5EORH

Structure of the murine antibody fab 8e3 bound to the vaccinia virus a27 peptide 101-110
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
214
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGLSLTSYGVHWVRQSPGKGLEWLGVIWSGGNTDYNAAFISRLSISKDNSKNQVFFKMNSLRADDTAIYYCAIYYRYGAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTGSSVTLGCLVKGYFPKPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti vaccinia virus A27 antibody 8E3 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 38
structure length 214
sequence length 215
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorH02
4C54A 3ZLQC 3DVNB 1T21B 2DLFH 4YXHL 1IGIL 4M48L 4JRYB 3VXUA 2NW2B 3UJTH 3AU1B 3RWEA 3VWKD 4ZXBD 5ACZB 1K9TA 1RIVH 3L95A 4HUNB 1W0YT 2V5SA 1C12A 1MWAL 1HNGA 2PTTB 4LLQA 3EFDH 5ITFA 1INEH 4KDTC 5KVEH 3DGCR 3B83A 3RVTD 4ESKA 5E7FA 5JIIA 3QI9D 2OTPA 3SHSA 1UKQA 1H3GA 4Z77A 5C6TL 2EDFA 1A6WH 4O5LH 4HUWB 4NUJA 3VFPA 4R2GC 4PB9H 2X1XR 4LHQB 4JRXD 1KCRH 3WIIH 3UTZA 1NKRA 4OAWA 5FKPA 4UIKL 3P0GB 1JN6A 5CUSH 2J6EL 1C1EL 3WHE0 4U1MB 3KLAB 2H41A 3QDJB 4JANB 5JO5B 5IMLA 1FG9C 5T3ZH 4WHTB 4ORZC 1IAOB 3NZ8A 1U8OB 4PJCA 1A3LL 5ID1A 3ZTJG 3QH3A 4HKJA 4Y4KA 5FA4B 4NM8L 1YEHH 1QSZA 1BWWA 2GK0B 5ANME 2W59A 1B0GA 3T3MF 2CUMA 2R4SL 4NKMB 2FHBA 2WW8A 4OQTL 1NEZB 4DVBB 2AJYL 2H1PH 3V6ZB 3WO3B 2HA1A 4IDJH 1MNUH 3S8WA 5JMOC 3G5XB 1EGJA 1FYTD 4FNLL 3B8SA 4OFYD 3VFWB 5HVWA 3W0WE 5IFHH 1JGLH 3BP5B 3T2NH 1C7SA 2QKIA 3U2SA 1LEKA 3QIUD 2DBLH 3RWHB 4FP8L 3WIFA 1IGYA 2NZ9D 5KVGH 4G8EA 3QEGH 2D7PA 1L7TL 5GRWA 3MX0A 4J23A 1XR9B 1I3RA 4HC1A 3T1FB 2Y07L 3WL9B 3CXDH 4ODVH 3W0WD 4XP6H 4KZEL 3BP4B 4JY6B 3VGAC 4HKXA 3PWJA 4Z5RA 4U1IB 3NIGF 1F4XL 2BNQE 5DJCA 3IRZA 2PTVA 3RJQB 1C8PA 3RVUC 2QQQA 4XX1G 1XF5B 1GL4B 2GY7B 4K9EH 4ODSL 5MENE 5FO9A 4IOFD 1O7SA 4P5KA 2X42A 3U9UA 1HHKA 3VRLE 1T04A 1JF6A 2DLFL 3NCMA 4OGYH 5I76B 5TQ2L 3QT2A 4FZEH 4M03A 4ZFGL 5EBGA 1BIIB 5EU4B 4HPOH 4Y5XB 5GS0C 4JKWA 1BZ9A 4JO4L 3ARWA 1UB5A 2EDNA 4O2CB 1IEHA 5MEND 2DWEA 3EFDL 1MIEH 1LP9F 3TYFB 1A6UH 5I1LB 1INEL 2OK0H 4K71B 2VZOA 5DHVB 2A0LC 2FD6H 5GGTH 4O51B 4PLNC 2V7HA 4JFXB 5JW4N 1DQJB 2EZ0D 5C0CD 1ES0B 2XNAA 4Y4FD 3RUGE 4O5LL 1JPGB 4I3GA 2XQBH 4QHLA 5INDB 2NY6D 2GTWA 2P5EE 4NQSB 1LQSR 4PB9L 2AQ1A 1B3JA 4ORGB 2MSPA 1S7RB 4BFBD 4IRSD 4RZCB 1KCRL 1ZT7B 4MDJB 1RUKL 1AXTH 3JWDC 3WIIL 5B22A 4RIRB 2I5YH 3HE7D 3HRZB 5MEOB 4XAKE 5CSBA 3V52H 4KHXH 3F58H 4JPVH 3MJ9H 2I26N 2P5WE 2YZ1A 1B4JH 4QKXB 5EG6C 2YRZA 3C5JA 3S98A 5H35A 5AYQA 3LKPA 4D0CB 3UYRH 3MRLA 4Z18A 1VA9A 4P2QB 4CVZA 4EZMA 1AQDA 1RUAH 1UJ3A 4YWGH 1YEHL 4XAKD 2D0HA 5D7IF 1KF9B 3JWOL 5E2TH 3TBYA 3AS3A 2P5WD 5GGUB 5K93A 5AAMA 2EDKA 3HPLA 4DQOH 2CD0A 2O5XH 3T0EB 3U0TB 4JLRA 2ZUUA 1M7DB 4IDJL 1GGBH 4AY0A 4TVPE 5IROA 5D2NE 4S10A 3QG6A 3V4UL 4Y4HC 5C07B 4FQPA 3LSOA 1H3WM 2NXZC 4P23A 1JGLL 3VFNB 1FLRH 3IDNA 4WO4B 5HDBE 3T2NL 2OI9B 5B3JE 3VG9B 2X4RA 4PJGA 4FZ8H 4GKZA 2ICCA 1Z5LB 3U9PH 3IT8D 3I84A 4ZPTB 3CXDL 1SJHB 3SGJC 1FC1A 3MO1B 2RAMA 4PREA 4NO0B 3ALWA 2FZ3B 3HB3C 4EDWL 3MUHL 4HCRH 4I13B 3WKMH 3V2AR 1M4KA 2Z9TA 2WM0A 5C0NC 1WTLA 4HS6B 1S9XA 4P46B 5KS9F 4PG9A 1NMAL 2B4CC 2VE6A 3O8XC 1GZQA 4KRLB 4LVEA 4U2ZA 2HN7A 4OZFH 1WEJL 2DMCA 5T1KA 4OGYL 1NBYB 5CIPB 1HXYA 5IG7A 1SQ2N 2ADIA 1RUPL 1QO3A 4FZEL 3EZJB 1NANH 1OD7A 5I1GL 4IMLA 4DUXA 4NKQB 1MIEL 4A2LA 2OK0L 5L2KB 4MJ5B 1CU4L 1FVEA 4P4KB 3MRRA 5MHSE 2FD6L 2QLVB 1NBZB 2EC8A 1CD0A 3SCMA 4PTTA 1OAKL 2EH7L 4UTAL 3PGDB 2W0KA 3VXPA 4MA3B 3FQXB 5KANI 3ZE2F 3OKMB 1U8QB 3C2AH 5MHSD 3QAZC 1AXTL 4L8SA 3DGGB 3VXUE 3OKLA 4YFDB 4N5UA 1HHJB 4ENED 2W60A 4IOIB 3U83A 3V52L 3ZT6A 3MBEB 4KHXL 3GGWB 4JPVL 4QYOA 1T1WA 3UYRL 4XVUC 3ECBB 1CXLA 5C0AA 3QXWA 2RR3A 4LCWB 4Z0BH 5TFSH 3VXUD 4QGYA 3MV7B 5IQ7H 1OT1A 1S78D 1RUAL 5JXEA 2H26B 1FZMA 3IDYC 4PGCA 3X17A 2H32A 2PO6C 5C0EA 4NZTL 5TDOA 3B9KC 5B39A 3DRTB 4GW1B 35C8H 4M7ZB 4LLYA 1GGBL 2CKBH 2VN7A 4PJ9A 1VACA 3BE1L 3UPAA 1G0XA 2BDNH 1WIOA 1RJLA 4ZTOH 1FLRL 3QJHB 3FB5A 3E3QC 2PXYD 4D0DB 1Z0MA 2V9QA 4LNVA 3UROR 4FZ8L 1FIGH 1XZ0B 4GKNA 3U9PL 1R3HA 3KVQA 4KDTA 3EDJA 4HIIB 4HWEH 1X3DA 4C4KT 1LO5B 2ZSVA 2QSQA 3S7GA 2JJTC 4KKLC 4P2OC 4BKLB 1KG0A 4HC1L 3T2QA 4DAGH 1HHGA 3WKML 4Y4KD 5FK9A 1UENA 3OQ3B 3KPRE 2HTKD 5B39G 5C0RL 1CGTA 1E4XI 3WFZA 1RFDH 2WBJD 1CLYH 4PJAF 1CLCA 1MI5B 5M95B 4UILL 4ZPVA 3Q5OA 4BH7A 1ZA3A 1BBJA 1NCDH 5IVZB 4UT6H 3RGVC 1GGCH 3VI4F 4PRHA 1F6FB 4LSTH 1XMWA 3ULUD 1V3JA 3FQWA 4HUVA 4I4WA 5HHVH 3MODL 4PJEA 3ZKSD 4B0MM 1JVKA 3T0XA 4Y19E 4JRWA 4M7KH 