5EOQH

Structure of the murine fab 1g6 bound to the vaccinia virus a27 peptide 31-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
217
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDKYYNPSLQSQLTISKDTSRNQVFLKITSVDTADSATYYCAHDRGYYAMDYWGQGISVTVSSAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti vaccinia virus A27 antibody Fab 1G6 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 45
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eoqH01
3P73B 3NBNA 4LSDA 4K3JL 1FVCA 2Y36H 3UJIH 4YHOL 1CWVA 2F53B 2NY6D 5F6IB 3FHAA 4GMSL 4CL7A 4XTRD 1DN0A 2NY1D 3TBTA 3MCLH 1P5UA 4OZHB 2ICWB 3DV4A 1KLUB 3MLWL 1CDJA 1NGYA 2QHLA 3O8XC 4KTDL 2F54A 3L7FA 1OAXL 5A1AA 4Y2OA 4AIZB 3QT2A 5I8CB 1SY6A 3MOAH 1I1YB 3JWDC 3K8LA 5HHPB 4PYHA 2AERT 1QUNA 4PRBB 1KLGA 1D5ZA 5L0QB 1JWMB 1R5VB 2LU7A 5TDNB 4N8VB 3FMGL 1U6AL 4KZEL 3RVXD 4QTIL 5F6HJ 2VRAA 5GPRA 2ERJC 3ZT6A 1HZHL 5JW4R 2DJSA 2X89A 4YXKH 1INQA 3SDXA 4NO0A 2GUOB 1FH5H 3D3VD 4PRHA 4DW2H 4HS8L 2DQEL 4LNVA 3R0NA 4X7CC 1UZ6F 2VABA 4QRQB 3C5ZC 4Y5VA 5INDA 1NCCL 4LSUH 5C0BA 1T04B 3K8KA 4HAGA 1ZHNB 1GGBH 1TVDA 3VFGH 1UKQA 4G8GB 3GMRB 4MNQA 4FQJL 4PTUB 2H2SD 5GGQL 1J1OL 2HJLA 4XNUH 2PR4L 5CLWA 2Y9RT 1YN6B 3PL6B 2R2HB 3FQWA 2XTLA 2HT2D 2R39A 3JTTA 4I77L 4UDTA 5J9PA 4GT7A 4YNYA 3BSZH 2QSVA 4JHWH 4JRYA 2EYSA 1U41A 5C0EB 5JPMA 3T0EE 1IAMA 35C8H 5E7BA 1JI1A 3OMZA 3JTSA 3S34H 1IEAA 1EJOL 4PJEB 1QPPA 1MI5E 4PJ8D 4NBZB 5GGTH 4X4MA 3UYOD 1UM6H 2P46B 3MROA 1LO4L 4YHLL 3WFEL 1QSZA 2MCPL 5JA9A 2B5IC 3HC4H 1DQDL 3VWKA 2BHUA 3ZKMD 3MO1A 1NAML 4X7SH 3VD9A 4KUZH 2A6DB 3E2HB 1ZT4B 3MRPB 4R4FH 3QH3A 1K8IB 3ARRA 5GGVH 3PDOA 4RISL 4UQ2A 1KOAA 1S78C 5C07E 1CDHA 1FZKA 3MRDB 1CFSB 4ZNEE 3BP4B 5E2UH 3IAQA 4UV7L 4WW1B 5DGQA 5KSBA 4LLDA 4OM1H 4O00A 3VFVB 3WFBH 1N8ZB 3BDYL 3BZ4B 3RWFB 4JO2L 5BZWA 2AVGA 2DI8A 5JIIA 4DGIH 2FB4H 2OQJB 4P2OD 1F90H 1MAKA 3LN5B 4R3SB 2DLTA 3S9DB 3IJYB 4TOYL 4J3WA 3HE7A 2ICEB 2ESVB 4QHNA 4XPHL 5K9OB 2X4PA 3WFDH 3AU1A 1G1CA 3LDBB 1EFXD 1F6FB 1I1FB 1QSEE 3ZTNH 1DUZA 5IGXH 2HFFA 1KN4H 4U2ZA 4TQEL 1RSFA 3JWDH 4OT1L 2NX5D 3MBEC 5D1XB 4RRPG 5I1DB 5L2KB 4NWUH 3FZUD 3SJVE 3RU8H 3QPQC 5J6GB 1S9YB 3FFCE 1W72B 2Q6WB 1YQ2A 3UTTD 4GAFB 1UCTA 4K7FA 5CILH 2I25N 4XCYB 3FO2A 5CS7A 1W0WA 2NXYB 3C2SA 2ED8A 1J0IA 1IGFL 4WJ5B 1CFTB 1KCSH 2EH8H 2YPLA 5FGSA 4EUPB 4UOW0 3GSOB 4Y5YA 2BC4B 3KPLB 1OB1A 2V6HA 5BOPA 4RX4A 1P69B 5ESVA 4NBXB 1S7VA 5IBTH 1CDUA 3TA3A 4ZPTA 1B6DA 3S37X 4OCSH 5MEQB 3B9KC 2ZNWA 2XT1B 3B5TA 4ZQKA 1KT2A 3F58H 3ARDA 4O2EA 1F97A 1IM3A 3TT3L 5L9DH 3NABH 5IEHA 1S5HB 4ODXA 4OQTA 2PO6B 3MA9H 4JEGB 4U1KB 2VDNH 4ZOEA 3P11L 2IAMB 2R1WB 2VQTA 4KRPD 1HH9B 3PGCA 1TQBB 4MJ6B 4PV8B 4YHIA 1H15A 2R29L 3P0YH 4TSCH 3CMGA 2DRUA 4XX1E 3N1PC 3O81A 4LL9A 4H1LG 4L3EE 5HDLA 1BFVL 4DK6A 2NY0D 1MVUA 4HKXA 1B6UA 3O6KL 1P6FA 5GJTH 3FQUA 5CJXC 5J89A 1J1XH 4OUUB 4QRPB 4RQQB 2AI0L 3HE6B 5J6HB 4OCWH 4LSTL 2P8PB 1BD2D 2X44D 2UUDK 2G5BB 5J0BA 3KJ4C 4O4YH 4WW2A 3L7EA 5CKGA 5DD0H 1AXTL 1DQJB 2DQJH 3T0AA 2XNAB 2W0FB 5CZXC 2BVOA 1XR8A 3VI3F 3G6DL 1AGFA 5DT1L 5EIIA 2IQAB 1A3LL 1LGVA 4HGKC 3CD4A 3ULUC 5IWLA 4D9LL 3GMOA 1PQZB 3CLFL 1J1PH 4M3JA 3ZE0F 2C7UB 4LVEA 3L95B 3BT2L 3E8UH 4J8RB 1HH6B 4LCWB 3HPLB 5GS1B 2XKSA 3GKWL 3TO4C 1KB5L 5HI5C 1T1XA 2BSED 2CRIA 5JZ7C 2BSRA 2A1WH 3IRZA 4NP4L 5DQDL 4EEEA 1T3FB 4I18B 4M02A 1ZOXA 4KRLB 3O2WH 3VFSB 3T04D 1V3KA 5SX5K 2DLFL 3L3KB 5ADPL 2X40A 4EOWL 4PB0L 3CAFA 2DMCA 2Q7YB 4IHOA 5F1IB 4GRWE 4JJ5B 1GGTA 1OW0A 2VXQH 4S1RH 4KUCF 4LSQH 3W0WA 1TPXC 4U7MA 2ICWA 2XZAH 5DEGB 4F7PB 3QSKB 25C8L 2YC1B 2GQHA 4P4RB 1D6VL 2LAAA 4AIZA 2J8UB 2VZTA 1DDHB 1T2JA 1IGCH 4M8VA 5I8CA 2VSCA 3S37H 2AJZB 4M93B 3RAJH 1DBJL 1S7RB 2MPAL 5HHPA 4JY5L 3K2UL 4JFDD 3V7AE 5B3NA 5F7HA 1AQKL 1WFNA 2DDQL 4I0PA 4MA1B 2VJXA 3GI8L 5D7JB 5JORB 5TDNA 1F2QA 4DKEH 2P5EA 4RMWA 4U0RB 3IJHA 4Y4KB 5EN2B 1FNEA 1RMFH 1Q9KB 3HZVB 5DSCA 4LIQH 2DM7A 4F3FA 4MJIA 2VN7A 4DEPB 4WUUD 3VXSE 5JHDE 5D6CB 1U93B 3U0WL 3RIAF 4ZXBB 2E9JA 4N0RA 4G8FB 4C58B 4G9FE 4M7LL 3BZFA 4HUUA 3QXTA 2QQLH 4P2QE 4IRSC 4QRQA 2R0KH 1Y6NR 1NC4A 1EGJL 3WO4C 1IAOA 4PLJC 3RGHA 5CHNB 1RJZB 2BY0A 4G8GA 4OV6F 3GMRA 4KV5F 5H35A 3MNZA 4PTUA 2RHEA 4AEIH 4RMRA 1Z5LA 3RBSA 4Z95H 1QLEL 2WV3A 4J4PC 3PL6A 3N1MC 4P5KB 1OP9A 4ONGH 3NVQA 1E4WH 5CJ5A 5I1IH 1DE4B 5BO1H 1MJJA 4QTHB 5C0EA 4HDIA 2YK1L 4ZMAT 4WWID 5CEZH 1N6VA 1T0NA 1M1SA 2AJVL 4NZJA 3RIFF 1WZKA 1NCBH 4YHZH 4PJEA 2Q76B 1QBML 2ADIB 4HHAB 4JAMA 5D2LA 1V05A 3QI9D 1GJIA 1T5XB 5JUEH 1DQLH 3E0GA 3CFIC 5HD8D 4CVZA 4KGJA 1QLFB 4OIAA 4AG4L 4Y19B 4IDJL 3IFPB 2A6DA 3SCMB 1JHTA 1ZT4A 5IFAH 1OAKL 3HS0B 3MRPA 1PX3A 4JZJC 5C92A 4ZS7L 1K8IA 4K7PY 4M62H 3W5NA 1P7QB 4H0IA 2COQA 1IARB 1U95A 3MRDA 1Y18B 4XPTH 3BP4A 4TTDD 5D70L 4WW1A 2C4FT 2IGFH 3EGSB 1KCRH 4P23A 4XWGL 1NGQL 4WTZA 3AVEA 4KGLA 3LN5A 1N4XL 2FH8A 3FO9A 4R3SA 5HDBF 3IJYA 2HFGH 2WINB 2UVFA 2GY7B 4DAGL 4TUJA 2ICEA 2ESVA 2YWYA 3MUGB 5J11B 5K9OA 4UU9B 4XI5C 1OVZA 2CJUL 3R8QA 2VERN 1I1FA 1JZ8A 1OSPH 3RJQB 4ONFH 4YJZL 1GGYA 4KJWD 2CUHA 2JIXA 3ARQA 2FATL 3VE0B 3PGFL 4H25B 3PWPE 4Z7QF 4KTEH 5D1XA 