 1N5YH 5MEPA 3MXWL 4FQ1L 3KHQA 4Z7OE 2EH7L 5EFIB 3MRHB 1N8ZA 4FQXD 1R6VA 3TEUA 3GIVA 1IMHC 3DHJA 3P40A 1ND0B 2NXYD 2H2SC 4N8CH 5FYJD 5F7MC 3SQOL 1T6VN 3I6LE 1T7ZA 5IMMA 3MMEA 2VE6A 2D0FA 4Z7OF 3DXAD 3S3PA 2B7DT 4PJ5B 3RGHA 3DTXA 3PL6B 3ZYZA 4BFIB 3RX8A 4KKCD 2HA1A 3X12A 3BESR 4OD1L 4OZHB 1UC6A 4TPRL 5DFWH 3NH7H 5F7NC 2A73A 5D1ZA 3ARZA 4OKDA 5ADPH 2GK0A 5BV7B 4UDTA 1LNUB 1YJDL 4YDVB 5D1XD 4JPVH 1CGVA 5ISZA 2A6JA 3WL9B 3BRGC 4M48L 4LRNH 3JV4B 5BVJB 1GZPA 2B39A 3QO1A 3UTTB 3PDOA 4PBXA 5DYOA 3SDAA 4Z5RB 4V1DA 3BKYH 3V4UL 4R96A 4FQJH 4TNWF 4Q0XL 4Z95L 4JVUA 5DS8B 3EGSB 4IRSA 4H1LH 5B4MD 4XPBL 2BVEA 4LK4A 3JTTA 1QVOA 2AV7A 5EZIH 1ZAGA 1M6OA 3MROB 5T3XL 4S10A 1Q0YH 4KMLB 3R8QA 1UEMA 2H32A 2X4TA 2MMXA 3B5TA 2X09A 1GIGH 5DGQA 2KUTA 4KAQH 4NQDA 3MV8B 4Y4KB 3VXUE 5I1EH 3TWCL 3GSQB 5DEFB 3IAPA 4R9HA 4KKAC 1HXYB 4P3CH 3CFBB 3L1OH 4PRAA 4XNUH 1SMAA 3OKLA 4I48B 2ATKB 4PJ7F 1DBAL 1QSEE 3INUH 3JV5A 3H3BC 4NP4H 1CFSA 5D71H 2F8OA 1XIWD 1QPXA 2FJGB 1CDHA 4JVPA 3QUMA 4MXQD 4NDMB 2HT4C 2ENSA 4FFZL 1WZ1L 3HG1E 2R0ZL 4JDVA 3VI4E 4NKIH 2J1KA 3S34L 3BPCB 3RWJA 3WIFA 1FYTE 2ERJB 2BNQD 4OFVA 4TSCL 4X80L 2RAMA 3ZKND 1D9KA 5GQBA 5D5MB 1NAMA 3FQTB 4GMSH 3ARFC 3Q0HA 3VXNA 5ICXB 4JM2A 4HFUL 4NGHL 5FYJH 4B53A 3PV6B 1KB9J 3BMVA 4NO2A 4Q6YA 1CL7H 1IZJA 1H0DA 4XB7A 4R7NB 2IG2L 4HXAL 1U8PB 3HRPA 5L88L 1EGJH 2FD6L 4K3GA 2BC4B 4LEOA 4WU7B 5H94B 2NPLX 4UINH 1FZOA 1NCUA 4XPAL 3H3PH 3GMNB 4O2CA 5GJTL 1HQ4B 2WLZA 1KN4L 2GAZA 1Y18B 3W9DA 1S7XA 2DD8L 2JIXD 1U8NA 4OGYL 4PD4K 1FL6B 4W6XB 1WJ3A 4GLRH 5EFIA 3MRHA 3QHZL 1DVFB 5IK3B 4WUUE 4F9PA 3CFCL 4WV1B 4ZOEA 1W72H 2Y6SC 1A7RL 4PV8A 2R2BB 1RZ7L 5I2IB 5I19L 3DO7B 2DM2A 3LKPB 4BM7A 1BGXH 4PJ5A 3PL6A 3I6GB 3EYOB 4BFIA 3QFDB 1Q9OB 3BP5B 1L9MA 4OI9A 4F37K 4P5TC 3OKNB 4OZHA 5C0CD 4ZFOL 4EI6B 5FO8B 3VXUD 4HZAA 1RHFA 9CGTA 1YNKH 2UZYB 5J12B 4JQVC 5A40E 4YHIB 3WNLA 1CFBA 3X13B 1LNUA 4Y2OA 1J88A 4YDVA 3SKOB 2VXSH 4JVWA 5K93A 2Z4QB 3VXRD 5D2LF 1ES0A 1IZKA 3AGVA 4K94C 3WL9A 4M7JL 1C1EL 3JV4A 5BVJA 4XP9L 4NFDA 1SHMA 3PWPE 4NHCL 1ZLUH 4MNGE 3DPBA 3GIZH 4Z5RA 2E27L 2XG5A 3MLZH 4M02A 