5D1XB 2DQGH 3NA9L 5EC1B 3TJEH 3GBMH 3T3PE 3P4LA 3C2AL 4N8VA 4TRPL 5IW6B 5DK0A 2A73A 5T3XD 3WEXB 2FR4B 1CFNA 4MVBC 4PJHA 4HK0B 3L3IB 1JIBA 5F8RC 1H3UA 3FOMB 4NRXB 5HJ3B 2X4OB 2ZG2A 4Z95H 1WCBA 5SX5K 1FZKB 3KJ4B 3L5IA 5FDWA 2HLFD 4Z0BL 5TFSL 1NCUA 4M61B 2DM4A 1S9WA 4Q9BA 5DJ2A 2DTML 3W9EB 3MRDB 4O58H 2W65A 3SDCA 1T7WA 2JLLA 2VDQL 1YEDB 5IEKB 1A7PH 1S7XB 3SKOA 5EO0A 1ZA6B 3FQRB 35C8L 5F1NB 5FYJE 4UIMB 3VGHA 2CKBL 3U0PB 3M07A 1PX3A 3P73B 4ZDHA 3S37L 3BIKA 4N8VG 1S9VA 1YUHA 4E0RB 1HILB 2BVUA 3SDDB 4OCSH 4NC1E 2WWMC 3Q5TA 1NC4B 5TE7H 1PBYA 3C5SB 4Q2ZB 3BZ4A 1FIGL 4HWEL 3QFDA 1IM9A 3AC0A 5MERA 3EW3B 5TH2B 2VLMD 3TVMB 4D9RE 2FX7H 4U31A 2X4SB 1YQVH 1HOCB 1J11A 3TPKA 4OZHE 3MRMB 3EHBC 1CG9B 3HG1D 3RVXD 4ODXA 4MD0B 4OZFB 4GUPA 1MH5A 5EUKB 1KPVB 2R0ZH 1RFDL 1T22A 1G7JA 1U9KA 5EZLA 3GJFB 1T0MA 1YN7A 3MJ8A 4PJGE 4H0GA 3HNVL 1NBQA 4K8RD 5HGAB 2YPVH 4XXDA 2X89A 4YDLB 4P23D 4XHJD 5JORA 5JUEH 4HZLB 4I2XE 5DD6A 1BX2B 3GIVB 4IM8A 1I3GH 4PJIA 5I1KL 4K71C 1GGCL 3NCYS 2EDTA 3KS0H 4XNQA 5E9DE 5M7QA 3QO1A 1AO7B 1UJTA 5HHVL 2YD5A 4CVWA 4TPRH 2A6JB 1NLBH 2NY5H 3TJEL 4IEFB 2YSSB 3GBML 5DMGC 3CXHJ 4CKVX 3P4OA 3UEZA 2HKHH 4OF7A 4LIQH 4WTXA 1BVLB 1XGRA 3PWNA 2YS4A 4L9DA 3EAKA 5FF6A 4Y4HA 3W2DH 3PWPA 1Y6KR 4M1GH 5D2LF 3TIEB 1AKJA 1X5LA 3QUXB 3WYRA 4NPYB 1ZGLB 3DUUB 4WEUD 4DK3A 4Z95L 1AD9A 1FCCA 3PF2A 4U1SA 2XXMB 4G8FB 5T1KD 1ZGLP 3B9VA 3KPOA 3B9EA 4W6XB 4GRWH 5C9KA 3G6AB 2AEQH 4RMWA 4O58L 1P7KA 3SGJA 4MXQD 4ETYA 4MCYB 1M71B 5IR1B 2ZG1A 4P4RA 2V2XB 3T0EC 1A7PL 3O3DA 1INQB 2VKXA 1PDKA 2FJGA 3IFPB 1MJJA 3CVHH 5E70A 3SCMD 4R96B 3QQ4B 3GSWA 3O8XA 4U1JB 2AVGA 5F1SA 5IBUB 2Y9RT 3SOBH 3GRWA 2AEPL 5DMJB 5IHLB 4U3CA 3VG9C 4LOUC 2EEBA 1JNLH 4N9GA 4P57B 2EDLA 2NCMA 3D18A 1GOHA 4RMQA 1XGTA 1TLKA 3NFPB 4GMTH 3WDIA 2FX7L 2CK0H 5C0AD 1YQVL 2YMXH 3MOQA 1LK3L 1ZVYA 1JUFA 2Y5EA 4P46C 5CFHA 4RFNB 3WFBL 1RK1A 3ARRA 3V0WH 1ED3B 1D5MA 2I24N 1SEBB 5EU5A 5GGVL 2OLDA 3F7VA 1J05B 3T0WA 1E0OB 3D25B 3VRJB 2YPVL 2IPKB 1DANT 3QXVA 3B3IB 1TVHA 1MEXL 5IMKA 5JUEL 5BVJB 5IFJA 1I3GL 4P4KC 4RAUA 1X5ZA 2BP3A 3BO8A 5GRUH 2X7LB 5A2IH 5BZWA 1U8NB 4JDVB 2PO6A 4KK9C 3B9KA 1NLBL 3RY4A 1GRWA 1MREH 3SKNB 1NJ9B 4Q6IC 1Q9LA 4JEGB 2ZSWB 1KNOA 3JTTB 4LAQH 3ZDZE 3VFRA 2BHYA 3W2DL 3INUL 4R2GD 2Q7YB 4M1GL 3ES6A 1TVBB 3IFNH 3MBEC 3PDDA 5GXBB 3ZHDA 1PG7X 1IVLA 4W4OC 3MV11 2G75B 5JIPA 5K9KB 3MRKB 1R3LB 1JMXA 4PRHE 4LSDA 1MFBL 2E9BA 1F5WA 4J1UB 3NZHL 4E9LA 4XZUA 2AEQL 3BMWA 3RA7H 5D7KE 4APQC 3JZ7A 1HYRC 2JJTA 1CGUA 3LKOB 4AG4H 4P2OA 3H3PL 1KN2H 1PFCA 4PRHD 3E6HA 2QSTA 4M7ZC 3GMQA 3RP1A 4D8PB 4LQFH 4WW2C 5B38A 2DQIH 3B2UC 4XT1C 3CMGA 5DJ8B 5HYJD 4GG6A 1OQOA 5E2VL 1GOFA 3DVNA 4G5ZH 1T21A 2DQUH 2GSIB 4JRYA 3SOBL 1QFUL 2NW2A 2RBLA 4WEBL 3AU1A 4OI8A 3GJFK 1VEPA 3I75B 2PTTA 2V5YA 1LDPH 3Q6FB 3HZKB 5L8KB 5IHUH 2PKDA 2Z8RA 3JXAA 2X4TA 1GC1L 1PKQB 4WFHE 2CK0L 2NXYB 4K9EC 4HH9B 3RPIB 3H2WA 4HUWA 2YMXL 3TZVB 2VR5A 3ZL4L 2YUZA 3P11H 4ALAL 4ZAKC 4GW5B 3V0WL 5D70H 3SDCD 1EDQA 2GAZB 5B38G 4D9QD 5JPMA 4U6XB 4Q9CA 3KLAA 1MCOH 5CBAB 3OAYH 3QUYB 4MA1B 3RVUD 1DUYB 1OL0A 2VDOH 5JO5A 2ZP0T 4GLRI 4WHTA 3WLWC 1IAOA 1U8OA 5FA4A 2AQ2A 3CSYB 1WZLA 1VERA 5LGKA 1QLFB 3MBXH 5IMMB 2GK0A 1U42A 4OLVH 4NKMA 1M7IB 3RWGB 5D1XC 2Q8AH 1NEZA 4DVBA 3E8UH 3V6ZA 2A0LD 1QBAA 4J3WA 1SJVA 4PLOB 5CD3A 2VZ1A 3BMVA 1Q9OB 4O9HH 3VD9A 1FFNB 3G5XA 1TIUA 2BMKA 1SHMA 4H25B 3VFWA 3WJJC 4L3EE 3BP5A 5CGMA 1OQXA 3CMOL 4J3OC 3RWHA 3QCVH 1ORSB 3BH8B 4QRUB 2CGRL 2JB6B 3KJ4C 1BHGA 5I66B 4NJAH 1Y6MR 2AXHA 2X9YA 1XR9A 3T1FA 3FOLB 2P4AB 3WL9A 5EO1B 3RA7L 4MA8H 4OJFH 2E27H 4LLMB 5BRZB 2X89D 3BP4A 4JY6A 1E27B 1NH6A 4U1IA 4Y2DB 1JWSA 1A2YB 1NEZG 4LQFL 3MZGB 4X7EC 2UZIH 4M7LT 4YX2H 1XF5A 2R23B 2DICA 1DE4B 4BFIB 2MCPL 2R0KH 1N3NB 3U4BH 4X9BA 3MLPA 1KFAH 1S8DB 1WICA 1AH1A 3RWFB 3EOTH 5I76A 1BIIA 4MCZA 5EU4A 1E4KC 4LAJH 1CYGA 4Y4HD 3JTSB 3EDFA 4O2CA 4HIXH 3PWPD 2NXZD 1MVFA 1TXKA 3BN3B 4JFDB 1LDPL 3MLSL 1AKJD 5JQ6H 3TYFA 3VFTA 5I1LA 2J7LA 1IC7H 4O51A 1ONQB 4JFXA 1DQJA 3TVMC 1ES0A 4POZC 1JPGA 2XKNB 3O0RH 5INDA 4NQSA 4QTIH 4AEHL 4X6DF 1S7RA 4B7LA 1Y6NR 4YHIB 4MDJA 3VA2C 3PG2A 3BZDA 4L4TB 3HRZA 1AR1D 5DJYA 1OP3H 2WIIB 2XRAH 5MEOA 1MCOL 5C0ND 4WI2A 2VDOL 1A0QH 3TIDA 4CVXB 3O8XD 4YDLC 4LKXB 4D0CA 3IF1A 1PKOA 1IGFL 1HEZB 3KPNB 2DIJA 4P2QA 4EXKA 4JR9L 2L0DA 4XB8A 1NKOA 2R9HC 3MBXL 1MQKH 4WHYG 4DZBB 4DJMA 4TTDC 1NDGB 4OLVL 1Q8MA 5GGUA 2Q8AL 1BZ7B 3U0TA 3T0EA 4TN9A 3PE9A 3LIZH 4YK4B 1M7DA 3FONB 5IVXF 1EA9C 5EWIH 1ND0B 4O9HL 5EOCH 2M1KA 5C07A 4CADB 3IDXL 4Y89A 