5I1DA 5L2KA 1YEJH 4P9HC 4GS7B 5J6GA 1W72A 2Q6WA 5BW7A 2L4OA 5J3HC 5BS0E 4BJLA 1KIRA 2R4SL 1CZ8L 1JGVH 3FKUS 5BV7L 4XP9L 2WLZA 5EUOA 4W81A 2W91A 1DL7L 5IQ7L 1C1EH 2ZCLH 2DL2A 4PRNB 2ADJB 3QDAA 4WJ5A 1CFTA 5DJ0B 3WNPA 4EUPA 3V8OA 1U8PA 5L88L 2F15A 1O7VA 3UTSE 3MA7B 4XPBL 1R24B 4FA8A 2BC4A 1IAIH 5T5NF 3TP4A 3KPLA 4NC1C 4BFIB 3TIEA 5DJAB 4QWWD 3QFDB 4PGZA 4V1DE 4PFEA 1IZJA 3SPVB 2CQVA 1FG9C 3K80A 1IT9L 3W81A 2V7HB 3I2CH 2UZIL 5GS2H 4QHKJ 1RZJL 3JV4B 1YECL 3RNQB 4JFHD 2BFVH 4Y1AE 1S5HA 5I66B 1I8IA 4KPHL 1QNZH 4RRPA 3OZ9L 5GRUL 5CEXB 2PNDA 4HJGB 4NHCL 5KSAA 1QQDB 3HR6A 1SM3H 4NFBA 3TCXA 2XICA 1CE6A 1ZA6A 3ZDYE 4RA0C 2RIKA 3ARFA 1N5AB 4YK4B 4WW2F 3GI9H 5JQHC 2IQ9L 4Z5RA 1N64L 3SDCC 3S3JA 5JA8B 3PHSA 3JWOH 4KUCD 1B0GB 3O6LH 5EWIH 3S35X 2JKXA 4RQQA 4P2RE 3HE6A 3WIFB 5J6HA 3EO9L 1KB5B 3WV0A 3H0TB 1UQSB 2C9AA 4U6HB 2G5BA 2X89D 3MTRA 4HPYL 4KROC 4WGVB 4Y89A 4PRHD 1KXTB 3U1SH 5IHBA 3PQYE 5DFVC 5KS9F 2QQKH 2ICCA 2Z4QB 5CSGA 2XNAA 2WUCH 2LABA 3CVHL 1UB6B 3BISA 2ZG2A 4MD5B 5TH2A 5C0BD 3LIZH 1ZHKB 3T0EC 1G6RH 5L7XH 4K94L 3RA7L 4MNQD 4RDQG 1IGIL 2IQAA 3F65A 3HAEB 5EBMB 3AY4C 4HT1L 4HBQA 1YPZA 1P5VA 1DQQB 2C7UA 5K59F 1U2CA 4JRYD 3T2NH 2BNQB 4H1LA 4J8RA 1HH6A 2H6PB 1CLZH 1MHPH 3SDAB 3AAZB 1FPTL 4NUGH 1NSNL 3SDDC 1RPQA 1SMAA 4QLRA 4PG2C 1B0RB 4JO4H 5L6YH 4K7PX 4ZSOB 4AEHL 4R4BA 4LSVL 1RZIA 4JRXB 4I18A 3WNOA 4YBLC 3L6FB 4ZTOL 3MRNB 3GHBH 2QSCH 4OZHF 3ILQC 5JLZA 3VFSA 1UM4L 1KJ3L 2XQYK 1YMMA 5CD5D 4DK3A 1UT9A 2DAVA 2FSEA 4KKBC 2WP3O 4ODVL 3L3KA 5C08E 5FO8B 1RUAL 5SWSE 2Q7YA 1F13A 3KS0H 5F1IA 3X14B 4P5MB 4BQBA 3E1F1 2HJFB 4LLQA 4M6MH 5DJ6B 2YPKA 5F7EL 3U4BH 1TENA 3F7PC 4XMLL 1CS6A 3VGDA 4D3CL 1KTDB 2YC1A 4PP1D 2XXMB 1C7TA 3WFZA 4BSWB 4P4RA 1WFUA 2J8UA 3MV7A 1DDHA 3IS0X 2AJZA 5H2BB 3FRUB 4ODUB 3PWUB 4XAKE 4QRUB 1E4XL 1V3MA 6FABL 2RB8A 3HE7D 5JORA 5MHSD 1NCNA 4LHQB 4PJAB 4Y4KA 1Q9KA 3PDGA 1DEEA 4LK4A 2NY5L 4ONOA 4Q7DA 1UB5B 4LVNC 4Y0GA 1GHFH 3T09A 1FBIL 2FEDD 2JJWA 1IQDB 1MHEA 1P4IH 3NPSB 4ZXBA 5T5FL 4HLZH 1UWEL 1V3JA 2HFEB 5I18L 3BP5B 5IJVB 4NQEB 1NL0L 3ARGB 4TUOB 4XPGH 1DQML 1LE5B 1GZQB 1RJZA 2X4QA 3FOMB 4N8PA 2VLJB 4GW5B 4NKOB 4P5TC 4Y4FC 4HK3N 5CZKA 3FT2B 3S35H 4EDXA 4OCXL 1FO0H 3PV7A 4QXTA 3D69B 1A1MB 4P5KA 4WCYL 2DM2A 2IANE 3V6BR 5HYJB 3NA9L 4R8WH 1DE4A 1DLFL 1UC6A 4XVUC 1LO0H 5EUKB 5E95B 1P84K 3FAXA 1G9MC 2Q76A 4RX4D 5D7LA 2ADIA 3TA3D 1XH3B 3DV6B 4FFZH 1FNSL 2ITDA 3UYPA 1Q94B 5CEZD 4F7EB 5DMGD 4OLXH 1ZTXL 2AXHA 3ESUF 4F58L 5FYLE 1A8JH 1U9KA 3ARDD 2NZ9C 4LRIA 5HXMA 4PJ9A 4XCFH 4Y19A 4JN1L 3EYFB 3IFPA 5E7FA 3MQIA 1UG9A 3HS0A 3ECBB 3C5ZB 3QJHA 4PB9L 3O6MH 2VR9A 1P7QA 3ES6B 1ZSDB 2OTUA 1MLCB 3MRKA 3V4VL 3IAPA 1Y18A 3CDGB 4FZ8L 5KG9B 2DQCH 3PHQB 3CZFB 2BRRL 3EGSA 4E41B 5BV7B 3MLTB 4K7PH 2OL3L 3CDFA 1RU9L 5E2TL 3I6LD 3C8KB 3H42H 4IRJA 1HCFX 3VFOA 1VFOA 4LDLB 1FDLH 2WINA 4I1NB 2LV4A 5JOPE 2IH1A 4QXGH 4FFWD 4MNGB 3ZE1E 5T1KA 1EHLL 5CP3H 3UTZA 2B5IB 8CGTA 1MFDH 1CFQA 2DQHH 2W1NA 4OZFG 5BRZA 4MSWB 4H25A 2O5YH 1A4JB 4K3JH 3MYJB 4MAYC 4PG9B 5E70A 4N0YL 2AEQL 4P46A 4GMSH 4FQ2H 5HPMA 2BNRA 3MLWH 1CICB 5BVPL 4KTDH 3Q6GL 1OAXH 3CFJA 3OKNB 4NCDA 4QCIB 3KJ6L 2UZYB 4KK5D 4RAUB 5GRYA 4PGBA 2HT4D 2P5WB 5DJ0A 3T0DA 4A6YL 2R4RL 3UTPE 5IW1B 3MA7A 1AHWB 1R24A 4M1DL 1AE6L 2Z9TA 4BFIA 1U6AH 4LGPB 3QFDA 4KZEH 4RGND 1EA9C 3SPVA 5GSVB 1HZHH 1U92B 1HQRB 4KI1A 3BH8A 5HHOA 1VEOA 2V7HA 5F7LB 4YGVB 4HS8H 3CFKB 2DQEH 3JV4A 4PJ7E 5E00B 2WUBL 2FL5B 4PJXB 1L7TL 3SO3B 1NCCH 4MXQC 2NY3B 5I66A 1SJVA 4CU8A 5GS2D 3RIAK 4WI8A 2WIMA 1G9MH 4FQJH 5CEXA 4L4VB 1J1OH 3W0WD 1GGIH 4HJGA 1TVBB 2PR4H 1MRDH 1QQDA 4JVUA 4LHUB 4Z18A 3P9MA 2QSQA 4MQ7A 4LQFL 3QG7H 1AH1A 4B7IA 3DSNA 4PJHE 3F7QA 4KAQL 3DX8B 1EJOH 1B0GA 2OBGA 4YC2B 4HK3J 2HVKB 4LCCB 5E94A 4XVSL 5DD5L 3FB5B 1LO4H 4YHLH 2P5ED 2XKUA 4U6TA 3RWHB 1SEQL 3H0TA 1UQSA 2JELL 1DQDH 4H88L 2NLJB 1TZIB 4AZ8A 1JGLL 4MJID 3U7WL 1NAMH 2I27N 4OB5L 3BPCB 2OR9L 3DO7B 4Z7UE 3AS1A 5DHXB 3MJ9L 3OB0H 4ZAKA 3STBA 5AYUL 4CVXA 2YKLH 2OP4L 2X7LB 1UB6A 4MD5A 43C9B 4G6JH 1NC4D 1ZHKA 5TDOB 4G8GD 4UV7H 5EZOL 3RY6C 1N2RB 3CXDL 4X5XA 1ZLUK 3HAEA 3BDYH 3IDUA 4OCLC 1O0VA 2FECI 3FAWA 1IRAY 1TZGH 3PL6D 2EDKA 2P7TB 1SJXA 3GMMA 1DQQA 4PJGB 2YWZA 3EW3B 3TJHC 4HUVB 2PW2B 1ZGLB 3RNKB 4YHMH 1XGQB 4ZDHB 1L6ZA 1OGTA 5DJYB 4TOYH 1F02I 2H6PA 2OSLB 3BH9B 1S7TB 3SDAA 4XPHH 2H3NB 1B0RA 2XTJD 1EO8L 4HQQH 1UJ3C 4JRXA 4CKVX 2A6KB 3MLUH 3RDTB 4TQEH 3RWEB 4OT1H 3TFKD 4N90E 3WO3B 5A2JH 2PW1B 2BRQA 2J8UF 2ZOLB 5KW9H 3G6JE 1JF6A 4K23H 3SBWC 4WI2A 2YS4A 3UBXG 1BWMA 2HN7B 3TGXA 1WIUA 4GRWH 1FGNL 1EGJA 3GBML 3U6RA 1KTDA 1PDKA 1IGFH 5DYOB 2FLBT 2FCBA 3IS1X 5ESQB 3HNVL 1NBQA 1E4KC 4P23D 2BK8A 3QR2A 2C3XA 2P49B 4DCQB 1NUGA 4KKCD 5H2BA 1XGPB 3NMEA 5MP6L 2DTMH 4X8JB 4ODUA 3PWUA 4YE4L 5T3ZE 4OGZA 1EAJA 1HHKB 3FJTA 4DKFL 3D87B 4HEPG 2ESVD 1E0OB 2QLVB 1D5IL 2EYTB 2VZ3A 5F7UA 4PJAA 1LK2B 3LY6A 2QJDA 1IGJB 2C1OA 4X4YB 5B3JF 1UB5A 3S97C 3TT3H 1IQDA 4LCUB 3OAZK 4H8WL 3BW9B 1PZ5B 5D1XD 3A6BL 4HUNB 2HFEA 5L2KD 3BP5A 4C56A 5IJVA 4PJIE 4ZS6D 5EZLB 2IF7A 5K9KB 3C9NB 1LE5A 4LLWB 3DX6A 2X05A 1A02N 2QHRL 1HSBA 