1NCDL 2VLLB 2R1YB 3RBGA 3DGCR 5GGSY 5DS8A 5HHXL 3WMSA 5HVFB 1DP0A 3EGSA 3KYAA 1LO3H 2HVJB 5T3ZL 3MROA 4G7VH 3VFUB 5KTEL 1F4WH 5LGHL 1QBBA 4AIOA 2XIDA 1FYTD 4OCLC 2NQCA 5DD0H 5GSRA 3ZE2E 4F57H 3MV8A 3OAUL 5CZXD 4NBZB 5DEFA 5TH2B 4XVTH 3T08A 1VCAA 3RPIB 5F70A 2V5TA 4G8GD 3UJIL 1HXYA 3CFBA 3KPTA 1MFAL 2E9WA 1OQXA 4AMKL 2FYYB 1BM3L 5D7KD 3KPSA 4I48A 5E2VH 2ATKA 4QRPB 1D5IH 5A2IH 4TYUA 3K2UL 5A43C 3VFRB 1FLTX 5I18L 2DQTH 2EIZB 2FJGA 1SVZA 2PNDA 5KVFH 1UWXK 4QXGL 1KEGH 1JF6A 3WNMA 3OG4B 4Q74A 4HUKB 1QLFB 3NCJL 2A6IB 1WWCA 4WW1B 4UU9B 3QUZB 5CJXC 1ZWIA 1Q9WB 3BPCA 4FS0A 3QRGL 2NYYD 5F93C 1YUHB 4OB5L 4Y5YB 5F7EH 3TH4T 3DSFH 5D72H 3FQTA 3TJEH 3GKWH 1IAII 1IGIL 3ULVC 4M1GH 1EUTA 5CWSB 5ICXA 4WUUD 3DURA 3K4DA 4QHKI 2IBZY 3PV6A 4J6RL 3MUZ1 4EOWH 4RAVB 2E7HA 2H9GB 4UQ3B 4N0FA 4XGZB 4XHJC 1KOAA 3Q6GH 5GISL 5TQ0H 5KJRH 4ZOBA 1JGUL 1U8PA 2ORBL 2L0DA 2HT4D 4XC3H 4JQXA 4TVPL 4WU7A 3BD3A 4S1QL 4S1SL 5H94A 3KYNB 5D7SH 5HI3C 4X9FA 1BBJB 4OCXL 2G2RB 5IHUH 3VMPA 3GMNA 2EECA 3ULUL 1HQ4A 2MOVA 1NSNH 2F5AL 1Y18A 3OR7B 2FEEI 3K0WA 5I74C 3ZE1F 5DMGC 5EU6E 1TPXB 4C55A 5CJOL 4PJEF 4CVWA 3N1GC 2P48B 1WZMA 1IBGL 4NRZB 3C9NA 1WEJH 3EBAA 1DVFA 3TFKD 1BBDH 2VLRE 5IK3A 5I73C 4WV1A 1YDPB 2VDRH 1ZHNA 2R2BA 2WUCL 5I2IA 3DO7A 3KJ6H 4U49A 4DEPB 1A3LH 3LKPA 4M7ZB 3ARDD 5IVXB 1S7WA 3BIKB 3QQ3B 4I0PD 3I6GA 3EYOA 3KVQA 5ERWB 3QFDA 2ID5A 5DDHB 1Q9OA 4NZRL 3BP5A 5GGQH 5BXFB 5C0IB 5ICZA 3OKNA 4EI6A 3RWIB 5FO8A 3QR2A 4YHIA 4KU1A 3C09B 1I85C 4N0RA 3V0WL 3SKOA 2BNUB 2Z4QA 1NUDA 3GRWH 5CBAA 2W59A 1RURH 3D9AH 4OLXH 3ETBF 3QWQB 4OF6A 1JV5A 3WJJC 3BD4A 2VLLA 2R1YA 4ZUSB 4JRYD 4PJCB 1AH1A 2Z31B 2LTQB 2HVJA 5GSVB 2ZUSA 1RZKL 4LGSB 5BS0B 3VFUA 3AY4A 1WCQA 3K3QA 4MXWL 4NM8H 1TTUA 2P8PB 3PGFL 1WBYB 1NMAH 4U6HB 2EDBA 4RDQG 4ZQKB 4I2XB 3QQ4A 3M8OL 4D9RE 3RPIA 2Q8AL 5F97E 2AP2A 4YFLF 1A7OH 3RHWK 1CDCA 5GHWH 3WBDA 2FYYA 4J7RA 4J8RB 2NY1D 5BO1L 3RVXD 3BT2L 5LWYH 3OJMB 4QRPA 3K1DA 2F19L 1LP9E 2FX8L 4Y19D 2Q1EA 3JVGC 3VFRA 2EIZA 1T20A 4LPXA 4O00A 5KS9E 1OAUL 5I8KL 1CLZH 2BRRH 3DVNA 4RWYH 1QLFA 3MYJB 4GXUN 2B1HH 4WW1A 1AHWB 2Y07H 4ZO7A 