1KIPA 5EBLA 3VFNA 3QUXC 3O6FC 3G6JF 4F15B 2WV3A 5C1MB 3QCVL 1A5FH 3DOSA 3GI9H 2XFXB 3VD4A 2B1HH 1Z5LA 4M9OA 3C60B 4ZPTA 4A6YH 2K7QA 4OJFL 2E27L 1SJHA 3F5WB 4NZRH 3KLDA 4XVSH 4TSCH 2R39A 4KGLA 3MO1A 4XCNB 4WENB 2NW3B 4NO0A 4PJBB 4XVUD 3BD3A 5I16B 2FZ3A 4I3RH 3VA6A 1TENA 4HS6A 4P46A 2XWJB 4MYWB 4JQIH 3IKKA 2PO6D 4WW1B 3U4BL 3FB6B 4Q9QH 3B9KD 1NBYA 1MFCL 5CIPA 5DI8B 3E3QE 5E4EC 5DUBB 3DVGB 1EO8L 3BSZL 3QDMB 4OV5B 1HQRB 3ARGB 3OB8A 2FIKB 4XCYB 5JQ6L 4MJ5A 4P4KA 1IC7L 2G2RB 3QPQC 1NBZA 1KELH 5IVOA 1JHLL 1KCVH 1PW3A 1MCHA 5JW4M 3O0RL 3PGDA 1P4LB 3IRPX 2RFXB 1I1FB 4DEPB 2EDRA 4MA3A 4GG6E 3FQXA 5SV4A 1DL7L 3RIAF 3OKMA 1U8QA 5B4MD 4KKLD 4LFHG 3CZFA 3DGGA 4JRYE 1BM3L 3PXHA 1HHJA 1F4WH 2XRAL 4PJFE 4IOIA 3B4NA 4QRQB 3MBEA 2QADB 3GGWA 4FFZH 2DJUA 3GSRB 1TZGL 1JHTB 4W4OA 3NABL 3ALXA 1CGWA 4G7YH 3WNNA 1KOAA 3ECBA 5J13B 4LCCC 3QR2A 4LCWA 1FNLA 5GGSB 4JRYD 3K4ZA 1VKXB 2HFEB 4NKIH 1MFDH 3JV6B 1BAFH 3FO0H 5I1AB 1DJSA 1FGNH 2Q3AA 2XTLA 1RV6X 1X6NA 5D5MF 1TPXC 2AJSH 4DTGH 3DRTA 3LIZL 4GW1A 4M43L 5CZXC 1JPST 3L9RA 1KIUA 4WIQA 1FSKC 4QXGH 4KVNL 4LARH 4WW2A 4OKVA 4OCRL 3O4OB 2CSPA 4NKOB 4LVNC 3RL2A 4YIQA 4YDVB 4QLRA 1I4FB 2JE8A 3QJHA 1BWMA 3TF7C 3GI9L 4D0DA 5E8OA 4ZUUB 4XPHH 4OLWH 1J0IA 2B1HL 3TBVB 1WF5A 1XZ0A 5FIEA 3DVIA 4MVBD 2WWKO 1AY1H 1B0WA 1FN4B 1QZ1A 4LKCB 4HIIA 5CINH 3QDJD 1LO5A 1N6QH 4TSCL 2VL5B 1X9QA 3AREC 1VFBB 1A6PA 1V3KA 3RZCB 4PUBH 1H15A 4JB9L 4OI7A 4OF0A 4N0RA 4ZAKA 1TETH 1UWGH 4JQIL 4QY8B 2CLVB 4NDMB 5EA0H 1T66D 3RWDA 4Q9QL 1V7ML 2ADJB 4J7RA 2W38A 3KYNB 4JZNB 3LKSA 1MAKA 4X4XB 5CEZD 1ZSDB 1IC1A 1IGMH 4WFGD 2YPLB 4S0TD 1MI5A 4ZFZA 1IE5A 2YPKB 4XBEH 3VFMB 4HKZB 2O5YH 4F57H 2BSSA 5F70A 3EOYG 5BMFH 1I8MB 3BAEH 4PTUB 3BESR 1KCVL 2WWMD 3EYUH 2NXYC 3R06B 2BC4A 3KPQB 3TZVC 1A9EB 4O02H 3SGDI 5D1XA 3ZHKA 3BQUC 1OAXL 1YEEH 2FX9H 3E1F1 3FZUD 4URTB 4YHYC 4HAFA 5IW6A 3VGBA 3WEXA 2FR4A 5LCVL 3EHBD 2LAAA 3WJJA 2KBGA 3NPSB 4HK0A 5ACLA 3L3IA 4Y5YC 3ROOA 3QUYC 4MA1C 1BBDL 1OVZA 3FOMA 4G7VL 5HJ3A 1CL7L 1LD9B 4YUEL 5F9AC 3CFEB 3IS0X 1HIMH 1PEZA 1OAUH 2P47B 1ZLVK 1EPFA 1NUGA 4H1LH 4PJ8B 4M61A 1A7OH 4I0KA 2UUDK 4NKIL 2LU7A 2NY5C 3QEUB 1MFDL 3MRDA 3W9EA 2B0SL 1BAFL 1NDMB 1PEWA 3ZKNC 5GS2D 1FGNL 3DUHA 5FECB 3O81A 1L7IH 1QQDB 3PXJA 1K2DB 5IEKA 1FJ1B 1YEDA 2AJSL 4DTGL 5FFLA 2CDGB 1S7XA 1OGAE 1ZA6A 5F1NA 5L0QB 5LKNA 4UIMA 4QXGL 4LARL 1YEKH 3U0PA 3QNXB 3P73A 1UZ6E 3MTRA 3DETC 1IARB 4E0RA 5IGXH 1HILA 5DMGD 3TN0B 1E4KA 5F6IB 5GZNC 4P2QE 1WFUA 1OPGL 1NC4A 4U0RB 4WNQB 3C5SA 4Q2ZA 4YQXH 1IBGL 2AXGB 2O26U 2J12B 3SE4C 2F9BT 3N1GC 3VI3E 1SM3H 1ZAGA 1P69B 4HCRA 1N6QL 3QHFL 5TH2A 3TVMA 3NVQA 2X4SA 4J3VA 1HOCA 4P2QD 2VZTA 4Y2DC 3MRMA 1CG9A 1U6AH 1I7RB 2D31B 1CK0L 2KDGA 1U3HB 3BPNB 2ERJB 4OZFA 5C07E 2OM5A 1UWGL 5MP6H 5EUKA 1I7TB 4DW2H 2B7DT 1J18A 1KPVA 3QRGH 2OZ4A 3T0ED 3GJFA 3QQNA 1CXIA 4U33A 5GGQH 1URLA 4OF6A 3OAYK 1J1PL 2W1NA 2XTJB 5DJAB 3QULB 4KDVA 4HWNA 5HGAA 1MOEA 4HPYH 5C07D 5ADPL 1MAJA 3OKYA 3LCYA 3HUJB 3WHXB 4HZLA 4F57L 2HT4C 4WO4D 3GIVA 1DEEB 4YBLB 4F37F 3RKDC 3ZE1F 2NX5E 5IHZB 4RFOL 4JY4B 2EDJA 1AO7A 2KZ1B 4JFFB 3EYUL 1MCWW 5E6YA 3MYJB 3DX6B 3IETB 2A6JA 4NIKB 5FUOH 1MIML 3E2HB 2YSSA 3O3AB 1T0PB 5K59E 1KJ2B 1N5YH 4NO0D 4OZFG 2J8UB 2AV1B 1BVLA 2D3VA 5B21A 3I2CH 3LD8B 1C16B 3TIEA 2YD2A 4P46D 2W0PA 3MLXL 4LFHD 3QUXA 3O6FA 4NPYA 2C3HA 3DUUA 4GOSA 1ZGLA 1J86A 3D39B 1FCGA 2V5MA 1M05B 5AG8A 2UVEA 1OAUL 4KI1A 4JM2F 5D1ZB 5HYIA 4M5ZH 1B2WH 1A7OL 3G6AA 5DVNA 4ZO8A 2PW1B 3S37X 4WTZA 2HT2C 1LO4H 4WHCA 4MCYA 4OGAD 1M71A 1ZLUK 5IR1A 2YEZB 1RJYB 4YBQD 2HRLA 1Q9WB 4PIRF 2V2XA 5ALCL 5L2KD 4LK4A 4P4KD 4M93B 2NY2B 4YK4C 1INQA 2Q76B 2GKIA 4KTEH 1S7TB 3GSNB 4LRNH 3IFPA 3UDWC 4RA0C 5JW4Q 2MHAB 4XP9H 4JG0H 5T3ZE 4R96A 1OTUC 5F6HI 3BEWB 4KK9D 4U1JA 5K9OB 5IGXL 2HG5B 2VXVH 3N85L 1A6ZA 5J6HB 4LCWE 3WXVH 2W9LA 4HGMA 2CUIA 4P57A 3GBLA 5IB2B 5JR1H 2CDEB 3MBED 3C60C 3D6GA 3R0NA 3NFPA 3QQ3B 4WTZG 1T6WA 1T0NB 4LCWD 1G6RH 3CCHB 1U6AL 2PCPB 3W39B 4JPWH 4U1KB 4LASH 4DW2L 3TFKC 1ED3A 4WUUE 5B8CC 2DAVA 1SEBA 1I7ZB 2HJFA 5GGQL 1J05A 2YXFA 5C2BL 5IBUG 1WAAA 1J10A 5FO7B 3D25A 3B2UD 2ZCKL 3MCKB 3VRJA 4HPYL 2IPKA 3B3IA 1AFVH 3ARGC 2DQHH 5SV3A 5BVJA 5TJWK 3ETBF 4X83A 4WDIB 2PYEB 5DD1L 2RCSH 1MCFA 2X7LA 4PJXB 2E7LA 2R8SL 3ILQC 4JDVA 4MHHG 3MLTB 1DVFB 1E4WL 3MLYH 5FUOL 4KMTL 4DEPC 1AI1L 3SKNA 1DLFL 5H2BA 1NJ9A 1AC0A 4GXVH 1UB6B 2ZSWA 1N5YL 1TQCB 2CMRH 5E1HB 4AZ8A 1YPZB 2A83B 3I2CL 2DN7A 4L8DB 1KIRB 2Q7YA 5DD3L 4N0CC 1TVBA 2Z35B 1MI5E 2QADC 4Z7NE 1MCIA 1CS6A 1QR1B 3D3VA 2G75A 