3MV9A 3M17B 2VLJA 2R29H 4GW5A 1UH4A 1ZHLB 4Z76B 3FT2A 3O8XA 2NXYD 3D69A 1BQLL 5DEFB 1FCCA 5F9JB 3UC0H 3OJDA 1BFVH 4M1CC 4FOMA 4R4ND 4IOIB 3O6KH 1H3PL 2W60A 3X3FL 1KPUB 2OL3B 2XA3A 2AI0H 3EYVB 3GSNL 4M3KB 3TN0B 4LSTH 2HLAB 3C8DA 4ZO6A 2BOBA 5F97E 3V79C 3DV6A 3VXME 4DWHA 1Q94A 1KJ2A 5FCUL 2D7MA 4CADB 1DBMH 3QEQE 4KVNL 3K7UA 4K8RL 5C0DA 1AXTH 4G6MH 3FONA 3F62A 1JN6A 1FNLA 2GJ6B 1ZV5A 4UBDC 4W6XB 3EYFA 1Y0LB 3MRLB 4GRWF 4KK6C 3ECBA 3JVGC 3C5ZA 5H8DA 4IRSB 5IVZB 4UAOC 3GUTA 2F5BL 1NQBA 1A3LH 2FJGB 2IAMD 3MRJA 1BQUA 1MLCA 4YUEH 3F5WB 4WU7B 4NDMA 4PUBL 2RQ8A 3VRJB 4P4KB 3PHQA 4ODWB 4OLVL 3CZFA 1D5BA 3CLFH 3ZKNC 1EHXA 4FQXB 1WSST 4E41A 2VLLB 3FQTB 1X5AA 3MLTA 3ARFD 5K93A 3QUXC 1DZBA 2BVQA 3PXHA 2E7LC 2P24B 3C8KA 5I1EL 1QRNE 4LQ1A 1KB5H 1WGOA 5HGBB 4A6YB 3ROLB 3IETB 2JCCA 3T4AA 2CSPA 5DQDH 3HE6D 5C09E 1UZ8B 1C12B 1YMHB 4MNGA 4RMTA 4S0TD 5JXAL 3GBLA 3AXLA 3EJYD 2W65B 3BPNB 1NCWL 1QHOA 1A9BB 2DLFH 5TPWL 4UNUA 2A2QT 4EOWH 1A4JA 4OKVA 5DDHB 5FDWB 4PG9A 4NIKB 3WUWG 3QHZH 4GLRI 4NNXB 4Z7VE 1JJUA 2ZG1A 1CICA 3FB8A 2HKHH 2GSIB 4YHKL 3OKNA 3CU7A 3WS6C 1D6VH 4R0LB 2X4SA 5I0DA 2P5WA 2MPAH 3V6OA 5GZOD 5T1LB 3K2UH 1WAAA 4HXBH 1AQKH 5IW1A 2P47B 3D18B 4G7VL 1CXKA 4MS8D 3GI8H 3ARTA 3MRMB 5F7WC 1LILA 3T8XB 4B41A 3WYRA 4FG6C 1R3IL 1F11A 4BUHA 5GSVA 3AMLA 1HQRA 3MXWL 3ULVD 3V0WL 3O41A 1T2QL 3PNWB 4MCYB 3RVTD 5K9QG 4HBCL 2D7TH 3BESR 4Z7OE 1FN4B 3JV0A 5GZNC 1YMMD 3IVKB 1U2HA 4M7LH 5IB1B 2EDYA 3IDYB 3MLVL 5JXEC 4LGSB 4TVPE 3W11D 1K3ZA 4OZFA 4G6AC 3RWIB 4NGHL 3O3UN 5DVMA 5GRXG 3BN9D 1A4KB 1CK0L 3B5GA 1EUTA 1PAMA 1DBKL 1TVBA 1QLEH 3NFNA 4J23A 4EN3C 4R7DB 1MEXL 4LHUA 3CFBA 1C08B 3RRQA 2G5RA 3MV7D 1PG7L 4PRPE 4HLZG 5C0CE 2YK1H 1LO5A 3BD4A 1CVRA 3GBNL 5C86A 2AJVH 4JKKA 1AD0A 3MGAA 5GGUB 3RGVC 1NFDB 1QBMH 4LPTA 1UADC 2HVKA 2VZUA 4MLSA 5D7JD 3FB5A 4CMHC 3AB0C 4Y4KD 1P7HL 1EO5A 3B9KA 1T83C 4IMKC 5SWZB 5IT2L 2ZZUT 3KWWB 4AG4H 4IDJH 2KH2B 2X4UB 3DO7A 3BIBX 3BD3A 1D5MB 1OAKH 4ZXBD 3P4MA 4ZS7H 2X6MA 4UIKH 3PV6B 2X7LA 5FHAL 5LGJA 1IL1A 2EZ0D 3ELAT 3DVNB 5TDOA 5D93C 1RHHB 2ZOKB 3ZKXC 1JV5B 4TUKL 3BGFB 4XNXL 3ZT5A 4XWGH 2P7TA 1NGQH 4GO6B 4HUVA 5FDYA 2PW2A 4D0DB 4LVHC 1N4XH 1R6VA 3RNKA 4AM0B 4ZDHA 5DJYA 3IU4H 2OSLA 1EJ6A 4WI7A 4J3OC 1S7TA 1HDMB 4OIIH 2E7BA 3O4OC 5T3XD 2H3NA 1RJYA 1Q9WB 1K9TA 2CJUH 4N1EA 1ORQB 4D9QD 2A6KA 5F44A 3RDTA 4X5LA 3RWEA 2FATH 3PGFH 4MZ3A 4PJ9D 4N5EC 4LP4A 4NCC2 4Y19D 1CE1H 2GSGB 3CSBA 3SCMD 1QBLL 2ZOLA 4G42B 4L29A 1NEUA 3JXAA 2EIEA 4X80H 5E08H 4D9RD 2IALB 2PYFA 1P7QD 2R4SH 3U2SA 5BV7H 3ET9F 4XP9H 2HN7A 4F37K 4Q9RL 5FGCB 3WMSA 32C2B 2Z8RA 1DL7H 2DD8L 5DYOA 5ESQA 4PJAF 2GKIA 4BSVB 3BE1L 4FZEH 1F3DJ 5L88H 4DCQA 1GAFL 4XPBH 4GG6B 3OX8A 4XRCB 4AYFA 1SYSB 4IRJD 3VXNB 3AMKA 1OT2A 3HUJE 1QOKA 3STLB 2RAMA 4OGYH 1HHKA 4KJQD 1WFOA 2Q8BL 2UWEE 3MV11 1IT9H 1WEJL 3GSNB 5A40E 1T89A 1BM3H 3D0VB 5T1KD 1LK2A 2YD9A 1IGJA 4X4YA 4I2XA 3C5SB 1YECH 4LPVA 4U1IB 3RUGA 1EERB 3M07A 5SV3A 4YDKH 4LCUA 5BRZD 2A0LC 5ILTH 4KPHH 2Y06H 2VLKE 1OOAA 1SJEB 3OZ9H 4P46D 5EZLA 5GRUH 1MCIA 5K9KA 3C9NA 3LD8C 1DLHA 1X4YA 4LF3A 4BFEA 4XB8A 4YLQT 3T0VA 1ZHLA 4Z76A 2FD6H 3P30H 1BEYL 4JANB 5DEFA 1I3RA 2F5AL 5I9QC 5MERB 1N64H 4P3WA 4ALAL 5I8EB 5FEBA 1WITA 4I9WE 1KPUA 1LO2L 2OL3A 5DJDA 1A6PA 3EYVA 3TN0A 3EO9H 2ZWLT 4XCCH 1CFNA 1YEGL 2HLAA 1CU4H 1TNMA 1ODAA 4QF1B 1T1ZB 5IMLB 4NN6C 2DN7A 4HPYH 4HUWA 4PGCB 5HHQB 2WBJC 5FV1L 4XC3H 4XX1G 4R96B 2DQTH 4PLNC 1OAQL 3CVHH 4F9PC 5FYLH 2H9GB 4Z78B 4IRSA 4K94H 5ENWB 3RA7H 1IGIH 2FJGA 1INEH 1IC1A 2AQ1A 3DTXA 4HT1H 4XBEL 3VRJA 4P4KA 1OTTD 4ODWA 2FECL 4J4PA 2D7NA 4FQXA 1HEZB 1N26A 5E1HB 4XVTL 1MRFL 4HIJB 3D0LA 1LK3L 3ZL4H 4Z0BL 2DIBA 3CXHJ 1HSAB 5CWSB 1PX4A 4JFQA 1Z0NA 2MTPA 1YEFL 3MLRL 4WFHE 5E6ZA 1FPTH 5HGBA 1NSNH 3BQUB 4U1JB 3IETA 3G5ZA 1BVLB 4AEHH 4LSVH 3P4LA 1UZ8A 4X6DB 1YMHA 2FGWL 1IEBB 5MI0B 1UJTA 4CU6A 5JTWA 2J12B 1R3LB 1NJ9A 5HYSB 5IB3A 2W65A 5F1OB 1UM4H 1FAIL 1KJ3H 4KDTA 1A9BA 2YRPA 4L9LC 4MX7A 5ITFA 2CKBB 2E6JA 1A14L 3EAKA 4OF5A 4ZAKD 4G3YH 4YPGA 1YY9C 4D94A 5FDWA 4JZJA 2ATPB 2DQIL 3BYYA 1WAAF 5I1KL 3TYGH 5DRZB 4ZUTB 4GKZB 4YXLL 4NNXA 1XZ0A 3NH7H 4XMLH 4D3CH 3DMMB 3DUHA 1JNHB 3CX2A 3T0BA 4PRAB 3EOBB 4MNHB 3DWTA 5CMAB 5T1LA 5A2LH 1HWGB 1WIOA 3H3PL 3VD4A 2BNQD 2F74B 3D18A 6FABH 5IFJB 2GEEA 3IDNB 1H5BC 4PJXF 3SDAD 4U1GC 2WAHA 2HT3D 3T8XA 4HIXL 1NCTA 1CR9L 5J1TC 3OWEA 4UT7L 3VXRB 4RGOL 4YBQD 4JRXD 2NY5H 3B83A 4OD3L 1J05B 3PNWA 4MCYA 4X6BA 5DF0A 5ABDE 1GGUA 2IPTL 4ZODA 3EHBC 3KPRE 3Q2CA 2DYPA 4O02L 5IB1A 1E28B 3PP4L 3IKCB 1CGSH 3ZDZF 4DZ8B 5MENA 2JB6B 2X09A 4KKAC 3VRIB 3IGAB 1DQMH 1J8HE 3V7AG 5KANG 2E7HA 1A4KA 4M7JL 2JK5A 3IJSA 4MDIB 1RUKH 2EDRA 3WUWA 3BUYB 4R26H 3LKPB 4Z7NE 4B0MM 4OFYA 4OCXH 1OQOA 5BJTA 1NLBH 4WCYH 2AJUL 2VXTL 3TCLB 5JNYB 3NA9H 1PYWB 2CLZA 2J5LC 4GG8B 5J7CC 5I74C 4PJFB 4X9FA 5GGUA 5HGAA 3HCVB 1NFDA 3BP6A 4KVCL 3T1FA 2MHAA 3JWNC 2Z93B 1EZVY 1FNSH 3TNNB 5B21A 5I16B 3SN6N 5F7DB 1ZTXH 2P42B 3O4LB 4F58H 3MRIB 1PGRB 3MCG1 1QACA 4X9IA 3ETBF 4OBSA 5SWZA 1HHGA 1VFUA 5CAYB 2X4UA 1TJHL 1TJIH 4D8PB 1M4KA 4IS6B 4GXUM 4PB9H 4PJGF 2VE6A 5FIEA 