4UU9A 3QUZA 3FKUS 1MCCA 1Q9WA 5EU7C 5E99H 1TVBB 3WUZA 4LPCA 3HNTL 5DJYB 1YUHA 3EYQC 4NQVB 1SYVA 3X11B 3O2VL 3QIUC 2VLRD 4FFYL 5CWSA 3PE9A 3T65B 4ENED 4BH7B 5JA8B 5E0QA 3F8UB 1BJMA 1UZ8A 4RAVA 4UQ3A 4LSSH 4XGZA 5B38G 4DQOL 5IQ7H 5A3IC 2YPLD 3LKQB 1D3CA 2W0PA 4CKVX 3G6JE 3MCKB 5AYQA 4XZUB 3V5KB 4CN6A 5BMFH 3L3HB 1BBJA 2CLZB 5L0QB 2F54B 4M4PA 2G2RA 2EDTA 3VXOA 2J12B 3IJHB 3BKML 1DBKL 1L0XA 1JRHI 4IJ3C 1ZA3B 5D70L 3OR7A 5L6YH 3WN5A 3SKMA 4DGYH 4JDZB 2MPAL 4GAJH 3TESA 4DW2L 3S36L 1PX3A 1GGUA 2XYCA 3REWB 4CU7A 5DFTA 3LB6C 2CRMA 5F1OB 1I7UA 3JWDL 1YDPA 1MJUL 3V0VB 2P5WB 1TQBC 4XHJD 4U33A 3TM6A 5HTSA 2QHLA 2IFGA 3G5ZB 5IVXA 3BIKA 3ZYIA 5HSFA 4RWHA 3QQ3A 3TO4C 2J6EL 3QCVL 3O9WC 5FUOH 5ERWA 1DANU 4MAYD 3D0LB 4WI2A 1Z9OA 5HI3D 3RU8H 3BSZH 5BXFA 3QH3B 1TTFA 1IGML 3RWIA 2DYPB 1Z0NA 4NKQB 3RWDB 2DQUL 2AQ1A 2J8UB 5E4IA 1IARB 2CDEB 5DMGD 3C6LC 1NAKH 3QUML 2GEEA 5EORL 4TN9A 2PW1A 3AXLB 2BNUA 4FNLL 3B9KB 3WFDL 1NH6A 1U6AH 1ZHKB 1FZJB 3P4NA 2BERA 4LASL 5I1IH 1OSPL 2EE6A 4XNZC 5DT1L 5I1AB 1XGPB 5E6ZA 4XP1L 4A6YH 1NAML 4ZUSA 1YY9D 1K6QL 1ZS8B 3QEUB 3D69A 4PJCA 2Z31A 4ZFGH 1EJ6A 1RU9L 2CD0A 3AAZB 1X4YA 2OZ4H 5BS0A 3FQNB 2F74B 4P46B 5DMIL 2P8PA 4JKLA 4U6HA 1J11A 3LZFL 4RFNB 4ZO6A 4ZQKA 1JI1A 4I2XA 5FUCE 2P8MB 2DM3A 4OM0L 3RUGA 4KKBC 5E9DB 3MTRA 1MSPA 1ZTXH 2BSRB 1HE7A 3UDWC 5IMLA 4J8RA 3ZHKA 2IPTL 2ZJSH 2F53E 4PJDB 4HC1H 3QXTA 2VH5H 2YWYA 4FQIL 4YZFE 3BP4B 5AG8A 5K9OB 1NCCL 1KC5L 4HV8B 5KVDL 1JE6A 4P2RD 4OLZL 4UT6L 3I85A 3RKDC 3WJLA 1KCVH 5AAMA 1CGYA 1IEBB 5IV2B 1QYGL 4AG4L 1YEEL 4GAFB 3MYJA 4YZFF 4U6VL 1AHWA 1D5ZB 2Q3AA 1E6JL 1TVBA 3T0BA 3HE6C 3OKMB 3MUGB 5DJYA 4X7TB 2ED7A 3QIWC 4NQVA 4KK6D 3LQAH 1L7TH 4QO1A 3PWVB 1MRDH 1LO2L 3RA7H 3X11A 3IRZA 3QEQE 4XXCA 4LPTA 2YWZA 1SYSB 3T65A 4BH7A 1MELA 3KPRB 2DBLL 4QXUH 4KMTL 3BGMB 4RISL 5GS0H 3MBEC 2W07A 2W0LA 2NNAB 4HIIB 3LKQA 5FYLE 1G7IB 1BWMA 4K7PL 2QHRL 3MCKA 4ELME 3DVGB 4NOFA 4XZUA 3V5KA 3L3HA 2RB8A 2CLZA 2F54A 5GS3A 2PO6B 1ZKAA 3IJHA 2BY1A 5GZOD 1WWAX 3BDYH 1JGVL 3I02B 1ZA3A 1BJ1J 2IH3B 3NTCL 3VJ6B 2E6JA 5C0JB 5SWSA 3I9GH 1G9NH 4L4TB 4JDZA 5IFAH 