3DO7B 2BHUA 1TNNA 5K9KA 5LBSL 4GS7B 1R3LA 5J13C 5KVFL 4J1UA 1B2WL 3T0DA 4Y2OA 1BIHA 1CFVL 3GIZH 1MI5D 2EIZA 2ZUTA 3WLWD 3LKOA 4HLZG 3T08A 4WI8A 5H37G 3J7HA 5A16B 2WUCH 4KTEL 4D8PA 1OWRM 1N7ML 1CQKA 4NRZB 4XP9L 5DJ8A 3EO9H 1YNLH 4HS3B 3IXAB 4Z7UF 4RNRB 5D1XD 1W0WB 3D2UB 2GSIA 4JO3H 2VXVL 3CAFA 1CIUA 3GHEH 4FQIH 1BQSA 3WXVL 1TJHL 3I75A 4X8JB 1OSPL 5JR1L 1I9IL 3Q6FA 3HZKA 2BERA 3VXSB 2E7BA 1I9RL 4AIOA 4P5TB 5DD0H 1MCWM 1S3KH 1PKQA 3RZCC 3HZYB 1G6RL 4LDLB 2F19H 2J8HA 4HH9A 3RPIA 3TZVA 4OCYH 3NIDF 1U58B 4OZGF 4OB5L 3BQUA 4GW5A 5HVGB 4R90H 4LASL 4NC0B 1E4JA 2GAZA 4MQTB 4N8PA 4C56E 5CP3A 1YEJL 4M1CC 4U6XA 1U3JA 4O2EB 4YHOL 1Q38A 3W11C 2Q1EA 4Y5YA 3QUYA 1DUYA 4WHDA 4ODWB 4J4PC 1X5GA 3FRUB 2B20A 4P0DA 2CO7B 1AFVL 2VWEC 1WSST 3KJ6L 4ONFH 3CSYA 4XMKL 1U93B 3SDDD 3WNLA 1QLFA 5IMMA 3RHWK 3LRSB 4YE4L 1NC4D 4R26H 1LILA 2HWZH 2VXTL 1FO0B 1M7IA 3MLYL 3MV8A 3GMMB 4J2XA 3I3EA 3EJZD 2BVQB 2P24B 1BLNB 4GXVL 1FRGL 1A02N 3TVMD 1Q9OA 2CXKA 4JZJB 1CVSC 1SMAA 3CH8A 4H25A 4NQEE 1X6LA 3LHPH 4ZNCD 3BH8A 3BJ91 2JB6A 5I66A 3TBSB 2UYLB 3KPTA 2E9JA 3FOLA 1ZKAA 5EO1A 4H8WH 3GIZL 5EPMB 4KWUA 4HWUA 5BRZA 1QOKA 1NMCB 1QACA 2QJDA 1E27A 3P9WB 3VJ6B 7FABH 2VDMH 1F4YL 4UQ3B 2DKSA 3CVHA 4Y2DA 4OLZH 4WI9A 2GFBB 3W9DB 2A1WH 3ESVF 1A2YA 2R9HD 1AO7D 5E8NB 1R24B 2DL2A 4R3SB 3EO9L 4TTDD 3D69B 1DE4A 1YNLL 4JN1H 4XC3L 4BFIA 1N3NA 2X4QB 4MNGB 1QSEE 1S8DA 4Z7WF 2LTQC 3RWFA 1EJOH 1A8JH 2D9QB 3TN0C 2ADFH 4LPWA 2DDQL 5F6IC 1GVIA 2UVFA 3QEQB 2H2SD 5C7XL 2DQEH 7CGTA 4K94L 4Q9RH 4JFDA 1HYSD 1QYGL 3TYGL 3QUXD 4NQCB 1ONQA 3DYOA 1S3KL 3V6BR 2E6PA 2GCYB 3F65A 3PIQB 2F19L 3L7EB 4N0FB 2IC2A 2XKNA 2BXYA 4QRPB 4UOJA 1CDUA 2UZXB 3SN6N 2J5LB 3BPNC 2ERJC 4BA8A 4NBYB 4G6JL 3MGTB 3QUMB 2EDDA 4KY1L 4YHIA 5CWSB 4UAOC 3GI8H 1BFTA 4WI7A 3V4PH 4L4TA 1FORH 2WIIA 2XTJC 4PRPB 3ABZA 1C5DB 2EXWC 3QCTH 4JN2B 4CVXA 3SQOL 1D5BB 2BFVH 3X12B 5EC2B 3N06B 4XI5C 4ONFL 1HEZA 3KPNA 4YBLC 4NP4H 1BQUA 1OF2B 1RK0B 1IKFL 2AI0H 3OXSB 4DZBA 3L3OB 4HXBL 2GUOB 2QHRH 3MZTA 1NDGA 2SEBA 4YHPB 1BZ7A 3E2HC 5DMKB 3BXNB 4MS8D 3QPQD 3FONA 5C0GB 1MCLA 3RI5F 2F5AL 4NN6B 1ND0A 3UDWA 5E0QA 3LD8C 4TSBL 1X5HA 3EUUA 4NGHH 4CADA 2VSDA 5F7WC 4ONGH 3VD3A 4YZFF 4Z76A 3VFOB 1KGCD 2DI8A 4WWID 3HMXH 1XF3B 4DOHB 4G42B 4P59H 3VD7A 4UV7H 4XP4L 2XFXA 3QUZC 3BZFB 5D1ZC 1X7QB 5LG1A 3FFDB 2GHWB 4X7TB 3UBXA 4NQTA 1C5CH 3P0VH 3QXAA 3C60A 1MHHB 1WC7B 3F5WA 4LEXH 3GM8A 4OZ4B 1UACL 4XCNA 2NW3A 4PJBA 3D9AL 4O4YH 7FABL 1QRNB 2VDML 1FIEA 5HI4C 4P3CL 5MI0B 2NY2C 4PJDB 3BUTA 1U91B 3HI5H 2XWJA 4JGUA 3V4VL 1IILE 4WW1A 3FB6A 2F58H 1JWMA 3F7PC 1NFDF 3STZB 2YA1A 4N0YH 1GGYA 1KEGH 3D3VE 5CZXD 12E8L 1EVTC 2AJUL 3HA0A 3QCUL 5DI8A 2G60H 2ADFL 5DUBA 4WV1B 2Z31B 3CK0H 2PUQT 3QDMA 1L9NA 1HQRA 4XWGH 4OV5A 4HUKB 2FLBT 3ARGA 4Q9RL 4I1NB 2FIKA 4WWKC 1JNHB 2IPTL 5DD5H 3RNKB 3UBXG 1QFHA 4G6FB 3D3VD 1NUDA 5HHMB 2C4FU 1N6UA 4U1HB 5HYSB 1I3UA 1P4LA 2RFXA 3CX5J 4I5BB 1I1FA 4YGVB 3MLVH 1DQQB 2HFTA 3JUYA 3CPLB 4JHAH 3CFKB 4G6KH 4EVNB 1WQVT 1RSFA 4H20H 1FGVH 1R5VB 4QRQA 1PQZB 1VPOH 2J4WL 2EH8L 3ULVF 3GSRA 5JTWA 3QCTL 3QB7C 5I9QB 2BFVL 1C08B 3S35L 4NHCL 4TYUA 4MXVF 5GGSA 4NP4L 5JHLH 1JHKL 3NACH 1VKXA 2E6JA 2HFEA 5I6XC 2Y36H 3JV6A 2AI0L 2XA8H 2IG2H 5I1AA 1DVFC 5CSGA 2OSLB 5F7DB 2Q6WB 2APWA 3BJLA 3L7FB 3JV0A 2NXYD 4NKOA 2X09A 3TZVD 2P7TB 1X5AA 5CJ8A 3LN5A 3QXUA 2ZCLH 3VWKB 3H3KA 4YDVA 1I4FA 3BQUD 4LRIC 5DQDH 2YA0A 3GSXB 3HMXL 5EN2B 3PGFL 4P59L 4GS7C 4F9LC 3IJSB 3TBVA 1Z2KA 1FN4A 3G04A 3QUYD 4LKCA 1C5CL 3QI9B 2VZUA 4LIQE 2VL5A 4QXUL 3MV8E 3VRIB 1AGFB 1VFBA 3ZDXF 3BUYB 3RZCA 3QIBB 3N1PC 2WZPD 1IGJB 5DEGB 4YHML 2ITCB 3TO4B 4JJHA 3K46A 3QEHB 4KV5E 3ZKND 4W6YB 4QY8A 1CE1H 1FNEB 3DO3A 2K9UA 1VHPA 2ADJA 2ENSA 2VDRH 3KYNA 4JZNA 4NQXB 5E94B 4GRWE 4XBPB 1KEGL 3ZHLA 4X4XA 3N50A 2G60L 1QFWM 1ZSDA 1BVKB 5HSFA 4QHMB 4LQ1A 4U6YA 5IFAH 3MRCB 2YPKA 5IT2L 3VFMA 3DETD 4RFEB 1CDYA 3BEVB 1I8KB 3P9LB 4HKZA 4RISH 4F2MA 1DLHA 1KBGL 3M8OH 4Y0GA 2GY5A 3IAQA 3UTSE 1GAFH 2OP4H 1I8MA 5AG9A 3SGDH 4PTUA 2P8MB 3OR6B 4JFQB 3R06A 3KPQA 3SEPA 1NGWB 4XPFL 3K8KA 2FECL 3B5TA 3H0TB 3WCYA 1OAQH 3MLVL 5BRZD 3SDYH 1YEFH 1EMTL 1MJ7H 4XBGA 1JMZA 1JP5A 1KB5H 2WAHA 3L6FB 4S1DC 2YD9A 4G6KL 4Y2DD 5GRVK 3SDXF 1PVHA 1BQLL 5DJZB 4H20L 4LSPH 4OT1H 1HSBA 1RY7B 4ZFOB 2EC9U 4X5LA 3LZFH 4JFDE 1LD9A 5IB3B 1U3YA 2DWDB 3CFEA 5FDYA 1JTPA 3EYFB 1TNMA 4BQBA 3W0WB 1J8HB 5CCKH 5JHLL 4PJ8A 3NACL 4YXKL 1KULA 4L29B 2Y36L 3QEUA 2IQ9H 4RGMC 1RZ8B 2IG2L 4QRRA 1UXWA 4JFDD 1QQDA 1K2DA 1FJ1A 2HT4D 4K2UL 2EIBA 3V6OE 1F3JB 