1KJMB 2J2ZA 3TEUA 3ARGD 4MB5A 2IFFH 5J13C 3RX5A 3V4VH 1RHHA 5D8JL 4FZ8H 1JV5A 2VLJD 1RIVL 4EI6A 2BRRH 1KJVA 1RZKC 1RIHL 3STZB 4M00A 4KK9D 2B0SL 1Q9LA 4OJFL 4DUXA 1RU9H 4K3HA 4OTXH 5E2TH 5HYJD 4D0DA 2YUXA 5DVLA 1VESA 3EDEA 4PJ5E 3SDCA 3NIGE 4OV5A 4KHXL 3C6LC 1HDMA 4KI5E 3U4EB 5F93C 4G9FB 4JKPH 1U8IB 4LRNL 3EBAA 4MJ5B 1MCHA 4ELMB 3TVMB 3PJSB 1ORQA 5IK3B 3Q0HA 2BY1A 1NUDA 3JUYA 5FAAA 3QXVA 4JREC 2GSGA 1AC6A 4N0YH 2AEQH 2BCKB 4N8CH 1LP9E 2HG5B 3X13B 4G42A 2Y6SD 3C5ZD 3LCYA 4LPXA 4OI7A 4K3GA 5I1LB 4N0CD 5BVPH 3QFJB 3G08A 3KJ6H 4YHNA 1H3TA 5DURB 3AY4A 4L5FL 3RL2B 4LSRL 4BSVA 4LNRA 4E41D 4V2BA 4A6YH 4IJ3B 2R4RH 4WGWB 1JRHI 2YR3A 4GG6A 3AM8C 1DP0A 3ARXA 4M1DH 4XRCA 1AE6H 5JDJA 1CYGA 5FM5O 1SYSA 3X12B 3VXNA 5HGHA 2DM4A 2AXGB 3BPLB 3O9WC 3STLA 2DQUL 2CDGB 5EIVA 5FHBL 4IIQC 4PG2A 3GSNA 2WBKA 2J8HA 3U82B 4FQLL 2GTZB 5SX4I 3C5SA 4Q6IC 4Z7UF 2EDJA 1A6ZB 2WUBH 1VDGA 1F4HA 3C2AL 1U3HC 1X44A 1WQVT 2IG2L 1MFNA 4FN0A 4BA8A 1ZAGA 2HTLD 5IVXE 5KBNC 4AEEA 4BZ1L 2IMNA 3U30C 2NNAB 1CICD 1S78D 3KPQB 2NY2B 4N9GB 4LEXL 3WHE1 2YA2A 3U79A 1PKQB 4LQFH 4L3CB 1MHCB 2FJFB 2L7UA 2P5WD 4ESKA 1IFHH 5D1ZC 1BIHA 1OL0A 2BSTB 4KAQH 5EC1A 3H9HB 1NBZA 4X4XB 4XVSH 1T80A 5KSUB 1SEQH 1P9MA 2P8LB 5M7QA 4QF1A 3SJVA 4H88H 3M8OL 4PLKC 3U7WH 3VGAC 4PGCA 1GGCL 4OLZL 4BELD 4OB5H 3QWRA 4ORGB 3WFHB 1FRGL 1NLDH 2VKXA 3CLEL 4R96A 3MJ9H 5IHLB 3RVUC 4OAWB 3QDJE 4KTYA 3O2DL 4WFFE 4O5LL 2L7JA 2NY3D 5CSBA 5B4MC 5ENWA 5E9DB 1X7QB 4HX1B 4POZD 4HS6A 2HA1A 1HYSD 3ARZA 1WCQA 2WWMC 1I85A 1KN2L 1CTOA 2NCMA 3BKYL 4PV9B 1HNFA 4QOKB 3FFDA 3T65A 3DIFB 1BF2A 4LHUD 1K8DA 2CRZA 3HMWH 5D72H 4HIJA 1X3DA 1NH6A 3REVB 1HSAA 2VL5B 5DD1L 5CWSA 5IEKA 3Q48A 4M7LT 2AABL 2E9BA 1QFWI 3BQUA 1I1CA 4U1JA 2XN9B 2MMXA 3D1MC 1EO8H 2J7LA 1BVLA 3KDMB 5HVWA 4P3DA 4WWKC 1AGEB 4X6DA 2WLYA 1IEBA 1S3KL 1R3LA 4NOBA 5EZIH 2B1AL 2C5DC 3VI4E 4EI5B 4MXVE 5IVOA 2CKBA 3RKPA 1EPFA 2AK4E 3R1GH 1G0XA 2V5TA 5TQ0L 2ATPA 1G6VK 4XPAH 4ZUTA 5L8KB 4GKZA 3HB3C 3MRCB 1FGNH 4ZTPH 4MVBC 3D39B 4QYOA 2R2EB 5CEYB 3DMMA 3DYPA 1CQYA 5ESAB 3HNVH 4JCMA 4PRAA 2MQ3A 3EOBA 5JW4Q 5CUSL 5MP6H 5C9JB 1KTKE 2N7AA 3MRRB 3DI2B 5FYKL 3QAZC 3CFEA 1FZMA 2F74A 3X11B 2OK0L 2HJKA 4DKFH 4NQCB 1UEMA 1ETZA 4ONHB 1I1AB 4ZO8A 4ZUSB 1OP5K 3RDTD 3EOAB 3P3YA 4NQVB 4JFZL 4XHJC 3X17A 4JLRA 4H8WH 1WT5A 4Y2DB 2EEDA 3U7AA 4QRSB 2NZIA 3A6BH 3IKCA 4RSVA 3VRIA 1KELH 4MAYA 1CTNA 1YDPA 4GKNA 2QHRH 3Q3GA 1JF5A 4MDIA 3HI6L 1J86A 3LKPA 1O5DT 4XT1C 5F88A 2M26A 5TF0A 3NACH 1MCNA 1BQLH 3ULUD 1AC0A 1MQ8A 3TCLA 2CXKA 1LHZA 2GYSA 2XG4A 1H3PH 3MJ6A 2A73B 4GG8A 3X3FH 5EPMB 4PJFA 3EYSL 2RFXA 1F8TL 1MH5A 5DI8B 2Z93A 3IXTB 1PG7X 5JZ7D 3H9SB 4OQ1A 3GJFH 1P4LB 3TNNA 1QR1B 4KU1A 5F7DA 5DC9B 4O2FB 4HZLB 4HFWB 4JDZB 4CMMB 4L1DA 5IR1B 3HNSL 4XMKH 3ROOB 4X5WB 2OXHA 2A9ML 3C60B 4HG4J 1FFNB 2OTWB 4U1LB 1NDGB 2HVJB 4S0SD 3ZKSD 1KJMA 5L2JA 1T22A 2F5BH 4UQ3A 5IROC 2ZKHH 3OGCB 5IG7B 3IU3B 4DUWA 4PUBH 2JJVA 4OLVH 1NGPL 1L4IA 4X6EB 1I4FA 4GBXB 2ARJA 3P9WB 4CNIA 1B9ZA 4WENB 1BJMA 4Y5XC 5FGBC 4KDWA 5I1EH 1GC1C 3QUYC 1KCKA 1BZQK 1MWAH 2V9TA 3W2DL 4C57C 1AQDB 3VXSA 5JHDA 2VDPL 5FA4B 1QBAA 3TN0D 2YBRB 4G9FA 1U8IA 3IDXL 5JXAH 3F12A 4P2QA 2VDLL 4MJ5A 3FN3A 4JFFB 3TVMA 3VXQB 1B3JA 2W0LA 3PJSA 1NCWH 4Z7OF 2VNCA 5TPWH 1XF2B 1RZGB 4F57L 3WEXB 2FX8L 3RTQC 4Y4HC 2GJ6D 3NIFF 2KQNA 3D5OF 2I5YL 5DVKA 4R6UA 4HKJA 1DJSA 3TT1L 2F58L 3QO0B 3O2VH 4IRSD 4U1HA 3KPOB 3SOBH 3LQMA 5JMRA 3GO1L 4QNPF 1A47A 4YHKH 3CVIH 3RHWF 1OAZL 5D9SB 4JO3H 2NX5E 4P4KD 3QUZB 1TVHA 4L8BA 4F7MB 4J4PD 4FQXD 1UWXK 2DICA 2H45A 1GOHA 43CAB 1GL4B 3D3VB 1UWGL 4CW1A 4YH6A 3G5XB 4RFNB 3UTTE 4NQDB 3K8MA 3TZVC 1JPGB 4YX2H 4Z7WE 3CH1B 5D5ME 1OP3K 1R3IH 2AXGA 1JTTA 2CDGA 4XP1L 4RNRB 1FL5B 1OM3H 4HV8B 4WU5B 5DMJB 2YXMA 3O45B 3OTTA 2GTZA 4JDVB 3MRBB 3EZJB 5T33L 3PHOB 1A6ZA 1EHAA 4YAQA 3MLVH 1T0PB 1TMCB 4NGHH 4WRLA 4NRZB 3PGDB 5EA0H 3DX7A 4DGYL 1CK0H 1K2DB 1RULL 4K71B 2M8XA 1DBKH 3O3DB 4NSKB 2B4CL 2X2YA 4WFGD 2NNAA 2HMIC 3KPQA 4GQ9L 3G5YA 1FNAA 1MEXH 2GK0B 3BP7B 1PG7H 4S1DC 2FJHA 4L3CA 5FF6B 5DHVA 3VXUE 2I60L 3GBNH 5HDOA 3QUKB 4LSSH 5T1LD 3QRGL 3OR7A 3GM0A 1KYOK 3H9HA 1CG9B 1MJ7H 2GJZB 5KVEL 5IB2B 3BZDA 2BVTA 1BVKA 2ICWI 4XI5D 4GRMB 1G0YR 3LMJL 4FP8L 1MJ8H 3T4YA 3WFHA 1DANU 2H2PC 3WKNA 1GC1H 2AEPL 1JPFB 1G7HB 2AV7B 1B4JL 1X4XA 5E9DA 2GK2A 1FYTE 2AJXL 3UTSA 4TUKH 4OZIB 1I7RA 3GSXA 3DVIA 4HIHB 2OR7A 4XBGB 2NYYC 5EC2A 5D2NE 4OFYD 4XNXH 4NQXB 1FCGA 3KYAA 5DUPH 4DQOL 4QOKA 3N0PB 3QQ9D 4X6DF 3DIFA 5DXWA 5BQ7B 4KFZC 3DETC 4WHTB 4M6OL 3VWJC 3DVGB 1IGML 1C16A 1AD9B 1HCVA 1JWSB 1ZT7B 1G0DA 2NTFB 1T20A 4Y1AA 3UJTL 1UZ6E 4LSPL 3KDMA 3U36A 5IV2B 2PTVA 4P2CG 3MR9B 3B43A 4A2LA 5SWZD 1B88A 2FX7L 5B39G 4QHMB 4APQB 2R23B 3MJ8B 1I9RH 3RFZC 3QBTB 1A6WL 1Q0YH 1OD9A 3VMOA 3JVGA 1INDH 5LGKA 3ARBC 1DBBL 1A6TB 3CZJA 3WLBB 4Q9RH 3ULSA 5D71L 5EBLB 5KVFH 1YN7B 3DHJA 3D39A 4JM2B 2PN5A 5HYQB 1F6LL 2R2EA 5CEYA 2DD8H 4KI5C 5M94B 1T7WA 5C0RL 1ZGLP 5CJQL 3BE1H 4YFLI 5GISH 5E8EA 4HH8A 1GAFH 2IH3A 3QNXB 5ANME 5HI4C 5TGBB 5C9JA 1JRHL 4LPUA 3MRRA 4WO4C 1A5FH 4MGXA 3SDCD 1FZOA 2X4TB 4G9DB 4K9EC 3X11A 