4TVSa 1MNUH 5C70A 2YD9A 1A4KB 5CUSL 5JUEL 3UMTA 1IL1B 1J1XH 1CE1H 3ALXA 5C3LD 3EDDA 3REWA 2X89A 3W0WE 2CDFA 3VRIB 4XPTH 5HGAB 1CWVA 1DUZA 1WTLA 4XX1E 3PXHA 3V0VA 2P5WA 3VFGH 3U0WL 4LPUA 1P7KB 1CGXA 1RIUH 5F7YC 2HRPH 3B8SA 4KZEL 2YUXA 1H3UA 2VL5B 5DUML 2Z93A 3D6GA 1TQCC 2LVEA 3D0LA 4RMQA 4HBCH 2A0LD 3QH3A 1UT9A 4NC1E 3OX8B 2FBOJ 2DYPA 4DUVA 2DQEH 3RWDA 1EEUA 1EPFA 2J8UA 1F13A 4K7FB 4GAGH 2CDEA 3PDGA 2NX5B 2BVTA 1M4KA 1AE6H 2AJSH 1P4BH 4MWFB 4AK1A 1CFTB 3QG6B 3AXLA 4U1KB 1S9XB 2YPVL 4PJ9B 5FCUL 5HDOA 1ZHKA 1OAQH 2AEWA 3CLEH 4ODTH 1A5FL 5JHLH 5I1AA 3LD8B 3MR9B 4XVJL 5ANME 3U4AA 3X14B 4G6FD 5CHNB 1EEQA 1ZS8A 3QEUA 4KDWA 3TO4D 4GKSB 4WUKH 3BQUC 4NNPH 4KH2A 3AAZA 1JNNH 4MXVE 3QI9C 1J87A 2VDOL 2F74A 4LOUD 4S1DD 2HTLC 3WIHH 1RHHB 4D0CA 5EZOL 4BUGA 3TN0B 3HI1B 3QUXC 3O4OC 2P8MA 5HGGS 3BZ4B 4S0SD 3U4EB 5E9DA 4TQEL 4X6DE 2BSRA 4YXKH 4Q9CA 1FPTL 1LO4L 3FO0H 3WNPA 1L0YA 4DAGL 1G84A 1ZT1B 4GXVL 5T1LD 5GRWA 4PJDA 4GKOA 1RUQL 4P2CG 5T1DL 1X9QA 3VGBA 3HI6H 3BP4A 3DI2B 3DECA 3FQXB 3EDFA 2EDDA 5EC2A 4FQPA 3UYRL 5EU5B 5I1CL 1F90L 2GHWB 1KTKE 3L3DB 5IV2A 5MENB 4O5LH 1HWGB 3WFEL 4ORGB 4OCWL 1YN7B 3UC0L 3VFNB 2FL5B 2JIXB 2NY7H 1DQDH 3MUGA 4X7TA 4YK4B 4R4FL 1MEXL 5IHLB 1Q9LB 1UGNA 3OF6A 2JCCF 3PWVA 1ULVA 3UO1H 1FGVL 1EHNA 4XVUC 1SYSA 4ZXBA 4IOSD 3KPRA 4IOFC 4AJ0A 5D2NA 3BGMA 4CL7A 3ZT7A 3CVIH 4HT1L 1H5BC 2DQFB 2NNAA 4ZFZB 2HT2C 4JAMB 4N90E 4DVBB 4HIIA 3LMJL 3F12A 4D3CH 1TXKA 5J1TC 1DZBA 1G7IA 5KVGH 4F7PB 3TPUA 1FBIH 5C0CB 3DVGA 3P9LB 3CC5B 15C8L 4H1LG 1MHEB 3C2AH 5FGRA 3T0XA 4WFGE 5FM4A 3GUTB 4PJ7B 2PO6A 4X9BA 5MERA 2NY4B 5ECJE 3I02A 4L5FH 2IH3A 1AQDB 3VJ6A 5C0JA 3V7AG 3VXRB 4L4TA 3WHXB 4DZ8A 2OR7A 4M5ZH 4NO0D 3TCLA 1A4KA 2VSDA 1IL1A 1IGCH 4XVSH 2YD1A 4WTZA 3VRIA 2UY7A 5DQDL 5HGAA 8CGTA 4KFZC 3BDBA 4FFWC 1TJGH 4WY7H 1P7KA 2P44B 2R4SH 2VL5A 1DR9A 1A9BB 1TENA 5C7XH 4I18A 3WDIA 3CVHH 3SO3C 3U7YH 5DO2C 5GGVY 1GOGA 3E2HC 3HC3L 1ZANL 4K7FA 1JNHB 4HIJA 5E1AB 4BZ2H 4U1JB 3VRJB 5JXEC 2NX5A 3BN9D 1A47A 2GJ6B 3MLTB 4KJQD 3O2DA 1X5HA 4IRJD 5EA0H 4MWFA 1CFTA 2IJ0C 4U1KA 1DCLA 5J3HD 1S9XA 4PJ9A 2XRAH 3EOYG 