1YDPB 2CDGA 1UH3A 1RZKH 1F3DH 4YXLH 1WWCA 4CL7A 2H8PB 3CXHK 5E6IB 3ELAT 1F4HA 4PLJC 1IT9H 2ZCLL 4HEME 2BNQB 1FZJB 3CFJA 4MSWB 1MY5A 2KH2B 4K3DH 5BOZG 3LKNB 3TN0A 5D72H 1JI1A 3T3ME 4A6YA 3CJJA 4WNQA 3O2WH 4L4TD 2AXGA 3TCLB 5F7EH 5CGYD 3LQMA 1AGBA 3TCXA 4JHWH 1NMCC 3LEYL 3U7WL 1TJIL 5L6YL 5FYLH 4Y8AA 1EJ6A 1KEMH 1I7RA 2D31A 4KJQC 4MA7H 4JM4L 4ZUTB 1MRDH 1Z6JT 4JZOB 4ZOBA 2HT2D 4GSDH 1I7TA 4LMQI 4OIBA 4EKXA 3RUGB 4CUCA 1NCBH 2P5EB 3BKCL 5GHWH 2BVEA 5FUCC 2JTDA 1WFNA 3O2DA 4UNUA 1J87A 5DJAA 1CLOL 3QULA 4E5XB 1OTUD 3DSFH 5IFAL 2PTUA 3LKQA 3NIGE 2WLYA 1PY9A 3HUJA 3WHXA 3EYSH 1DEEA 3O45B 2CRMA 5EO9B 1YJDC 1GAFL 2OP4L 4OCXH 4JY4A 2VDNH 5DWUL 1YZZA 3BFOA 4JFFA 4RWYL 3MYJA 1OB1B 3DX6A 3IETA 4S1RH 4HIHB 1RQ5A 4FOMA 2J5LC 3C60D 1RULL 2EDYA 1OAQL 3O3AA 2ESVE 4HGWA 1KJ2A 4LBEB 2J8UA 4L9LB 2AV1A 5HD8C 4D0BB 5GZOC 1C16A 3WN5C 3TJHC 2IALB 4LSPL 4OT1L 5ERWB 4OD1H 3MUGB 1A6TB 5C92A 3LZFL 4G80B 3TFKD 3D39A 3QNZA 4KROB 4XB7A 5KVMC 1M05A 5I8EB 4DGYL 5EDXA 4OZIF 2LVCA 4FABH 4OIIL 5D1ZA 1CZ8H 5CCKL 1LMKA 4HX1B 1JK8B 5KANG 5CSZA 2IQ9L 1KCUL 2R69H 3QDMD 2BVTA 3ARGD 2YEZA 1RJYA 5EUOF 4I48B 1RZKL 3WLBB 4YXLL 1S7TA 3GSNA 1JPTH 4DFIA 2MHAA 5CGTA 3SGEI 4TNWK 3BEWA 5K9OA 1IT9L 3CGTA 5HGHB 2HG5A 2A6DB 4K3DL 3EYQC 5D7IE 5D72L 5HHOB 5J6HA 2OQJB 3B43A 4NFDA 3QYCA 4P9HC 1IM3A 5IB2A 2OJEB 4WWKA 4N0CD 5E56A 2CDEA 1NC2B 2QADD 4FXKB 4D2NA 4JHWL 3PHQB 5FYLL 1T0NA 5MI0C 3V6FB 3CCHA 1KEML 1ADQH 2PCPA 3W39A 2RQ8A 1NAMH 4OF5A 4U1KA 3RX7A 5AAWA 4F7TB 4FQCL 1I7ZA 2IJ0C 5GHWL 3SO3C 4JKPH 4NHUB 4WV1C 5LXGH 5FO7A 3DSFL 3ZMRA 1FAIH 1G6VK 2J3SA 5I1EH 1I1AB 3RWEB 5JQHC 5DA4A 3T1WA 4R9HA 2VXUH 4WDIA 2PYEA 5KS9E 1C12B 1T6VN 2ZWLT 4LLQB 4PJXA 1DBJH 4OCXL 5J8OA 1SBSH 4PRBB 1X44A 2F8OA 2EDBA 4MJ2A 3GO1H 4S1RL 3BZEB 3MLTA 5C3LD 2BY3A 1DVFA 1KB5B 4BSVB 3ARZA 4Z77B 2E8ZA 1M1SA 1UB6A 3HTLX 4ODHL 5DVOA 3T09A 3RZCD 1YPZA 2A83A 4HBQA 2DI9A 4L8DA 1KIRA 3TM6A 4ZMAT 2Z35A 4LRIA 3FHQA 1J1XH 4H1LA 4XMPH 5I9QC 1QR1A 3LH2L 3P3YA 4R0LB 1UWXH 3DO7A 3DTXB 3FL7A 1P4IH 4F9LA 4M1CD 1CZ8L 2X41A 3W11D 5IMLB 1D6VH 3ZE2E 3IAPA 1ITBB 2R69L 5ID1B 3QH3B 4YNYB 5IQ9A 3U7YL 4EIGB 5DGRA 1XT5A 3UTTE 5A16A 1DSFL 4QWWC 1CE6A 4NRZA 3G08B 4M1DH 3LRGA 2WWKT 1DUZA 1YEIH 2EIEA 4HS3A 1MRFH 1KT2B 4RNRA 1W0WA 3D2UA 3KPRB 3NCYP 2DF3A 1ACZA 1HI6B 4PJ5E 4XPGH 1EZVY 5CJOH 4XCFH 4HLJA 1HZHL 5A40E 4GW4B 1YY9C 1QFPA 4H1LG 4H8WC 4X8JA 1R5WB 1D9KC 3QJFA 5FHBH 2VRAA 3O6ML 3RKPA 3VXSA 4XNMB 4KHTH 3H7BB 4QRRE 1FPTH 4I18B 4P5TA 4MWFA 5LVEA 3QIBC 1JZ3A 4PJ8D 1ADQL 1U58A 2CRZA 3D0LA 3PWJB 1F13A 4Z5RB 3TO4C 3FAXA 4DN3H 4OM1H 1NAML 2G5BB 1YMHB 4X5WA 5I1JH 2FEDC 2D7TL 4Y19B 4O2EA 1PJ9A 4WFFE 2JCCB 4GT7A 3U9UB 2BZDA 2ATKB 4ODWA 4K7PL 1SY6H 3FRUA 1KPUA 2D7NA 5I1EL 4OKDA 2VXUL 1K4CB 3LQZB 1U93A 3TN0D 5IW1A 1SBSL 4WFFD 3LRSA 1OM3L 3BHBB 1WZ1L 3OPZH 1FO0A 1C5BH 4U0QB 2A77H 2P8LB 1WWWX 4PJAE 3GMMA 3NFNB 2DQDH 4FXLA 2BVQA 4W81A 1BLNA 3GDBA 4AEEA 4KJYB 3CVIH 4X4MA 1F45A 1RMFL 5F9OH 3VI4E 1KXTB 4UI2A 1U3HD 2WSKA 43C9A 3QG7H 3TBSA 1P4IL 3KYAA 2UYLA 4K07A 5LGHH 5H35B 1D6VL 2XTJD 4JFFE 5I8OL 5EPMA 4HWBH 3MRLB 2EXWD 2VISB 4UDUB 4EDXA 1R3KB 3VJ6A 1AQDB 4XI5D 3BRDA 4GFTB 5IHBA 1M7XA 5HDBF 1ZMYA 2GFBA 3FT4B 4M7LL 5B3JF 4JFFD 1R24A 4R3SA 5B3NA 4M1DL 3D69A 3I85A 4QXWA 2CIKB 5FO8A 1YEIL 2X4QA 4U3HA 4MNGA 4OZHB 3WE6B 4KJPC 5DRWB 3D39E 2C5DC 4XPGL 3MJ6A 5EULV 3UTOA 3MSPA 3QEQA 4OM0H 5A2JH 3UZVB 4F37K 4NZUH 1K6QH 4KHTL 2A9MH 1HE7A 1T89C 2X4RB 4NQCA 4U1LB 3LQAL 3D39D 1KN4H 2GCYA 1RIHH 2BOCB 2FNBA 3C8DA 3PIQA 4S2SB 3L7EA 4TVSa 4I2XB 4N0FA 5D1ZD 3F12B 4QRPA 1MRCH 1PZUB 5E9DB 1DFBL 4DN3L 4OM1L 4OF3A 3MGTA 3QUMA 2YBRB 5CWSA 1S9XB 4PBVC 1H0DB 4NNXB 2NY2D 5HYEA 4PG9B 3WN5A 2FSEB 4LLUB 4PRPA 5DUPH 3NA4A 1FE8L 3Q48A 3ULVH 1C5DA 1HNFA 1W8OA 4N1CA 1D5BA 3X12A 5EC2A 4WVRA 2WK2A 4X7DC 1CDHA 5H94B 1QEWB 3MV9B 5IEHB 1OF2A 1RK0A 3UAJC 3ARBB 3OXSA 4JHBA 5HTSA 3L3OA 2GUOA 3MRRB 4XNXL 4YHPA 4FG6C 1YC8A 2EECA 2A77L 5JW3L 4G6ML 5E5RB 4LDOB 5GJSH 5DMKA 3BXNA 2DQDL 1UXSA 1T80A 2VDPH 1IAIM 5C0GA 4BM7A 4IMKC 2ZUYA 4L9LC 1MVUB 3AS0A 4MXWL 5KZCB 1KJVB 4UUJB 1KC5H 3MLUH 5JHDA 4RMUA 4FQ1H 4JPKH 3V8CA 1GIGL 3VFOA 4AQOA 2NLJB 4OFKA 3RWCA 1XF3A 1QNZH 4KROC 1EFQA 4G42A 4LCUB 1A6VL 3I6LE 5FYKD 3EYVA 3QG7L 1NBVH 3BZFA 4JFEB 4PJXE 5LGHL 3FFDA 4RGOL 4RCAA 1MHHA 1WC7A 5HHPA 1X5YA 4OZ4A 5E2WH 3A6BH 5I8KL 2MOVA 4XGZB 1INDL 4IRZH 5D2LE 5BW7C 4X6CB 4HMEA 2PYED 4PJDA 1U91A 4WGWB 1XGYH 4PJCF 5E5MB 1QPXA 5BV7H 1YQ2A 4KQ4H 4FQXC 3TT1H 2I07B 1DVFD 4LLYB 3STZA 4PJ9B 1VACB 2XOTA 