1BFOB 1NPUA 1S5IL 5CP7B 3GMNB 2JJTC 3B9DA 3DNKA 2Q8BH 3O6FB 2J88H 3PWVA 3T0XA 1FL3B 4NQCA 1HILB 3I85A 1G9NC 4K3DH 4ONHA 5AZEL 4LPWA 1Z6JT 4ZUSA 1IEHA 4KROD 2YD5A 4KRPB 2YD7A 4NJAL 4NQVA 1SYVB 5FO9A 2I07B 1JUFA 5LCVH 4QRSA 1A7RL 5D1QB 1EHNA 4Q74A 1CGWA 1W0YT 2NY0B 1C5CL 5I8KL 4AK1A 5MEOB 1PY9A 4PJFF 4WUUE 1KNOA 2NXZC 1C8PA 4UTAL 1F3JA 1BEYH 1NMBL 1UCBL 1NGXB 2F5AH 5KZCD 1BD2B 1KPVB 2XIDA 4U6VH 1A21A 3QEUA 3VA2C 4PGDB 5ICYB 4CDHA 4ALAH 3IKKA 3S3SA 2VYRE 3OKDB 1LO2H 2ILLA 5EPMA 3HRPA 3B2VL 5E6IC 3RPIB 1YEGH 2AV1B 5C0AE 3IXTA 4NRYB 1KCVH 4OD2A 3H9SA 3MUY1 3RY4A 1QR1A 5SWSA 2Z91B 3FO0H 5DQ9B 1J5OL 4MQXC 4J3VA 2NTSP 3QDGB 4O2FA 2W9LA 4HZLA 3SGDI 4HFWA 4JDZA 4CMMA 5ID0A 3GFUA 1OAQH 1SY6L 3ROOA 3CX5K 1A6AB 5DVOA 5AEAA 4K8RD 4U1LA 2OTWA 3EFFB 4KKBD 3DXAB 4RA3A 5JXEA 2VH5L 1CLOL 4ZFZB 4W68A 5D7IE 3OGCA 3IDMB 3L5WB 4XBEH 3IU3A 5HJ3B 4HK0A 4BK5A 5IJKC 2R0ZL 4RWYH 3NCEB 4GBXA 1I7ZB 2R69H 3HC0B 4XVTH 4EN3A 3UTQA 1MRFH 1T1WB 3QEGL 5I73B 1LK3H 1ZLWK 1A1OB 1MCPL 2LVEA 3LHPL 1BQHB 4ELMF 5HPOA 4Z0BH 4F33A 1FIGL 3RZCB 4R97B 3FOLB 3MLRH 2EO9A 1AQDA 9CGTA 1QFWL 4ZOCA 4HWBA 5GGSB 4ODTH 3RGVA 5FA4A 1JZ2A 2YBRA 2FGWH 2WQ8A 3GGWB 1XF3B 4NKMA 3W39B 4JFFA 4KJPD 3VXQA 1CVSC 1FAIH 3BRDA 4M5YL 3C6SB 3QWRD 2ZSWB 3HHRB 4IMKA 1RZGA 1G7QB 1XGTA 1XGYH 3WEXA 3JBG7 3VFNB 5E8NB 2BHZA 1G84A 2DQIH 5DMIL 2EIZB 4N0UB 2IANA 3QO0A 3BIKB 4K9EH 1MFEL 3KPOA 2V2TA 1E6OL 4JFDB 1MREL 2FX9L 5IVNA 5K9JL 1G9NH 2A74B 3JUZA 3QUZA 3QZWG 2BVPB 1WWBX 4JPIB 4F7MA 3KLHC 1XAUA 4LFHD 2VDRL 1OHQA 1KULA 4NO2B 3H3PH 4R2GC 3FRPG 5KAQF 4GAJL 5BOZG 1JPGA 1JGUL 3KPSE 3P4NB 3BQUD 3CH1A 4HIXH 4NZDA 3FQNB 1CR9H 3V5KB 4UT7H 4RNRA 2XWBB 2RR3A 2Z35A 1NEZG 3QIBC 4WU5A 4OD3H 3IFOB 1N3NB 4JFOB 3WLWC 3O45A 2AW2A 3JV6B 4KQ4L 5DR5L 3ZTJG 1YNTB 3RVVC 3PHOA 1EMTH 1VPOH 3MV8B 1A2YA 2NZ9D 1LD9B 4X6CB 4XXCC 2NY6C 4NRZA 4XNZC 3ZE0E 5AAWA 3H7LA 2VUOA 4BQ8A 2NY1C 1NDMB 5EBWB 3O3DA 3O2DA 4NSKA 2V2WB 4JFHE 4XHQA 5EDXA 3DMMD 3MLPA 4CRPA 2R56L 2AJUH 4U49A 4UT9L 1I7TB 2XKNB 5DD6A 1UA6L 2GK0A 3BP7A 4Y16B 6CGTA 3MFFB 4L8SC 4PJBB 4MAUL 4JFYB 3QUKA 3KPMA 2AS5M 1VFBA 4ETQB 5C0FA 1NBYA 1J12A 1N59B 3RVXC 2QR0B 2B39A 3QULB 5DRNA 5E8OB 3WDHA 5IB2A 1IE5A 3HPJB 4NT6B 5DRWB 1C5BL 3FCTB 3P0GB 1BGXL 2J6EL 3RJDA 4L4TB 2Y5EA 2YXFA 3HMXL 1A9EA 5ICXB 3IDIA 1DSFH 1TJHH 3GSVB 5TFSL 1T7XA 3QUML 1N0XH 3ORJA 4P99A 5C0ND 4YHPB 3S8WA 4U7KA 1LP9F 1JPFA 4GAYA 3VH8G 2AV7A 4MAYD 4ZD3L 3GK8H 3SDXE 2YRZA 4PRHE 4OZIA 1RIVH 4FXGB 4HIHA 1AIFA 2HT2C 3I50L 15C8H 1RIHH 2EKJA 1EVTC 2FO4B 4PJDB 2AJSL 4TYUA 5IHZB 1JCKA 4OJFH 4Q2ZA 1JZ7A 5BQ7A 2QEJA 4JVPA 5C0BE 1QSFB 5D96C 4HF5L 3DVGA 1QFUL 1AD9A 4QHLA 4MNQE 2ZUYA 2WZPD 5JOFB 1MCRA 1R3JB 4PJ8C 5B8CC 4PJ7A 1ZT7A 2VISA 3TWCL 1ZHBB 5IM7A 1T5WB 2Y5TB 4DN4L 3CIQA 4TPRL 3FL7A 5CD3B 5EU5B 4JRYE 3V95A 4JM4L 1S7UB 3MR9A 4ERSH 3ZKMC 4KV5E 1H8OA 3ZSTA 1ZWIA 1AP2B 4U3CA 2ED7A 1WC7B 3J7HA 1VGKB 2E9WA 5INCB 3DARA 4X4ME 4APQA 3ZSSA 2W9EH 4F9PA 5GGSY 4BSJA 4GLRH 3OQ3B 3D2UB 1A6TA 2MSPA 3WLBA 3VFTB 5EBLA 4JM2A 3RWCB 2KKQA 4L5FH 3VW3L 4X7EC 5I1AB 2H8PA 4P2OC 3QNXA 5KVDL 5TGBA 2UUDH 4I3SL 1KYOJ 3N9GL 4G9DA 3VXSD 5JHDD 3WXVL 2DQUH 5CP7A 1IC5L 3GMNA 5FHBH 4UTBL 4G9FD 2GAZB 2UY7A 4FQLH 5DLMH 4C83A 3BKCH 3TVMD 2PYEB 1FV1B 3DV4B 4XZUB 3ZYOA 1QRKA 1NGYB 1SYVA 2IJ0C 3WDJA 4FMFA 2F54B 3C2AH 3K81A 4L9LA 5MHSE 2I07A 2IG2H 3FHQA 3FZUC 4LDOB 5EZJA 2VMFA 1RUQL 3LN9A 1HQ4B 2APFA 2X1WL 2CLVA 2EKSB 1KLGB 1D5ZB 3UZQA 3EFDH 5I71B 4RMSA 1I8MB 3OKMA 4LEXH 5HDBE 2YUVA 4HAFA 1KPVA 2WK2A 4DZBB 3NCYP 1BIIB 2J1KA 2Z31C 5ICYA 1LEIB 4EXPX 4NO0B 3MCKB 5C0IB 4TVSa 4U7SA 1IQWL 2OXGA 3OKDA 2XG5A 4R90L 1UFUA 4H20H 5E8PA 3T3PF 4S11A 1HKLL 4NKQB 3RPIA 1H5BA 2VABB 1L7IL 4NRYA 5SX5H 5IW6A 1H3GA 4Z7QE 5INDB 2OZ4A 2A9NL 3G6JA 3M8OH 1GGCH 5ACLA 4OLZH 5F72S 1FRGH 4HC1A 4GH7B 3CLEH 4MXVF 2HJLB 1MCDA 3FQWB 5J9PB 3ZKQD 1U3JA 5FKPB 5CEZE 1NGZB 3QIWB 4WEBL 3GMQB 4ZFZA 4V2CB 5F7MC 3L5WA 4JR9L 3P4OA 3NZHL 3BKYH 3OAUH 1IEAB 5HJ3A 4KHTH 2NY2D 4HZAA 3VG9C 3D9AL 1I7ZA 3HC0A 1T1WA 2AJ3B 2Y4SA 3MROB 1A1OA 1VFMA 1HIML 1BQHA 3EO1B 5DD1H 4NZUH 3RZCA 2AABH 3VWKB 1YEEL 3MPCA 2CMRL 3GHEL 3HI1A 2EYRA 4PRIE 3MO1B 2ZCKL 5A3ID 2BVEA 2KQMA 5GGSA 1CXIA 3QH3B 3V8CA 1S3KH 4DN3L 3GGWA 3GRWH 1IAKA 5JIPA 3V4PL 2H32B 2R1XA 2B1AH 1F00I 3PDOB 3MXVH 2YD6A 3C6SA 5D2NC 3OKKB 3KXFE 4HIIB 3ME0A 5KSBB 1KEGL 4JFEB 4LLDB 2DS4A 5E8NA 2D7PA 3SE9L 1NCAL 3VFNA 2AK1L 3SY0A 2AKRA 2EIZA 5BZWB 4N0UA 5KVMC 3BIKA 1HI6A 4K07A 4LLUB 3AS2A 5E9DD 3UTSD 4CVUA 4WEMB 4G80B 1YJDL 2A74A 5LXGL 1ACZA 4QHNB 4QOKD 3JV5A 4JPIA 2X4PB 4WHDA 1VHPA 3H7BB 5CUSH 1J8KA 3VXMA 2HWZL 4WI3A 4NO2A 3GEWB 5FYKH 1U8NB 4L4JA 2HFFB 2OK0H 2NMSA 3I9GL 3K4DA 5KS9E 2XN9D 4Y1AD 3EO0B 1FC2D 2ATKB 4LASL 5A43C 2XWBA 4FTVE 3IFOA 1N3NA 2D9QB 1X5YA 3JV6A 1OAYL 4JFZH 4EBQL 1YNTA 1BJ1J 5TE7L 3MV8A 3FO2B 3NA4A 1TQCC 1W0WB 1LD9A 4RGNE 1GOGA 1GXEA 5DWUH 2YPLB 2O26U 3SE8H 1ROWA 3QUMB 5K59E 4Z9KB 1T03L 5EBWA 1MIEL 4KMLB 4QHUA 1DCLA 1OB1B 3D39D 1LE9A 1ZEAL 5AZ2L 4S1SH 4I5BA 3V4UL 4FABL 5ESVB 1I7TA 1Q72H 3BYTA 3H3BC 4GKSB 3TA3B 5C09A 4Y16A 1DBAL 2F53E 4PJBA 