4LCCC 3P0VL 4X9HA 2EIBA 1KTDB 1P4IH 5FYLH 1VGKB 2D7QA 3I3DA 3QXUA 1CYGA 3MR9A 3X14A 1S78C 3SGEH 5CHNA 5E8NA 3C5SB 4O58H 4Q6IC 4GKSA 3TBTA 4HQQH 5IQ9B 1VACB 2KPNA 1RMFH 1UWEH 2HP4A 3SJVE 4W6WB 4KVNL 4DCQB 3E3QE 2XY2A 2WIIB 2VISB 3L7EB 2BY2A 3C8HA 1YA5A 4CNIA 1WBZB 1P6FA 1RHHA 3UTPD 1SJVA 4BA8A 1A1OA 1J8HD 3HI1A 3TN0A 4ALAH 3BZ4A 3KWWB 3NN8B 3CFJB 1A1NB 3U4EA 4GW1B 4JR9H 5IWLC 3GO1L 1R5IB 3ULSB 3ZDXF 2F5BH 1DDHB 2NZIA 5I30L 3FQRB 2ZCKH 1P2CB 3RWCB 2BMKA 1IAIL 4NM4L 4PRHB 5D1QD 5EU5A 1ZK9A 4G6JH 4WFGD 3L3DA 4LVHC 5MENA 2J8HA 1BF8A 4H0GA 4ORGA 3BJ91 3EZ8A 5ACLA 1EX0A 1PG7L 4JFHE 1YN7A 1NUFA 3VFNA 2FL5A 2JIXA 1EJOL 4ORZC 2C3XA 5JDSA 2FX7L 3ARFB 2XTJC 3NAAH 3GSWB 3WV0A 3BIBX 2RCSH 1AD0A 2MWCA 1Q9LA 5TF0A 3NZ8B 5C1MB 3QEGH 3NZHH 4MNQB 4G6KL 4YHZH 2C9AA 2DKSA 3UBXB 1X5FA 1UWGH 4PJ8C 12E8H 4XPFH 2VDNH 4LF3B 4P9HC 3ZKMC 2DQFA 4FRWA 5HHMB 1QFOA 4JAMA 4I0PB 1C5DB 4ONHB 1NBVL 4DVBA 4R2GD 4PRPE 1GC1L 4F7PA 5DC9B 5HHOE 5C0CA 3P9LA 3BYTA 3CC5A 2Q6WB 1MHEA 3MRDB 1FG2A 2Z8WC 4PJ7A 3MODL 3SHSA 4DGVH 1INQB 4P5KB 1F4XH 1RFDL 1AXIB 3SE4A 4FTVB 2YBRA 4JJ5B 5JIPA 4KQ4L 4KI5E 2CJUH 1AQDA 5E24E 3VXRA 3WHXA 3EOTH 2CRIA 1XGQB 5F7UA 1EAPB 2DQJL 5D8JL 4AH2B 5B3JF 4KJPD 1VA9A 1LILA 2D03L 1VGEH 3HPJB 1JI2A 4P2QE 5H35B 2VXVL 3RZCC 4JY5L 1HH6B 2IGFH 2J5LC 3HUJF 3QNZA 4JRYB 2BOCB 1A6WH 3QDJB 4QWWC 4LLWB 3MFFB 5FOJA 4P5TB 3O0RH 3X17A 3SJVD 4M1CD 3P11H 3OTTA 3O3EA 3FO2B 1G7JB 4FQCH 2IC2A 2NY2C 2R1XA 4NSKA 1JNHA 5E1AA 5E2WH 5TF1L 4U1JA 3VRJA 4DVRL 7CGTA 25C8H 2HLAB 3WUWA 2GJ6A 1IT9L 1FAIL 4YQXL 1U58B 1CT8B 2NY1B 4JPKH 4Z7VE 2HMIC 5L2KE 1UQSB 1ZGLM 1EMTH 1KTDA 3RL2B 3RNQA 4KPHH 4LPWA 1HQRB 1VGKA 2VNCA 4OFYA 4KUZH 2XKSA 2DDQL 2QADC 3MRFB 3LS4L 2R2CA 2P4AB 1UM6H 2W92A 3C5SA 2AJXL 5JW4M 3D2UB 4LPVA 2A74A 4KRNA 5IQ9A 2YXMA 1VACA 3BZDA 1IC5L 1ZVSB 4DCQA 4UILH 2WIIA 3FN3A 4EXPX 2VISA 3L7EA 4M7KL 4JO4H 5JPNB 1MFBH 3T09A 3LKSB 5E4EC 4JN1H 3PP3H 3NN8A 3CFJA 1INEH 3SQBA 1A1NA 4K7PY 3O11A 4UT7L 4MLSA 4M6OL 4PPTA 4PY8J 3ULSA 2EYRA 1FN4B 4YE4L 5TE4H 3W2DL 1DDHA 2RFXB 3TNMB 4S1RL 2YPLB 4JO2H 2JKXA 1NEZG 2HJLB 3FQRA 1G0XA 