3HHRB 1CDCA 4WV1A 2Z31A 4P3WA 1ZHKB 4CJ1A 4OM0L 1TZIB 4JREB 2X4NB 2CDFB 3MLWH 4KKBC 1JNHA 2VZVA 1K6QL 2A9ML 3O41B 3RNKA 4M3KB 4X6DA 5GISH 5ITBH 4GKNB 4HAGA 1GH7A 3KS0J 1RIHL 4I3SL 2R0LL 3ULUF 2ZSVB 1VSCA 2AEWA 1MRCL 4ZD3H 2YK1L 4I5BA 4YGVA 1Z3GL 1DQQA 5DDHB 3CPLA 3ZZ1A 3BKYH 4JGMA 1F02I 5INCB 3CFKA 1S9YB 3RVVC 4EVNA 2P45B 3DMMB 4PB0H 1R5VA 2N56A 4AEIH 5E8DH 1N0XH 3OBAA 3NN8B 3VXSE 1RZ7H 3D2UD 1BECA 1L0XA 3F7RA 4ZPVB 2Q8BH 4K23H 4CU6A 3PHOB 2F74B 4Z8FL 2V17L 1BJ1H 1YN6A 3VW3L 3M17B 1NMBH 4Y16C 2JJUA 3VXSD 1JPSL 1W72H 1V05A 5GJSL 4AIXA 4PGBB 5F7DA 1G9MH 2VDPL 2Q6WA 5BO1H 4P5TD 5JDJA 3KYMB 3X3GH 3G6JA 3L7FA 1JYNA 2R1XB 1FO0L 1MCQA 1XCTB 4R8WL 4Z0XB 4KZDH 3QBTB 1NQBA 2P7TA 1KC5L 1QKZH 3SKJL 2BSED 4ODBD 4JM2C 1K4DA 4KJWC 3GSXA 4W4NA 2A73B 2PW2A 1JGVH 5EN2A 4R0LC 3NTCH 4WEMB 4S1DD 2HYMA 1NBVL 3IJSA 3F7QA 3DX8B 1B88A 3U7AA 1WCBB 3VMPA 5CD5C 4GAJH 2NY1B 2F53B 5E2WL 3VRIA 1AGFA 4M5YH 3VXTB 5LQBL 3BUYA 3QIBA 3ARUA 3L3JB 5DMIH 1IGJA 1R6VA 5DC0A 2OBGA 1RUMH 5DEGA 1PG7H 4LLAA 4G6AD 5GS3A 3TO4A 4KQ4L 3BIAX 1FNEA 5EO0B 3K2UH 5I15H 5AD0B 1J0ZA 4XBPA 3WUZA 3HMWH 4HF5H 1BVKA 4MD4B 4QHMA 1S9VB 3QZWB 3UTQB 4Y8DC 3GK8L 4OGXL 3MRCA 2ITDB 4RFEA 1I8KA 1MHEB 1UC6A 2HH0L 3P9LA 2P49B 3WIHH 2G5RA 1H3TA 1MPAH 5GISL 1YA5A 4I18C 3S3SA 3PWUA 5HHXH 4G8IB 4JFQA 1YY8B 1NGWA 4FFYH 1IM9B 1T7XA 1SYSB 5DF0A 4ZD3L 1FFPB 4YHKH 3H0TA 4LHUA 4PJGF 3S35X 4F7MB 4U3XA 3BKYL 1JGUH 3L6FA 5F9DC 5FUCE 4PB0L 5DJZA 1MFAL 2FEEI 4KJQD 4N5EC 4ZFOA 3TLRA 4QRTB 1HWGB 3AY4C 1T22B 4AEIL 5E8DL 1N0XL 3H42L 5IB3A 1CLZL 1XGQB 4WCYH 3BDBA 1X5JA 3EYFA 4ODUB 4NQCE 3NFSL 4X6BB 1J8HA 4L3EB 3PNWB 3KR3H 2Q8BL 4K23L 4G3YH 4L29A 1JV5B 3QEQD 2HMIC 3VDBA 3UJIH 5BZDB 4QOKB 1B0RB 1WBYB 3B8YA 3IU3B 1F3JA 1YDPA 5BO1L 4NQCD 3U30C 5HHQB 3K0WA 1J0KA 4LHUG 1T03H 3GZKA 1MHCB 1LO2H 1M6OB 3Q6GH 4GMSH 1DN0A 3DXAA 4PRPE 4QRPD 2YD7A 5BOPA 2XZAH 5KBNC 1EX0A 2BNQA 1FZJA 4MSWA 4WUKH 1XGRB 2KZWA 1I8IA 3LKNA 4QHKI 2P48B 5HD8D 5K9QI 5HXMA 1IC4H 3IDIB 5GZOD 4MAUL 2YUVA 3TCLA 3VE0B 4PRPD 2Y6SC 4C58B 3FB7B 5ID0B 4GAJL 1T89A 1D6EB 3OMZA 4XVTL 4MLSA 1G1YA 4M5YL 4QGTA 1KTLB 5F21B 4IS6B 1BF8A 5DMIL 3MXWL 4X98B 4U1NB 4LEOB 1PG7L 3S97C 4JZOA 4PS4H 3S88L 3L1OH 5JHDE 5FCUL 3X3FH 3RUGA 1WTGT 1WLHA 2P5EA 1KJMB 3C08H 1D7FA 3HMWL 1X4XA 1CGYA 4W6WB 4CU8A 5HBBA 4YXHH 1TDQA 1IGIH 4M48H 2BY2A 1F6AB 4WI3A 1HK6A 3O45A 4PV8B 3A6OA 4FQLH 3EYQD 5EO9A 5C2UB 1ZOXA 3D18B 1ROWA 4PYGA 1OB1A 4PJDE 1RVFH 32C2B 4YHKL 2FL5B 2E7MA 1L6ZA 3B5HA 5C6TH 1QD0A 4KI5C 3I02B 4LBEA 1EK3A 4IMKA 3FO1B 4L9LA 1JGUL 1JRHH 1QRND 3GHBL 4D0BA 3LN4B 3RTQB 3SGKC 2IALA 4X6EB 1XF2B 5ERWA 3MUGA 5EIVA 3VWJB 3LOWA 2ICEB 2OJZH 5EU5B 2APTA 3F7VB 4G80A 1EEZB 1NSNL 4UIKH 4WCYL 5I8EA 2LABA 3MCLH 3WNMA 1CR9H 4X6DE 4HX1A 5HGGS 1JK8A 2W91A 2Z31D 5HHME 1W72B 1A3LH 3UJIL 6CGTA 4WFED 5FGSA 1LWRA 4YH6A 2CRIA 5BW7A 3VFSB 3GMLB 5A1AA 3C09B 4I48A 5BZWB 4LCIL 4G6FD 1BJMA 2R4SH 2L4OA 2HVJB 1F6LL 1FQ9C 1LO2L 2DKMA 3EDEA 3Q6GL 4OQTH 5HHMD 2AJYH 4FQXA 4OCWL 4QHUB 1IJ9A 2XZAL 3FQUB 4PJEF 2IF7A 4FNLH 5I19H 5FOJA 4FFVC 5HHOA 3VGGA 5D6CB 4GQPH 1IC4L 4KRPB 1CGSL 2OJEA 3LPGA 4F7PB 1X5XA 3FN3A 3MUZ1 1D5IH 1NC2A 3B6SB 1I8LC 3HKFA 1NFIA 3MNZB 4FP8H 4FXKA 3VCLB 2XYCA 3PHQA 4PJHF 2C9AA 3VGDA 1JYXA 2D7MA 4KZEH 3V6FA 3G6JE 3IAGC 4OCNC 1TFHA 5DVLA 2VL4A 4PS4L 3G6DH 4P2OB 4ZSOB 4O00A 1P53A 4F7TA 1KPRA 4ODSH 5K33A 4NHUA 4PLKC 3RNQA 4QWWD 2DLEA 4KU1A 2K1MA 4JREC 4CDHA 5TQ2H 4XTRC 4ZFGH 1I1AA 2R29H 1QFWH 4LLVA 3RX8A 3NCBB 4EEEA 1RUQL 4PJFB 4FQLL 4JO4H 1RIUH 5E95B 4PRBA 1MJ8L 1T7ZA 2NQCA 1RVFL 2VR9A 3RGVB 3BZEA 2X4TB 4WI6A 1KSRA 1KB5A 2IEPA 4BSVA 4POUB 1N5AB 3RIFK 3EJJX 1EUUA 4RX4A 1XF4B 3QXDB 4NNPH 2QSVA 4M4PA 1JRHL 2IFFH 3HAEB 3QIBD 5EOCJ 5F9WB 3DMMC 4LPYA 2ZOLB 5CILL 3V95A 1RUKH 2C1OB 1BP3B 3TO4D 5ESVB 5GJTL 5JPMB 2OJZL 5C08B 4R0LA 3DTXA 3MCLL 3MRHB 1I9EA 1CR9L 1V3LA 3WNOA 3PL6B 2DYPB 3DLQR 4OD2B 4MX7B 2X4UB 3B2VH 4UT9L 3HZMB 4BFEA 4YNYA 2Z91B 3QDAA 1GOGA 1A6AB 3JWOH 5L9DH 4LU5H 4EI6B 3DROB 5HVHB 2NY7H 3GSOA 4PJIF 3LPWA 1I85A 2IANE 3G08A 1QA9B 1N2RA 1KT2A 3D85B 3CDCA 5CD3B 3KPRA 4LHUD 4JQVA 1HI6A 4DGVH 3V4UH 5I19L 3SDAB 4JY5H 2BMKB 5DK2B 2UZYB 3ARTA 1J8HE 4GW4A 1NGYB 1R5WA 3PHSA 4HG4J 4NO2B 1T5WB 1D5IL 4XNMA 1A3QA 1EO5A 3H7BA 4TTGA 4KRNA 2NY1C 1JZ6A 4I18A 3IJYB 2L7JA 4X99B 4OFPA 1RZJL 1HDMB 3N0PB 1J8HD 1FL5B 1E28B 3GSVB 1DBKH 2ARJQ 3H9SE 2OL3H 3DXAE 3G6DL 2GJZB 4EDWH 1LEGB 4RMRA 5EU6E 3GKWL 2G5BA 1YMHA 1JWSB 4WY7L 1KB9K 2C3VB 4Y19A 5GRZA 3IJHB 1NMAH 2JCCA 4Z9KB 4GJTB 3AY4A 5GS1C 