3QZWA 4JQXC 4QXWA 4JFYA 3FO1B 1PJ9A 4OZHE 5B38B 3TZVB 1IM3B 4ETQA 5IEHB 1CQKA 3FRPA 1N59A 2ZUWA 4JRWA 2B4CC 1W72L 3QULA 4F15C 4RAVB 5E8OA 4NQCD 5EU6B 4WUKL 1NANI 3INUH 4NT6A 5DRWA 4OZIF 3FCTA 4Z7VA 1NEZA 3K1DA 3LSOB 3SGEI 3HNSH 2AEWA 1WCBA 2A9MH 4WV1C 2W07A 4UT6L 4DTGL 1HWHB 1U3HA 5E1AB 4W6YB 3PIQB 5CIPA 4FQHA 2DI7A 1PLGL 1MVUB 1NGPH 3HFML 1K4CB 1QA9A 4FXGA 1QFPA 5DD3L 4XMPH 5CSZA 2GTWB 4JKLA 5JQ6L 2FO4A 3CJJA 4NZTL 3IDJB 2G60L 1QSFA 3CDYA 3W2DH 4G8GE 1GIGL 3CSYB 2VDPH 4JN2A 4S2SB 5HHMB 3B9EA 2H1PL 5LWYL 4LEOA 3QI9C 2NY4C 3AREC 3H9SD 2BVOB 1FE8H 4FG6D 4YEEA 5SWSD 4FQIL 3CGTA 5HD8C 5EIIB 4NO5A 1S7UA 2WNGA 4F57H 1JHKL 3WNMA 4GJTB 1WC7A 4PJEE 2I5YH 3GMOB 1VGKA 2JB5L 5GZND 3TT1H 3C60D 4HEME 2F58H 5C0CA 4HJ0D 4G6AD 3GO1H 4QRRB 3KLAB 1OAZH 5I2IB 4TTDC 1KENL 5C3TA 2CO7B 1BBDL 3RWCA 1G7MA 4NC0B 4S1QH 2BSRB 4CBPA 3AFLA 4GBXD 1KUMA 4JQVC 2O61A 4EN3D 5I1AA 3S4SG 4I3GA 1OGAB 4HJJL 1OF2A 1MY5A 2VR5A 4K2UL 4XPFL 4OZGB 3BXNA 3QXWA 5LG1A 3RGVD 3RZWA 3F6LA 4HCRA 4IHOB 4WWKA 2GAZA 4JFFD 4FS0A 2PYEA 1FV1A 5T33H 4KJWC 3W0WB 2ADFH 1YUHB 1RHFA 3QDMB 1TCMA 5FYKU 4XZUA 4QY8A 4JY4B 2ESVE 4RGMC 1CDCA 3ZO0A 3FT4A 4AJ0A 3LKQA 5I75C 1HQ4A 1RULH 4ENEC 2B4CH 1WICA 4Z0XB 3G6AA 2EKSA 5DUML 3VXTB 4I0PB 2J4WL 3BPOB 3BWUC 3ULVL 3T3MF 5JPNB 1I8MA 5CZVH 2F8OA 2AGJL 2P5EB 3QUZD 4HPOH 5L2KE 3IJHB 4K3EL 4M61A 1FNEB 3THML 4DZBA 3GMPA 4FFYL 5CGYD 5DSCB 1BIIA 1LEIA 2VQ1A 4L3AA 4F3FB 3MCKA 5C0IA 4MJIB 2GCYB 2VSDA 5GS0L 4NQDD 4UB0L 5DC4B 4LKCB 1T0MA 2GY5A 4J3TA 1J0HA 3C8HA 5KVEH 1MAJA 3BZFB 4JG0L 4LCYA 4HUUB 1NC4B 3LMJH 1IAOB 4FP8H 4OZ4A 4ODHH 5H35B 2P1YA 3KNBB 3MNZB 4OFKA 1BECA 1Z5LB 2FBOJ 1TZHA 2AEPH 3V0AC 1U8OB 1B4JH 1W8OA 4HS3A 5FKPA 1NGZA 4AT6A 3QIWA 1MJJB 3GMQA 4HDIB 2ZCHL 3NGBC 1T0NB 1UGNA 2NXZB 3REWB 1M71A 4BH7B 1NKRA 4JAMB 5D2LB 3RKDC 2XTJB 3EDJA 1QEWB 4NZRL 3K46A 4TSBH 2AJ3A 2UWEA 1G1YA 3B3IA 4PPTA 3CDCA 2JLLA 4URTB 1IKNA 3EO1A 3L3IB 2R8SL 3CK0L 3MNWB 1MHHB 4CVZB 1MY7A 5F96H 1F45A 2X10A 2X5PA 3UJTH 5E4EC 1F6AB 1JHTB 2DQDL 4WHCA 1V5JA 3VGBA 4C59B 2CH8A 4FMKA 5KVGL 2HKFL 3UPRA 2H32A 4CUCA 2E8ZA 1BZ7A 2H26A 3WIHA 4MB3A 1U95B 1BBJB 2FX7H 3LVEA 2PETA 3OKKA 4Q9BA 4HIIA 3WSQL 1MCKA 1ZS8A 2A6JA 4QRPE 4JFEA 2R1YB 3IDGB 2CRMA 4X9GA 4P23B 4Y5VC 4YXHL 4W70A 1DBBH 1MLBA 4LOUC 3V5DA 4M1GL 5E8DH 4LLUA 3MOBL 1S9WB 5T3XL 3FO9B 1I9IL 5KSVA 2DJ4A 2IPKB 2Z8VC 5C0RH 1MFBL 4G80A 4NRXB 5CJQH 4GXUN 4TUJB 2M2DA 3QPXH 5KTEH 3TYFB 2R9HC 5HDQH 3VXOA 3H7BA 5IW3A 4MWFA 1Z0MA 2I9LA 3C08L 1JRHH 5DJXB 1MPAH 4TSAH 4Y5XA 1OPGL 1U8NA 3QUYA 1ZT1B 3C5JA 5E5MA 1S5IH 2JIXB 2NPLX 4X6CF 1C5DB 5LBSL 3QA3B 4IM8A 4DOHB 2XACC 3EO0A 3BEWB 5FYJL 5FYKD 2FR4A 2ATKA 2G75A 3RY5A 5AZEH 2KBGA 4HUXB 2VXSL 2ED9A 5SX4H 3TF7C 2QKIA 4NJAH 3HR5B 1KIRB 4LCWE 5CD5C 2OI9C 4ZPVB 5DZLA 1A7RH 5EUOB 4YWGH 2J6EA 4Y4HA 4GMTL 2VAAA 4APQD 3HMXA 4X6FA 5ID1B 3MLSH 1C5CH 5I8KH 3QUMA 1U8PB 5D7IF 7FABL 4JHZA 5HVHB 5C0JA 4UTAH 4OGAD 1NMBH 1E4XI 4JM2D 3TIEB 4PP1C 5J06A 3IYLW 3T08A 4GKSA 4F9LC 4XNMB 1XIWB 3PABB 2DIAA 1CD9B 2GJJA 3WDIA 5GIRA 3OXSB 1D9KB 2ID5A 3FO1A 1S9XB 1EBPA 3B2VH 2Z8WC 4UINL 5B38A 3TZVA 3HE7C 2FWOB 1FFPA 3O6FD 2APTA 3H6JA 2J8UE 4RAVA 1I8IB 1J5OH 5EU6A 5AD0A 4Z77B 4PRDB 1FG2A 2MKWA 1F4YL 1FHGA 2WIIA 5CFHA 3BJLA 3DGGB 2ZUTA 3RVWC 3V0VB 4LLVA 1SY6H 3V2AR 3LSOA 4MA8H 1IMHC 5KSAB 1G7PB 2DQFB 4PJDF 1CE6B 1ZA6B 1VADB 5EO1A 3TPKA 2VH5H 1CLOH 5D1QD 4X98B 3ARFB 5E1AA 3TV3L 1J0YA 1NCUA 4TTGA 3PIQA 4X7FC 4Z5RB 2ICES 3MACL 3QDHA 1KFAH 2D31B 3KYMA 1K4CA 2R0ZH 1LO3L 5T1DH 2GTWA 1U36A 3EDKA 1JBJA 3V5HB 1MCPH 5DS8B 1A1NB 3IDJA 4GUPA 4HWEL 4EIGB 1QSVA 2R0WL 1OAUL 1ZMYA 3BGMB 4OD1H 3LRGA 4HGWB 4Y5YC 2FHBA 4ELKA 1WK0A 2R2BA 5ALCH 5B3JE 1SBBA 1QFWH 3CSYA 1HHHB 3KPRA 4S2SA 4WNQB 1L9NA 5TH2B 5DMGC 1J8HA 4HIEB 2PXYB 4M5YH 2VTFA 3UBXI 5I6XC 3W9DB 3QDGD 3ARDC 4MA7L 4DJMA 1BX2A 2Q3ZA 3EHBD 1YPZB 3BFOA 3VFUB 4YR6B 3DXAD 1MFEH 2HH0L 4KKAD 2Y36L 4D9QE 2QADB 3UJIL 1F3DH 1CLCA 2FX9H 4QRRA 5K9JH 3KLAA 4H1LB 5I2IA 5T3ZD 1Y6MR 1YYMH 4Y19E 3FQXB 1CGYA 2VDRH 1J18A 4R4BB 1DTUA 1RZIB 1OGAA 3EDFA 3SKOB 4D9RE 3VWJA 1RK1A 3RZCD 1NMCB 4EJ1C 3P9LA 5JLZB 4OZGA 1KC5L 3OG6B 1YMMB 2V9RA 2FSEB 1QD0A 1WIPA 4FFWC 2QSTA 5IQ9A 2FRGP 4LLQB 2D03L 4YHYC 4KQ4H 1UEYA 4WW2C 4X83A 2YPKB 5DR5H 5GRVK 3RBGA 1GOFA 1OT1A 1AKJA 4UI2A 1JTOA 1YUHA 3QDMA 5F71A 1QBBA 3NTCH 2ZUQC 1MCLA 4JY4A 5C2UB 4KK8D 1ZLUH 2VDML 2C1PB 3MV7B 4LVOB 3SDXF 3ARBA 1GGBL 1OTSD 4Z0XA 4PJ5A 5AUMB 2X4NA 1A7QL 3VXTA 5IWLC 4UT9H 4KK5C 5GXBB 5JPNA 4JPVL 2HT4C 3LKRB 3EOTH 4MAUH 1DEEB 3K0WA 2W59A 3S4SA 2GCYA 5DZNA 4JKMA 4TRPL 5I1CL 5DEZA 1DVFC 4LKCA 1MHEB 4RGNC 1JZ3A 4XVJH 3T2OA 4JFPA 1NFKA 1C5BH 4JCLA 2KUTA 1BGXH 2CUMA 2X4QB 2XPGA 4W4OC 1OTUC 3WN5C 3KNBA 5F89B 5TFSH 4J3UA 1GZPB 3M1BA 1E27A 3MV8D 4M7ZC 4NN7B 3O3BA 4EDXB 4MDJA 4QXTB 1KGCD 1P7KB 3HN3A 4U1NA 1U8OA 4MD0A 1FNGB 1U8MB 4IDLA 3DROA 5F6IC 1OW0C 4R4FL 3DOSA 3TC9A 3UYRH 2AEIT 1NC2B 4F2MA 3F7YA 3I50H 2B7DT 2LAGB 4PIRF 3REWA 4BH7A 5D7LB 1SJHA 1OWRM 1QEWA 2ITDB 4HF5H 5C09D 3PXJA 5IFHH 4Y16D 1QFUH 3P77B 4OQTH 3L3IA 1JMZA 3MNWA 1MHHA 1KTLB 5ADOL 2MQ0A 4DGIL 