1P2CA 3RWCA 4C57C 4PRHA 1H15B 1MWAH 1RUPH 5HHOD 4OLUH 3RI5F 2V17H 1A6TB 5HHQB 1BVZA 4KI5D 4PJAE 5IHZB 1AGCB 4PLOB 1QFWM 4JFPB 2FDBP 3GMRB 3ARFA 1MFDL 3GSWA 3ME0A 2EH8L 2OR9L 3IVKB 4ZUTB 5IJKC 3O2WH 4QOKD 5CIPH 1NCTA 3W11C 3NA9H 4MNQA 1KB5H 1ZV5A 5JW3L 1NGPL 2QJDA 4KHTH 1JRHL 4M62H 3QULB 4LF3A 4NWTL 3MJ9H 3VG9C 2VQ1B 3TT3L 3OB8A 4R4ND 4YUEL 2D7NA 3VD4A 3O4LE 4IM8A 4ONHA 4MCYB 2MSPA 1ADQL 1CXIA 4U1NB 3WFZA 5JXAH 1FP5A 3GSRA 3PDDA 2Q6WA 2R0KL 5CGTA 3RX7A 5TDNB 4RMWA 5I74B 1INQA 3F58L 4FTVA 3JV6B 3GBLA 2XTJD 1MH5B 2XA8L 3RY5A 2KQNA 4EIGB 5TGBB 1U8JA 1XGQA 4LSDA 3K7UA 5D7IF 4AH2A 5I73B 3MV11 5L2KD 5I17B 1KN2L 4PJ8D 1EIBA 2R56H 3HPJA 3DETC 4KGJA 1AFVL 2AJUH 5EN2B 5H35A 2BDNH 3RGVD 1OTSC 3D39A 3EOAB 2BCKB 2BOCA 4Z0BH 3C5JA 1IM9D 3QDJA 4LSPL 1Y6KR 1UWXH 1E4WH 3BWUC 4L9DA 4LLWA 4P5TA 1YNTB 1NFIB 5ALCL 5FUZH 3PWLB 2N4IA 4S11A 1RSFA 4JQVA 5GGTA 2BHZA 1G7JA 2FBJH 1MCQA 3OKOB 1QNZL 1HN1A 4ODHH 1RVFH 2K1MA 3EJYC 4XI5C 1J5OL 3NABH 3ZKXC 1W0YT 1AD9B 1TETL 2JB5L 1MHHB 2HLAA 3D85D 4Z7QE 3U0TB 2V5YA 2FJFB 4YLQT 3UZVB 3K8LA 1UQSA 3MOAL 3RDTD 5DJAB 3IDXH 4JHWH 1FLRL 3DX8B 4NYLB 3V5DB 3ES6A 3E8UH 3DLQR 4P2RB 3MRFA 4RGMC 4D94A 1FCCA 4XWGH 3HI5H 1NCAH 2NY5H 3D2UA 5ILTH 4D8PB 2EZ0C 1G7HB 2GTWB 1XGYH 4WCYL 5CBEB 5IW6B 1ZVSA 1B88A 1BQSA 1JN6B 2AQ2A 2VKXA 2DLTA 3PG2A 3QQ9C 5JPNA 3AB0C 3BAEL 3RFZC 3LKSA 3IDUA 4L3AA 1JF1B 1RK1B 2CUIA 1L7IL 2X4RB 2UVFA 4HIXL 4UB0H 5DJZB 5KZCD 1CFVH 3MRRB 3SKUD 4HLJA 4ONFL 2HMID 1FRGH 4UTBH 2MCPL 4YHNB 1WLHA 1FN4A 1KJ3L 2RFXA 3TNMA 3ZDYF 3K74B 3O4LD 3I75A 3OKKB 4FMFA 2HJLA 4PJIB 5ADOH 2WK2A 3SGKC 1H15A 2ADJB 5FHAH 5J1SC 2C3VB 5CMAB 5CJXA 1DL7H 1OM3H 2MNUA 4WEBH 4MDJB 3WFBL 5HHQA 4LSQL 5IHZA 5D7JD 1AGCA 1Q0XL 3O6LH 4JFPA 3ZLQC 5FYKD 1YN6A 3GMRA 1K85A 4I3RL 2WZPD 4ZUTA 3QIUB 5DQ9A 2X4OB 1MCRA 5AUMB 4X6CB 2EXYC 5I8OH 2FSEA 3CMOH 1N64L 5F8RC 2DQIH 2UVEA 4F3FB 4H0HB 2CK0L 2VQ1A 3ARBD 1HKLH 4OGAD 2R9HC 4B7IA 4MCYA 2AK4D 3ESUF 2B20A 4U1NA 4PBVC 3GSNH 4YDJA 1DBMH 4X4ME 3U48A 1YMMD 4IJ3B 3U0PB 5FA4B 5C08D 1FNGB 5TDNA 1BJ1H 5EOQH 3IS0X 4WNQB 1K4DB 1SMOA 2YD2A 5TGBA 2O5ZH 4JY4A 