4JKMA 2ATKA 1R0AL 1WEJH 3DXAD 5E6ID 2CLZB 5TGBB 1MWAB 1RUPH 5HDLA 4MCZB 2R29L 1QFWL 2BNQD 4JVWA 4KJPD 5EZIH 5AEAA 3SBWC 5CP7B 1K4CA 3WUWA 4EI5C 5I1GH 3LQZA 1RIUL 3O6KL 3VFTB 2WINB 2XY1A 3BHBA 1CU4H 5IOPB 1B4RA 2P8LA 2YD3A 3D1MC 3NFNA 1OAKH 4NNPL 4LGPB 2EH7H 2M2DA 4UTAH 3NAAH 2IFFL 4KJYA 3ULVC 3U1SH 5DURB 5J3HC 1G9NL 2ZKHH 1OGAB 4GRLB 5CBEB 1FV1B 5IBLC 5LWYL 5DFTA 5DJYB 3OJ2C 2PR4H 5IJVB 4XNZB 2DMKA 2P5ED 3OKEB 4C83B 3TIDB 3B2VL 3IF1B 1S5HB 3CH1B 5C0BE 3WUWG 4CN6A 5JNYB 2VISA 5L8LB 1S7QB 4UDUA 3QFJB 1R3KA 5C8JB 4KKAD 5HDQH 3LEXB 2R15A 4JG1H 1XFPA 2OX5A 2DM3A 5FGCE 5L9DL 4TUKH 3FT4A 4LU5L 3UAJD 3SJVE 2NY7L 4JE4B 4NZTH 4UQ2B 2IBBA 5I1IH 2CIKA 3ARDB 4M62H 4FG6D 1RHHA 3P30H 4OCMC 4OZHA 3WE6A 5DRWA 1OW0C 4FFWC 3F8UB 3BE1H 4AK1A 4DGVL 3L5XH 5HVFB 1HH9B 5F97E 4JY5L 4X7SH 5DK3A 1KIPB 5EBLB 3OGCB 3IB4A 2V9RA 4W70A 5E8EB 4TVPD 2CRYA 4U1LA 4KROD 1G84A 2BOCA 3ARVA 3BYYA 2KPNA 3ULUH 5BV7C 4S2SA 4I2XA 3IKCB 3F12A 2FBJL 2P46B 3FO9B 4HKBB 4K7PX 1AGDA 2VR4A 1DBKL 2NX5B 2OL3L 5EH1A 1IC5H 5E9DA 4HC1H 2I27N 2YBRA 2BRQA 1LHZA 2XN9E 4UINH 1WV7T 5C9JB 3MFFA 5F1KC 4M8VA 3MUJA 4J3UA 4BSJA 5C0RH 1H0DA 4NNXA 4OCLC 3RDTB 5CAYB 5HHOE 1TQBB 3SGKA 2FSEA 4LLUA 5F7MC 5T3XH 4W68A 3WXWH 5J12B 4KVCH 5FKAB 3OAZH 4IHOA 3ME0A 1O0VA 3J8F7 1CTNA 5EZIL 5H94A 1QEWA 3MV9A 4OLUH 5IEHA 4GG6F 4HV8B 4LP5A 2H9GB 5HHOD 1UH2A 5ICZB 4UILH 5A3IC 3ARBA 5F8QC 4Q7DA 3LS4L 2UY6A 2IBZX 1FNHA 1LEIB 3BOVA 1NC2D 2YA2A 3MODH 3B9AA 3CX5K 3NAAL 3UTPE 1Q0XL 1MVUA 3A6CH 3DIFB 4XP1H 3NA9H 3U1SL 1KJVA 2ZZUT 4UUJA 3RTQC 4K55A 4GG8B 4GKSB 2EE6A 4M6OH 4Q6IB 2ZKHL 5DLML 3ZE1E 5I2IB 3CZFB 3GJEB 4TRPH 3RGHA 3VWJC 5I75B 2NLJA 3X11B 4S1QL 4OQ1A 4LCUA 1EVUA 3K7UA 3UJJH 2PR4L 3K1KC 1IZKA 3RVVD 3DUSB 5KOMC 4JFEA 3ULSB 3IDJB 2YD8A 2Q20A 3C9NA 1I8LA 2BVPA 2HAZA 3OB0H 5HHNB 1G9MC 3C87A 1I1AD 1CL7I 1N6VA 4XGZA 4HQQH 5HDQL 4JG1L 5IMOB 2DTMH 4X6CA 3C09C 4APQB 4EUPH 1F8TL 5EORL 4TUKL 4KTDH 4JO2H 2VDQH 5E5MA 5GRYA 1MLBA 5I1IL 4M62L 2I07A 3L9RB 3P30L 5DJXB 4WW2B 4OKVB 4JVPA 4WI5A 4RX4D 3L5XL 1BFVL 1YECL 1FVCB 3IXTA 4Y1AB 1OP5H 3RL2B 5KSUB 3S37H 4X7SL 1ZHKA 4I77L 4YIQB 2V5TA 1TZIA 5FAAA 4WUUB 2X4NA 4KRPC 2CDFA 1EGJL 4K8RH 2EYTB 4KJWD 3GSQB 5E8OB 3O41A 2P8PB 4Z7VB 4ZS6C 3ULUL 3QDGE 5J6GB 3S34H 4HMDA 5CD5D 1IC5L 1WWAX 3P9MB 5DDHA 4X4YB 1H15B 2MQCA 1OAZH 4UINL 5INCA 1S9YA 4ZAKB 3F62A 5I1HH 4BQ9A 3DMMA 1SY6A 3RWDB 1TJGL 5T3XL 2YD6A 3WXWL 3NN8A 3LKSB 4KVCL 1VFUA 2AW2A 2EDOA 4LSUL 4DVRL 3UYPA 2IGFH 3KPRD 2FX8L 3HNVH 4OLUL 4ZFZB 3TH2T 1VENA 4XXCC 4LL9A 1KCLA 3PHOA 2F74A 3KNBB 5I1KH 2BSSB 3ESUF 3BIBX 3CSGA 4LP4A 3M17A 1GGUA 4PGBA 2BC4B 2A6IB 3KYMA 3A6CL 4XP1L 2D7OA 1QBBA 2R1XA 1WZMA 1XCTA 4HH8A 2JCCE 4Z0XA 5F9WC 2ZUWA 4M6OL 4OLYL 1S5IH 1MJUL 1V8HA 3UJJL 3ROOB 2HLAB 2CIIB 4KKCC 3Q5YA 4HWBA 4Y19D 3MNVB 3PL6C 3V0AC 1ETZB 4N5ED 4X6FA 3DX8A 1ZGLM 3ZTNH 3EOAB 1UM5L 2F53A 4OTXH 1UZ6F 3VXTA 4HQQL 4NT6B 4M7JH 4L8BB 1FBIH 4CMMB 1G7QB 3L3JA 4KTDL 4JO2L 5HVHC 1JNNH 3KWWB 2HMID 4YLQT 2O93L 4ACPA 1CDJA 5AD0A 2H32H 2UV3A 3SDAC 4F9PC 4V1DE 4DN4H 4MD4A 2PYFB 4PY8I 3UTQA 3QZWA 5GS1A 5IW3A 4C56B 2VERN 2AEPH 2EKJA 2ITDA 4MNQE 4K8RL 1MHEA 5FYJD 3A67L 3SBWA 4EI5A 4G8IA 2YOCA 1JE6A 1YY8A 4Z7UE 3OJDB 4JDTL 1MCDA 4YBHA 2M26A 1JZ2A 1MSPA 1DQDL 1SYSA 5EOQH 3K4AA 5SX4I 1FFPA 3C8KB 3S34L 4M6ML 2DJ4A 5EZJB 3DV6B 4F7MA 1OAZL 3VFGL 1LK3H 1GXEA 4OV6F 3PDOB 4BUHA 1HH6A 4RMTA 2VYRE 5CMAB 3WFBH 5I1HL 1IKNC 1CICB 2VIRA 3LN9A 4QRTA 1Z0NA 2VXSL 4M6AA 5GGVH 4D9RD 1CXEA 3OAUH 1XGQA 3QZWG 4ZODA 4ODUA 2IGFL 4OZGE 3NIDE 4X6BA 4L3EA 4NQEB 3PNWA 4G8GB 4O2FA 1MEXH 1JV5A 4YHZL 1IGTB 2D2OA 2CH8A 5BZDA 4QOKA 1B0RA 5CS7A 5FGBC 4EN3B 1WBYA 3IU3A 4KI5E 3WFCL 3FO2A 4JCMA 5HHQA 2FRGP 3Q1SL 3ROLB 1U41A 4NOFA 1BQHB 1MHCA 1M6OA 3EFFB 4ZG1A 5C3TA 4B7IA 6FABH 4GRLC 1S5IL 1OW0A 5E9DD 4KI5D 3MACL 4PG2C 4BZ2H 3INUH 3MV9E 4XNZC 3IDIA 3VH8A 3O6FB 3UZEA 1QSEB 3K74B 5T5FH 4OF8A 3I50L 3VE0A 3ZTNL 1HHHB 3FB7A 3K4DA 4OLEA 3X14B 5ID0A 1FP5A 1T1ZB 1D6EA 1BVZA 1MFBH 2KUTA 4OTXL 3SY0B 4IIQB 3G5VB 3NZHH 4HUUB 5ECJE 1KTLA 3MV9D 4IS6A 4M7JL 1FBIL 1QBMH 4X98A 4U1NA 5JDSB 3REWB 4LEOA 1JNNL 3ARBD 2CKBB 1AJ7H 3DECA 3H3PH 3DX7A 1SBBA 3ARDC 1QBLH 1PD6A 4TQEH 3LY6A 1KJMA 4H0HB 4HIEB 5E2VH 3CZJA 2PNDA 4JKLA 1QFOA 4DN4L 4ELMB 4JFEE 1GGTA 2FGZA 3U46B 5KZCD 1QFUH 3KGRA 4WEBH 4J3SA 4MB4A 3I6KB 4OSUL 2Z8VC 1A6ZB 5E4EB 1F6AA 3VH8G 1MY7A 4PV8A 4YJZL 2XIDA 4KK8C 4FFVD 3VFVB 3QP3A 4X6CE 4B5EA 4B50A 32C2A 4P2YA 2NY6C 3P77B 4JFED 4NRYB 4Z7WE 5E1AA 1GC1H 5EOQL 2EO9A 2FL5A 4XHQA 