2FB4L 5L0QC 2WANA 3EYOA 5KSBF 4PJ9B 4DN4H 1AO7B 3UXFA 2ZPKL 1F6AA 4TPRH 3OAZH 3JWOC 3MLYH 3QJHB 3SHSA 3CFCL 4JM4H 2EE2A 2OTUB 3MRKB 1BBJA 3TBWB 4L4TD 3UMTA 3UP1A 5I0ZA 4OLWL 2R1YA 1UKTA 2B2XH 2C4XA 3IDGA 2FEEI 1OWWA 3NCMA 1L0QA 1U3HD 1UH3A 5F70A 5IOPB 3RU8L 5F9WB 1S9WA 3VFOB 4IRJB 4X7TB 1U91B 4CDGC 2IPKA 4DUVA 3VW3H 5TE6L 1KJ2L 4NRXA 3PWNA 4CU7A 2IH1B 3IF1B 1Q9OB 5HTSA 5IJKA 3GJEB 3TYFA 1ONQB 5T1KB 5KVDH 3TNMB 5E2VH 1QSFD 5DJXA 4I3SH 3UTZB 5DJCA 3LQAC 1FLRH 4B7LA 1ZT1A 1CFQB 5H37H 3R06A 3ISWA 4UUJB 5J57B 5BRZB 1C5DA 4UTBH 3QA3A 2R2CA 1UACL 3BEWA 5IBTL 1CDYA 4P46B 4HUXA 4EQ3A 5C8JA 4TNWF 2ADGB 5HPMB 2BNRB 2BNQE 4WTWA 4PLKD 3HR5A 3TFKC 3F58L 4ZPVA 3CFJB 3E2HC 3P2TA 1B2WL 2HRPL 5L9DL 1RUQH 3A6CL 1YEIL 3NABL 4PGBB 3RVUD 1J11A 4ZSOE 4YGAB 2AXFA 5ID1A 2LTQB 4JRXE 4ZUUB 1H9VA 1A6VL 4NHUA 5C0CD 4F7CA 5F6HI 3OJVC 3D2UD 5A16A 3DRTA 4HWNA 1CBVL 5JMOC 5JR1L 4OFIA 2FHCA 2APVA 1I3GL 4GW1A 2ZUSA 1BP3B 2V5YA 4Q9CA 3WS3A 4XNMA 5I8OL 1XIWA 3PABA 4KKCC 5DVNA 1H3VA 5HHOB 3BH8B 3NIDF 1IQWH 1EEQA 3OXSA 1II4E 1D9KA 1S9XA 4R90H 1CXEA 3Q1SH 4M7KL 2FWOA 1PD6A 1L7IH 4UOJA 4NPYB 1FSKB 5FUCE 2R0LH 3LDBC 4WWKD 4Z77A 3QIBA 4O2CB 4PRDA 4PBVC 5EG6C 3SKJL 2EDWA 2PYED 3DGGA 1X5JA 3WL9B 3V0VA 1QR4A 3O0RL 1FFRA 1G7PA 2DQFA 5DD0L 2F54D 1VADA 3P9MB 5E5RB 1EV2E 4MQ7B 4PJAE 4ZS6C 4X98A 4XXCA 2XQYG 3MUJA 1I9JL 5KOVC 2HAZA 1YYLL 4JR9H 2JJSC 2D31A 2GT9A 3HB3D 1QO3A 1WFTA 3D9AH 4FFVD 5E94B 2NXYC 3WXWL 4NM8L 3V5HA 1YEHH 1H3XA 5DS8A 1A1NA 4NQEE 1A7BA 1J1PL 4M4PA 4R4NC 4U05A 3BGMA 4HGWA 2MKLC 4NO0D 2W38A 3GHEH 4YDIH 2ZCKH 2VLJE 1HHHA 4OI8A 3VGEA 3I6GB 1KBGL 1M6OA 4WNQA 4BQ9A 4ZAKB 1F58L 4CVXB 3L5XH 1ZA3A 1MVFA 3AUVA 3V4PH 4HIEA 5HYJE 1K3IA 2PXYA 3MBXL 5GRJH 1J7VR 3W9DA 1KEGH 4XCNA 4X5XB 3SE9H 1BWWA 4XHJD 2PO6C 3LQAH 1GCFA 1QVOB 3GMMB 4KJYA 3VFUA 4UIMA 4YR6A 3QIWD 2IAMC 5TQ2L 1I9EA 1OGTB 2VXQL 3MNVB 3DUSA 1YJDH 1TQBC 1MNUH 4QGYA 2KL6A 2XZAL 3FQXA 2BX5A 3VFMB 2HWZH 1NUNB 4KZDL 4Q9QL 4AIXA 3SKOA 1IGCL 1PSKH 3VWKD 3MRHB 3I9GH 1ADQA 1P53A 1R5WA 4KKNA 3HE6C 4PJ8A 5B8CA 1HNGA 1CLYL 2MCG1 4LASH 4IEFB 1F2XK 4E41E 5DTFB 1JYWA 4PP2A 4XB7A 1GPOL 4DKEL 5JW5A 3EJYC 4RMVA 3KAAA 1OLZA 5IUSA 2W9DL 3DYOA 3L5IA 1KB9J 1WZ1L 2HYMA 4LIQL 5B22A 3IFLL 5TE7H 4Z6AT 5DK3A 3U6RB 3CC5A 4NFCA 4JFED 2XZQL 4MNGE 2C1PA 3BD5A 3VU2A 5J1SC 2F19L 1ZEAH 5AZ2H 2AAVA 4PJCB 4L1HA 5AUMA 3V4UH 1NKOA 2CK0H 1RIUH 4AEIL 1ZVSA 3LKRA 1DBAH 1E6JH 3SKUD 1S9KC 1AI1L 1HE7A 3GIZL 3GMLA 5AWNL 5GZOC 2C1OB 4P2OA 1E4WL 5BO1L 4MS8C 5GS1C 3WHXB 3VDBA 3QUYD 1D7FA 4NN5B 4X99B 1W72H 1WTLA 4YHZL 3BKML 4WUKH 4KY1H 2P5WE 4I18C 4C56B 5TDPA 4EDWL 1EFXA 1W2KT 2PF6A 3V6OE 1WAAE 3HTLX 3PUCA 5JUEL 3SGDH 5J4MA 3ULUL 3DX6B 5JIHA 3B5HA 1HSBB 3MV9B 4D0BA 4EUPH 5F89A 4PJEF 1GZPA 4UT6H 5D2LF 1D6EA 2NX5A 3O8XB 1BLNB 1P7KA 4Y4HD 3W11C 3WJLA 1BMGA 4KC3B 2YPLD 1FNGA 1U8MA 3OJDB 5IFAL 3BN9C 2N7BA 4YFLF 1PLGH 5J1AA 3OKLA 3OPZL 2CR3A 4H26B 1NC2A 4M62L 3D85B 5BCAA 2A38A 3HFMH 5LQBH 2W60B 2BDNL 4FNLL 3TH3T 2VB5A 2G2RA 5KJRL 5JQ6H 4PLOB 4Z7WA 2W0KA 4NZTH 3RI5K 4PJXE 4WI4A 3RWJB 2G60H 2BOBB 2IGFL 3SQOL 4M93C 1KJ2B 3P77A 2ERJB 2Z31A 1X5IA 1GIGH 5C0DB 2ZJSH 4L4VE 1KTLA 2M1KA 4MA1C 3FONB 1JN6B 2YA0A 5D7JC 3TZVD 2YD1A 3NN8B 1AO7A 2HFGL 3W9EB 1BZ9A 1UKSA 4U0RC 4Y4KC 3ZDZE 4FQIH 1KIQA 5EU6D 3GUTB 3F7RA 2CDFB 3FTGA 3MRJB 1JHKH 4DEPC 5BXFA 2DL9A 3TBWA 4NDMB 4ONFL 4ZXBC 2JB5H 1D5BB 1U8HB 1EXUB 3A0OA 4NO3B 1Q38A 4KTEL 3U83A 5MEPB 3NPZB 4N9OB 3VXUA 1YEJL 2GFBA 2BVQB 2IEPA 5IOPA 2P8MB 2W92A 2N56A 4X7TA 1U91A 4PGEA 1JGVL 2JCCB 3T4AB 2HMID 1YNLL 1Q9OA 3IF1A 4XNYL 3GJEA 1ONQA 1K4DA 3UJJH 3AXLB 3PDDA 3TNMA 3CNKA 1BFTA 4XPFH 1BAFL 4OLYH 4CN1A 1IAIL 5EUOF 4UUJA 3KPRD 5HHMD 4OKVB 4EIZC 4R7NA 4UDUA 4YHOH 5TF1L 5KANI 3GIVB 1EO7A 4PJGE 4F37F 4LLMB 1FYTA 2ADGA 3FB8B 3I2CL 5F1NA 3VXPB 2BFVL 3SCMC 1MAML 4H1LH 2X4SB 1Q0XL 3MREA 1UXWA 3TBYB 2QQNL 4ZUUA 5DUMH 2J4WH 4QRRD 1QTYT 3ULVH 3DPBA 5DHYB 4PGJA 2AGJH 3FMGH 1F4XL 4QTIH 3QP3A 1F11B 3THMH 4H5SA 4WIQA 1SM3L 4FFYH 3QHFL 1F4AA 5AG9A 3D6GA 3O41B 4MJ4A 5EOTB 1PW3A 1OGAD 4Y7MA 1Z9SA 3VWJD 1PEWA 5GS0H 1A3QA 5GJSL 1VB9A 1R0AL 4HKBA 3VFRB 5SWQA 3O6LL 5EWIL 4NPYA 5J11C 4NWTL 4OGXL 3MBEB 1ZLVH 2K3TA 1S7QB 4OZFB 3NCBB 1AFVL 2CDEB 4O2CA 1IM9B 1K5NA 3WL9A 2FH6A 3WBDA 1FVDB 1Z3GL 5GGQH 1AKJD 5FB8A 3GSWB 3QDMD 3NFNB 4I77H 1HN1A 2YOCA 1JVKA 2A83A 1WWCA 3CFBB 3VD7A 2NW2A 5KN5B 2X4RB 4NC2B 5DJ8B 2WUCL 4GS7C 1I7UA 5ANMA 1LO5B 2ZCHH 2OJZL 3ARBD 5FUOL 1MSPA 1AD0B 5L7XL 1I3VA 4I0PD 3DJ9A 1F3RB 4NZRH 4OIBA 3HG1B 3WFEH 2MCPH 3VFWB 3BZEB 2R8SH 1T4KB 3CK0H 3B9KB 3O3AB 1JWUA 3S5LG 2X41A 4M4RA 3I6GA 4LBEB 5HY9A 1YPZF 1CLZL 4P9HL 3P4MB 4J3SA 5KVGH 3HZYA 2XWTB 5LGJB 2HKFH 5L6YL 3EYQD 4RISH 1IL1B 5JOEA 1CDIA 3ZHLA 1HXMB 5T5NG 4BM7A 4WUUA 3GHBL 3WSQH 4OCMC 4YXHH 2FEEL 4JO2H 3ULVF 1W8NA 1QVOA 5FM8A 3MOBH 5HYFA 1MCEA 5T3XH 2EEAA 3RX8A 1MFBH 3MNVA 1OTTC 2VQUA 3CFDB 2NXZD 2GJ6E 4DGVL 5C0AA 3ARWA 1ERNA 2ITCB 1RJYB 3GSUA 3C08H 1X6NA 3VFMA 5H94A 4YK4C 1SEBB 1RZFL 5F9AC 1OPGH 2VKWA 3KJ4B 4ZUWA 3MRHA 5LBSH 3S5LB 1JFQL 3MC0A 4UILL 1BJ8A 2UZXB 4RBPK 3B6SA 3ARUA 4YQXL 5DTFA 