1I4FB 3OB0H 4PG2C 1CE6B 1Z3GH 1OAZH 5I17A 1BF2A 1TQBB 3KPLB 4ETYA 5EN2A 2X4SA 5CILH 5I8EB 1UZ6E 4JFZH 1OAKH 2BCKA 3EOAA 4RAHA 3TO4B 3O9WB 3HFMH 1KSRA 1YEKH 4HWNA 1CD9B 4MLIA 1S7TB 1TJHL 3W39B 2DWEB 1B4JL 3TJHD 1FQ9C 1YNTA 3HMXH 1NFIA 3PWLA 1ACYL 3VW3L 3LEVH 4OSUH 1T83C 4JFED 2O5XL 2RGSA 4FABL 1T0MB 4HPOH 3EUUA 1I85A 3C6LB 5HJ3B 3OKOA 2VR4A 5BZWB 4G8EB 4JPIA 4U1IB 5DWUL 4KQ3H 2ICWI 3SGDI 1AD9A 1A8JH 3QDGD 1MHHA 1JTOA 2FH8A 1LEKA 3ILQC 3U0TA 2FJFA 3W82A 2I60H 3FO1B 2YRPA 1GGCH 4XNZB 1A6PA 3GSXB 3BUTA 1MIML 3WJJA 3UAJC 5DJAA 2VRAA 4R6UA 2AJVL 5IW1B 3ARYA 4MA3A 3DX8A 4NYLA 3QJFB 3V5DA 2V9QA 4P2RA 4B41A 4TUOA 3BZFB 2HH0H 1YPZE 5TQ2H 4D8PA 1N7ML 2HN7B 2K7QA 1UH2A 2GTWA 5CBEA 2EDRA 3MLYL 4UIKH 5IW6A 4Q58C 2ZUQC 2NXZD 5FYKH 2EDQA 4YDIH 1JN6A 1YC7A 5IOPB 5DMYA 3SDDC 2AI0H 3HZKA 5EC1A 5C07D 3P0GB 4FFVD 4HSQA 4LCYB 3MCLL 2X4RA 5DJZA 3MRRA 3UXFA 5ETUB 1CCZA 3BOVA 3JVGA 1AO7E 5D96C 3WXVH 4JHAL 3S98A 3OKKA 4FXLA 4NQED 4P4RB 4HX1B 4PJIA 3T4YB 1I8LC 3BH9B 4JFDE 3I50L 4ODSH 2C3VA 2GUOB 5CMAA 3QA3A 3AS2A 2OL3H 4R8WL 5KANG 2B1AH 5D7LE 2V7HB 4MDJA 3HE6B 1JUFB 4Y4FC 3QQ9D 4FQLL 4F9LC 2H1PL 3G9AB 3QIWB 4U1HB 4ZD3H 1A1MA 5K9QG 1ZLVK 2BXZA 2QEJA 3QIUA 4RGNC 1CZ8H 2X4OA 5EO9B 2UWEF 1A7NH 1P4LB 2VLJB 2XN9B 2DS4A 3MQIA 5DD5H 5LXGH 4X6CA 1RUKL 4LLAA 3MBEB 1NCWL 3T0EC 4LHUB 2W9EL 2Z91B 4MB5A 4F3FA 1XH3B 4K3JL 4NT6B 4P48A 1JNLL 1MI5D 4NQCE 5FM5O 2Q86B 4Z7NF 1P7HL 1PX4A 1YEDB 3FB5B 3GJFK 5JDJA 5IGXH 3U0PA 5FA4A 3DV4B 1FNGA 2R39A 1HKFA 4RFOH 4OIBA 1F6LL 4HMEA 5ICYB 3L5WB 4OD3L 4WNQA 1K4DA 1EV2E 1CLYH 3OGOE 4HBQA 4K3EH 3I3BA 1J9CT 4UV4L 1CE6A 4ODVL 1MHPH 4ERSL 1ZSDB 4L8DB 4YBQC 3CSGA 4DGIH 3TO4A 3VG0L 1WZLA 1LQSR 1TQCB 1VB9A 3O9WA 4FZEL 4HF5L 4E41A 2JCCB 1S7TA 4KROC 3W39A 1IQDB 3B43A 5HDBF 3O3AA 1I3GH 2APFA 2WV3A 2C1OB 4QKXB 4WWKD 3C6LA 5HJ3A 1J8HB 4G8EA 1KACB 1H3GA 3MV01 3HHRB 2VLKB 2CKBH 1KCLA 1J8KA 1DEEB 3GSXA 3WNOA 3TBWB 1AO7D 2FATH 1HILB 4MSWA 1MQ8A 1BD2D 5IW1A 4PB9L 3QJFA 4GRLC 1I9IH 5D1QB 1A0QL 4P5MB 4HCRA 3UZQA 3BQUB 3BZFA 3QI9B 3QFJE 2CH8A 4ZPVB 1E4KC 2HN7A 4PB0L 3CLFL 4PJGE 5F7DA 5D7LD 2OXGA 5DUBB 2YKLL 3VDCA 3CZFB 5JNYB 3O4OB 3X3FH 5IOPA 4MQXC 4OKVA 5LJYH 4MDIB 5T3XD 3GSVB 3TF7C 3VXQB 4P23C 3UDWA 3G04B 4LCYA 2YD4A 4CGTA 3MLVH 1F58L 5ETUA 2YK1L 2NZ9C 1KCUH 4K23L 1VPOL 4OCYL 5ACZB 5SX5H 2M1KA 1LK2B 4H8WH 3WFCH 4P4RA 4NQCD 4ZDHA 4HX1A 3T4YA 3BH9A 1D7FA 3D48R 4LLDB 4XMKL 2ENYA 4BQ8A 4Q97A 3DRTB 5EDXA 3LPFA 2V7HA 3THMH 2JJTC 5DJXB 3HE6A 3MNZB 3IU4H 1JUFA 2AJ3B 2NY3C 4E42B 3QIWA 4XTRD 5ALBL 4TNVK 4U1HA 1QFHA 2HG5A 4HDIB 1U8QB 5TFSH 1DSFL 4YEEA 4YDLC 5CIPB 1REIA 2VLJA 2XN9A 1LEGB 3OZ9L 1CDGA 1VERA 2G60L 3MBEA 4LHUA 1H5BB 5GGTL 3MXWH 2Z91A 1XH3A 3RWGB 2EH7H 4BK5A 4NT6A 2NW2B 3DROB 1DLFL 5J57B 3LN4B 3QCUL 1OGAE 1JWMB 2Q86A 5GRVL 4GXUM 3LOWA 2BSSB 3SQOH 5C0GA 1YEDA 1JGEB 2B0SL 1TCMA 4O4YL 4CVUA 2NR6C 3KR3L 5E6ID 3BUYB 4GRWE 1S7UB 1EHXA 3Q3GA 3L5WA 5EOTB 2FGWL 4OD1H 4NKDB 4RGND 4TPRH 3MV9B 4XB8A 1B90A 4J2XA 1YEGL 1UCBH 1LO0L 4CW1B 1JPFB 1IGFL 1YJDH 3F7PC 4JFQB 1TZHB 3AU1B 4AL8L 2Q8BL 1T89C 4FG6C 3WS3B 5CSGA 1K8DB 2JCCA 1N6QL 4EUPB 1AGFB 3EO1B 3ZMRA 2GSGB 1IQDA 1T7VA 1I9EA 1GGYA 4S2SA 4JKPL 3V4UH 4R7DB 2V2TB 2AV1B 4MJ5B 4Q0XH 5DHYB 3SO3B 2EDJA 1NGWB 2DICA 3PF2A 5LCVL 3D1MC 3E2HB 2FLBT 4RQQA 4XPBH 4WO4C 4LNVA 2Y7QB 4QRRD 3S4SB 1QRNB 3SPVA 4LCCB 3QNYB 3PGDB 4GLRI 2VDML 1RZKC 3LH2L 3O6FD 2VLKA 3GK8L 1ITCA 2RJMA 1HNFA 2BFVL 1DEEA 3DMMD 3IJSB 1HILA 4BJLA 4Q6IB 4I77H 4P5MA 2DLHA 3ULVL 3BQUA 1J1OL 1DBAH 5F9JB 3QI9A 3O6MH 3UTSB 1QSFB 4ZPVA 1S3KL 3ULUF 3C60D 3GHBL 5A2KH 1E0OB 1W8NA 5DUBA 3S37L 3CZFA 1WZ1H 3HUJB 4FFZH 1O7SA 1T5XB 3QUXA 5JNYA 2X44D 5BVPL 2R0ZH 5T3ZD 4MNHB 5C3TA 3VI3E 4MDIA 5IMKB 1O0VA 2YXFA 3BKCL 3GSVA 3S34H 4NBXB 3VXQA 4EQ2A 1JZ6A 2GFBB 3QQNA 4FMKA 3TZVC 5E7FA 3VFSB 1NLBL 1F3RB 1P84K 3TH3T 2JE8A 2YN3A 4TSCH 4X80H 1BMGA 3SOBL 2GSIB 1HYSC 5ACZA 1BFVL 1LK2A 5FK9B 5TPWH 1HINL 2VB5A 1H8SA 1KELH 3MOBL 1W8OA 2Y72A 4LVHB 1ZHBB 1VFAB 4HIEA 3MV7A 2DQHH 4PR5B 4JO1L 1HDMB 4LLDA 4DN4L 3L7FB 4XNYH 1GGIL 3ZZ1A 2IG2H 4HXAH 2CDGB 3DRTA 1QLEL 5L88H 1J1PL 2XTJB 5DJXA 2M8XA 2FO4B 3MNZA 4E42A 1JZ5A 4MB4A 4XPAH 4JHBA 5KSBE 4P23D 5GJTH 1HHJB 2QL1A 4PJ8B 4PY7B 1EFXB 1KN4H 1OAXH 1WIUA