3QI9A 3AREA 4L29B 1U8KA 1MRCL 4FQQA 2PYFB 2X70A 3QO1A 3U2SB 4MQXD 1ZXQA 5GGTA 4TNWK 2E6PA 5H37G 5IB4B 2PCPB 4KDVA 7FABH 1CGXA 3OX8B 3CXHK 4BZ2L 4PJCA 3TO4B 2DWEB 4QHKI 1RUML 3KR3L 3QQ3B 4KKLD 1FO0L 3B8YA 1KTRL 4GAGL 4WFED 1MCQA 4I2XB 1X4ZA 4KXZI 3OKEB 1A7OL 4UINH 3BWAB 4WFGE 3WHXA 3SDAC 3RUGB 2HT3C 2JIXD 4FRWA 4X99A 1BFSA 4ACPA 2ZG3A 3U0TB 4YBQC 2L0DA 1F4YH 2X1PA 3P11H 4FFZL 4U1MB 3BKJL 3KLDA 1K85A 1DLHB 1ZANL 4LF3B 1G7LA 3B8SA 1TPXB 3UBXB 4YFDB 5EU4B 4UNVA 8FABB 5D6DC 4XCFL 1BLNA 1I3RB 4NQSB 3TV3H 2IADA 4G43A 3RWDA 5ACZB 5CINL 4RWHA 4H26A 3ZE2F 3D85A 1H8SA 1BREA 1LO3H 1PEZA 5DJDB 4MD4A 3KPSA 1T2XA 5FUCC 1CFNB 3OAYK 3RWJA 4HWEH 2R0WH 5JDSB 1XIWD 3M45A 1VERA 1PFCA 1Z2KA 4HUWB 2FNBA 3U9PL 1D9KD 4N8VG 3H42L 2CR6A 2EECA 3NN8A 1DVFB 3SGKC 3W9EA 4XWOC 1B0WA 4JKWA 4QXGL 1FJ1A 3G6DH 5DT1H 1IVLA 1ED3A 4FXLA 3WO4B 2CDFA 4MA7H 1REIA 5IIEB 3WN5B 3G04B 1MFDL 1IAIM 3VGFA 4NQTA 3DTXB 1XGUA 1X5FA 1NFDE 4PD4K 4D9LH 3NPSC 5KSAD 4M7ZB 1U8HA 5LGHL 1EXUA 4NO3A 2HH0H 2O5YL 3ARGC 3D0LB 1X6LA 5MEPA 3DVFA 4HSQA 3PWLB 3BT2H 4JFQB 2P8MA 3GKWH 5SWZE 4FQ2L 3IXAB 4GRLC 2HLFC 1EH9A 3QYCA 4NP4H 3G5ZB 4KK9C 4AMKL 5DRXB 1S9VB 1NJ9B 5IB3B 3QJFB 1KC5H 2DM3A 3LEVL 3WD5L 2Y1VA 2DQGL 4MX7B 5ITFB 5I30L 2XA8L 5GGRA 1EEYB 5ADPH 1JZ6A 4PB0H 4U3HA 4YPGB 3GIVA 2D03H 4JZJB 3HAEH 2Q20A 4LLMA 3ZLQC 2PXYD 1XZ0B 1U8JB 5E03A 1U3ZA 25C8H 4BKLB 1IC7L 1JPSL 2VLRB 3VXPA 1XCTB 2VDMH 1IKFL 2Y6SC 5FYJU 1DBJH 4N0CC 4JY5H 3TBYA 2C4FU 5CGMA 2QADD 1SVCP 4DKAA 1A7QH 1G9ML 2DDQH 4D0CB 1A6UL 2YEZA 3LS4L 4JPVH 5DHYA 1GGIL 3JSSA 1MRDL 1G6RB 5BV7C 4WTZG 3CSPA 5F9OL 3RL1A 5EOTA 1ZE3C 5DFTA 3QG7L 2CKBL 5HHVL 2VLME 4X6BB 3GKZA 4TRPH 5I1CH 5FGCE 3U0WH 1AR1C 3SE4C 3VFRA 2DYPB 3VJ6A 3ALXA 5MENB 3NIFE 1FAKT 3MBEA 1T66C 3DURB 1EGJH 3G9VA 1XGRA 1NANH 5GS0D 1S7QA 3TH4T 4ZOBA 2CDEA 3GNML 4U6YA 4JGJA 4GG6E 3S96B 2JK5B 2E5EA 1IM9A 3IJSB 4PBWD 3SGEH 2C3WA 3WUWB 1FVDA 1VGEL 3GSWA 4QNPE 1L0XA 5BJTB 3I3BA 1RZJC 5KN5A 2X4RA 2HTLC 3NAAL 1BQSA 4U6XB 2CLZB 4UV4L 5DJ8A 2IPUG 4CJ0A 2YKLL 4G6JL 4ISVA 5ISZB 1CICC 4NNYA 5HGAB 3BP6B 3T1FB 2MHAB 4EUPG 1M7DB 2NY7L 3HG1A 1H0DB 4PY7A 4F9LA 1TZGL 3VFWA 3V6OC 3BZEA 5FM4A 1LEGA 1T4KA 5ADOH 1AHWC 4KQ3L 1FP5A 3O3AA 5BMFL 4YHML 1HHGB 1JGEB 4JZOA 1UM5L 1Z9MA 1OP5H 4LBEA 2ZPKH 3EDDA 3ZYJA 3I75B 2VE6B 3H3KA 3CFCH 2XYCA 3IRPX 2XWTA 3TIDB 4HQQL 1CL7I 5EORL 3U46B 3OG4B 1HXMA 1W0VA 1TFHA 4KMTL 5D70H 1HK6A 3MLUL 4EI6B 4OLWH 1KJVB 1B90A 1P4BL 4XH2A 3SO3C 2NY3C 3P0VL 1X5XA 4EVNB 1Q9LB 2V2XA 4P0DA 4POZC 3MZTA 5KW9L 4XNQB 1HYSC 4K23L 1NC2D 3CUPB 2VWEE 3NFSL 2B1HL 3SDCB 3HC3L 4OV5B 4N0FB 3MLXL 5TE6H 1KJ2H 4DAGH 3CFDA 4K94C 5CJXA 5F7YC 5D7LD 3RX7A 1I3UA 1YEKL 3N1FC 1ORSB 2ITCA 3UX9B 2JE8A 1JHLL 2D9CA 1SEBA 3QQ4A 4Q0XL 4RCAA 2Z31D 5FV2A 4KROB 1FO0B 2DTML 4YC2C 4LCCC 4RDQF 3S5LA 1RQ5A 1AO7D 1UACH 1V7ML 1F4WL 1J9CT 1Y6KR 1R5IB 4AEFA 4PJCF 3T0EB 1CZ8H 5FYJD 2C3VA 3G08B 4YHNB 1B2WH 2HRPH 5IQ7H 2X9YA 3A6CH 4Q97A 1MI5B 1YEIH 5IB4A 1MELA 3MGTA 5KZCB 2PCPA 4X7DC 1MIML 4LNRB 2CK2A 4X6DE 3OJ2C 1A6VH 4IMLB 2HP4A 3VXUD 1CBVH 5JR1H 4HUMB 4HWUA 1I3GH 3V6ZA 5HGHB 3ZMRA 4PRIA 2YD4A 3R4DA 3TO4A 4ZNCD 2DWEA 3QQ3A 5I8OH 3SDDB 5F7KC 1NBVL 3ZDXF 5HI3C 2EH7L 4JO1L 1U58A 1T1YA 2UZIH 2YHGA 3TBVA 3IFNL 3L3HA 4YBLB 3UC0L 5IESL 1RZJH 4E42A 2YD2A 3LEXA 3OKEA 5C07B 3BWAA 4M7KH 1MCBA 2EXWD 4TNVK 3KXFA 4J2XA 3U0TA 5I17B 4U1MA 2XZCL 3SKJH 3O0RH 3RDTC 1FYTD 4NHCH 1DBML 3VMNA 2BNRD 4NNPL 5FA3A 1XR9B 4G6ML 2NY5C 4OM0L 5DO2D 3DECA 4MZ2A 4OF6A 3UBXA 5EU4A 2P48B 8FABA 1U8QB 4NQSA 4PS4L 1VFAA 1I9JH 3VDAA 3VXRE 1YYLH 2IQ9H 5ACZA 1G7IB 1UWXH 5EC1B 1QSEB 2DF3A 1NBZB 4XBPA 2ENYA 4G5ZL 2XFXB 4YUEL 3WXWH 4NM8H 5DQJB 4NM4L 4PTTB 5KS9A 1OP3H 3GDBA 3TLRA 5JDSA 3SJVB 4FTVA 3FFCB 3NCJL 5HHOD 3EKCA 1IILE 5DJZA 4OZFH 3MFGB 4LVNB 1N7ML 2CO6B 4ZFOL 4LMQI 1KBGH 2VITB 1DVFA 1F58H 1H3UA 5ACMA 1T89C 3MBXH 5EIQA 4LARL 4ZG1A 4YDVB 4M6NL 4HS6B 4WHYH 4JE4B 4W4OA 1DUYB 3TPUA 5IIEA 4PJFE 3WN5A 3G04A 2JCCF 4P5TB 4OI9A 2MOVA 3PWJB 1FQ9C 4Y4FB 3MRQB 3FFDB 2E6QA 3T65B 3P73A 1K8DB 4XC1L 2VC2L 3NCYS 2F53A 3O4LE 2X42A 3PWLA 5TQ2H 3QHZL 5IEKB 4BUGA 2GITB 4I4WB 3IXAA 4OZHA 3DHMA 1KLUA 4IOFD 1SHMA 2HKHL 3LN4B 4KZDH 4P3DB 5DRXA 1S9VA 4Q9QH 4JGMA 1KACB 4ZTOH 5DGRA 3VDCA 1I1YA 2Z92B 3QJFA 4HXBL 4PRBA 1MCSA 2XRAL 3UAJD 1JWMA 3TN0C 1CLYH 1R5VA 1V7NL 4ODVH 1ZLVK 1EEYA 1KV3A 1RUAH 5DA4A 1GPOH 4N8VA 4HG4K 1LDPL 2W9DH 4XAWL 4DFIA 5D4QA 2DKUA 4L3EB 1WZ1H 3IFLH 3DUUB 2GUOA 5F7EH 5L8JB 4PBXA 1U8JA 4CGTA 4QYOB 5EOCJ 2VZSA 2LVCA 2F8VA 4BKLA 2DMBA 2D7TL 2VLRA 2XZQH 1N5YL 1XCTA 5C0GB 2NR6D 5F7FA 1NAMB 3OB8A 1T04A 4ELME 1ZHNA 2F19H 1F42A 2FO1A 4X0KB 3SGJC 1E4XH 4D0CA 1ITCA 3CFEB 1GSMA 1FZMB 3B2UD 4YEFA 4P4KC 1NCDL 2HJKB 4FQXC 1YN6A 2R2HA 5C0AD 1AI1H 1G6RA 3GIZH 3L1OL 5AWNH 3WKML 1ETZB 4H0GA 4M8QB 5EFIB 1FBIH 3QFJE 5C3LD 4JLRB 3PE9A 4TULL 3BKMH 5T5FH 4QKXB 1UWEH 1VEPA 1QYGL 3Q5TA 1OLLA 1YQVL 1JTPA 5I18H 1NL0H 4EDWH 3DURA 4MAYB 2NY4D 3ARED 2EDHA 3ULUH 1QG3A 1YDPB 4GKNB 1LMKA 3Q3GB 4A2MA 4KDTC 3BPNC 3S96A 2BVUA 4XXDB 1MCWW 5F88B 4PD4J 1A3RL 1ZVHA 3AC0A 3MODL 4CJ1A 4JJHA 1CGVA