1DN2A 1IMHC 3WSQH 2FEEL 3I02A 4X0KA 3LB6D 3ZL4H 3FO1A 2DIBA 4ALAH 5JXED 1ZLWH 3T65B 2W9DL 3RDTC 1E6OH 1ZE3C 3LN4A 1TQBC 3L3GB 3RTQA 5E5UB 2OR9H 4IJ3C 4X6EA 5DHXB 1XF2A 3O3BB 1CFTB 2HJFB 4UTBH 3VWJA 1UEMA 1G7HA 2ICEA 3PV6B 5J12C 3NCJH 1EEZA 2J88H 3OAUL 1F90H 4NO3A 4OUUB 4PJ9D 5I1DB 2ZOKB 3JWDH 3OXRB 3P40A 1W72A 4LCCB 2VLJB 4XTRD 4ONOA 4LSSL 2QQKH 1IQWL 4K3GA 1T4KB 4I9WE 1U8KB 3VFSA 3GMLA 1YMME 4J6RL 4Z7QF 4HFWB 3QWRA 1QHOA 1TPXB 1QHPA 1WITA 3MCG1 2HVJA 3T4AB 4R97C 3DYPA 5H2BB 1IAIL 3DVFA 6FABL 4QHUA 1FSKB 5EIIB 3FQUA 2AJ3A 5I75C 4LVNB 3QO0B 3EO0B 4BZ2L 1QSFB 2FBOJ 4HSQA 5D6CA 2R2EB 3CMOH 1WIPA 4IRJB 5C0DB 2BOBB 2HVKB 3DMMD 5T5FL 4F7PA 1DBMH 5ILTL 3EGSB 3D3VB 1KXQE 3SO5A 1F2QA 2CGRH 3B6SA 4MJIE 4LSRL 3MNZA 3VCLA 2HFFA 2X1OA 2EDQA 3JWOC 3QIWB 4K7FB 4YDIH 3FKUS 4YGAB 4Z78B 2F54E 4HT1H 1L9MA 1QBML 2EIZB 1HCVA 2QQNL 1U95A 3AREB 3QUKB 3VGFA 4ZSOA 3DWTA 1AJ7L 3KPPB 2MNUA 2ZUXA 2X44D 3ZT7A 1QBLL 4X9FA 3KPSE 1AGEB 3IGAA 4TQEL 4N68A 2BX5A 5D7KD 2MCPH 1A7NH 3WIHA 2V2TB 3OAZK 4MDIB 5F7UA 2H6PA 1LE5A 1CVRA 5I18H 4PJFA 2F53E 3QHZL 3CU7A 1T3FB 5J1AB 4BH8B 2VLKB 4XXCA 3MLSH 4MJ4A 2F8XC 4L3AA 5DFVC 1NFDE 4KMQA 3F6IA 3RGVA 1CF8L 5GS0L 1DBAL 3U4EB 5IM7B 1N5AA 3WSQL 2NY1D 1XF4A 2F53D 3QXDA 4LLDB 1SMOA 3U36B 4AEHH 3HAEA 4LNRB 1E6OL 3BQUB 4NN7C 1F11B 2X6MA 3BGAA 2OR9L 2ZOLA 4YHYB 2C1OA 5ESVA 4DKDC 4UTBL 5JXAH 4Y5VB 3NCJL 1G7IB 4WFHD 2ICWI 2J88L 5C08A 1F90L 3TT3H 3PP4L 2DQFB 3SE3C 4Y5YB 3MRHA 3T8XB 4L1DA 3PL6A 2DYPA 3JWDL 4NC2B 4OD2A 2BRRL 4MX7A 2X4UA 4HS8L 2G9HB 4WRLA 3UZQA 4QHNA 1IGFH 2IH3B 4NBXB 3HZMA 2Y1VA 2YD4A 4JR9H 2QQKL 2Z91A 1U8JA 5GS0D 1A6AA 5BVPL 4EI5D 2ID5A 4EI6A 3ULVE 3DROA 4ZOAA 3TPUB 3CFIC 4H26B 4MQ7A 3MV8B 1QA9A 1A9BA 1IM9D 3OGOE 4MXVE 1MCJA 2B1AL 4YHLL 3HAEG 3D85A 1ERNA 2R2BB 5CEXB 5GGRY 3GKZA 4DKFH 5TDPB 4PP2B 3L5HA 3SDAA 2PXYC 4F9PA 5DK2A 5I73B 3ULVD 3IDXH 1NGYA 3R8QA 4HJJL 5LGJB 5J3HD 3CDGB 2JF1A 4GRWB 1DBML 3PP3H 4NO2A 1T5WA 4ZO7A 1JGDB 4QOKE 4XP5H 5IBLD 5J89A 4YDIL 3IJYA 4OD3H 3OX8A 2CR3A 4X99A 1HDMA 4L3ED 1UZ8B 1FL5A 1GGIL 2HTKC 4HT1L 5C09B 1E28A 5F9JB 3I6GB 1NGQL 3UTSB 1FNAA 3CNKA 3GSVA 1IGCL 5BS0B 2GJZA 5EFIB 1LEGA 4YPGB 3ARPA 3CVHB 2DLHA 4J8RB 4QOKD 2WBJC 4J3XA 3PWVB 2C3VA 4F3FB 1CIDA 1IKNA 3IJHA 2ZPKL 4XPAL 2PETA 1XEDA 1ZTXH 1A7NL 1J1OH 5BXFB 4XRCB 2JJWA 5MEPA 1MFCH 2CLZA 3RX5A 5TGBA 1J5OH 1MWAA 1RZGA 2R4RL 5IUSA 2B4CL 3M45A 4FFWD 5I18L 3F7YB 5CP7A 1EO8H 3BSZH 4BFGA 2ORBL 1OWWA 4M00A 4BELD 1WBZB 1P9MC 3GRWL 2WINA 2IH1B 2D03H 5FGBA 5IOPA 1JHLH 2AK1L 3VGEA 1H9VA 2ZUQB 4YHNA 2APVA 4NWTL 5DT1H 1DL7H 4CNIB 2J6EA 2YZ8A 1OGAA 4GRLA 1CICC 1AR2A 2E3VA 2CR6A 3HB3D 3LS5H 1K3ZA 1D5ZB 4JFOB 5CBEA 1FV1A 5JXAL 3WS6C 4PG2A 1BM3H 4XPBL 2XG5A 3TT3L 5IJVA 5GGVY 3OKEA 4TUOB 4C83A 4JQXC 1WZKA 1JGEB 1TZGH 5K9JL 3IVKB 3NABH 2AGJL 2YN5A 5CHNB 1S5HA 3CH1A 5JNYA 1S7QA 3QQ9C 3SDXE 3QFJA 5C8JA 1WAAF 4EN3C 2B5IB 3LEXA 4HD9A 4MZ3A 4OQTA 2FJHB 1K8DB 1Q1JH 3MA7B 4PRIE 3MJGX 1TZHA 2SEBB 5CKGA 5A3ID 1D5XB 4UQ2A 3KXFB 4ODTL 2FCBA 3SE8L 1Z9MA 3TWCL 4PRDB 3ARDA 4M43H 5D96B 5D9SB 2JJVA 2LQRA 2W0LA 4KVNH 5DUMH 1HKLL 4DKFL 4OCRH 1XAUA 4TNVK 1HH9A 4RGNB 4OIAA 4Z76B 2FWOA 3OGCA 5CEZH 3RTQD 1CXHA 1GSMA 1JFQH 4MB3A 3VWJD 1ZEAH 5E8EA 5J11C 3IS1X 4XP5L 4E41B 4EQ3A 1P84J 4IIQC 4OD3L 5IESH 3UBXB 3QXAB 3H9HA 5FB8B 1A14H 2CO6B 1UJ3C 1N64L 3IKCA 2YC1B 3KDMB 4HKBA 3FO9A 5J9PA 4HBCL 2NX5A 3TNNA 5E24E 4Q0XH 4JB9H 5C9JA 1KCKA 5DZOA 5JW5B 2IWGA 3RDTA 5DRNB 3ILPB 2Y25A 1MCRA 2ESVB 3QWRD 1V7MH 1JWMB 2BSRB 1ZTXL 5F89B 5B8CB 2I60L 1J1OL 2MKLC 5FKAA 3T2PA 1J5OL 3D87B 1LP9B 2DM7A 2N1KA 4K3JH 4CAGA 2I9TB 4HV8A 2J2ZA 1YEGH 2H9GA 5ICZA 4KUZH 4KFZC 1HHIA 2FO4B 4KRPD 4X9IA 2D03L 5JIKA 1LEIA 4ZSOE 3HLAB 4RRPA 2R1WA 4QO1A 1F3DJ 3PJSB 1Q94A 5DHVH 1MELA 1H3PL 3DIFA 5FM5O 3VXRB 5DVKA 4ZS6D 3FQTB 1OAXH 2WUBH 2ARWA 4PJ7F 5DT1L 4Q6IA 2DKUA 4GG8A 4GKSA 2OYPA 2QTEA 4P2OD 5I2IA 3LS5L 3GJEA 2FECI 3HN3A 3X11A 1KXVC 5LCVH 5HYQA 3OHXB 1NPUA 3CU1A 1KLUB 3BPCB 1YNKL 3DUSA 3MNWA 1BBDH 3ULSA 1R3IL 1A1NA 4G7VH 3IDJA 1CL7H 4YUEH 2YR3A 3EOBB 5D7IB 2Y06H 5I0DA 3OF6A 5ENWA 5HHNA 1UH4A 3MA9H 2VZ3A 5DEZA 1CDGA 2LVEA 1G7LB 1WFTA 5IMOA 4FRWA 2HJLB 2B0SH 1Q1JL 4APQA 3V7AE 3KLHC 3BP7B 2F15A 1P6AB 1JNJA 2DLGA 5IK3B 1EEQA 4RRPG 5IVNA 4ZYKB 4L5FL 3RGVD 1LO3H 2CUHA 1U8MB 4EBQL 5DJXA 5DUML 4BYHA 5C08E 2AJXL 1FVCA 4Y1AA 2FJFB 1W2KT 5KSUA 3H8NA 3T77A 3ALPA 3LN5B 1AC6A 4A2MA 4WUUA 5CEZL 4IRJC 5EUOE 4JFPA 2EYTA 1JFQL 3GSQA 1ZEAL 1OPGH 3HC3H 5C08D 3QIWC 3RPKA 1IBGH 4BZ1H 2P8PA 5IESL 3G04B 4NQDE 4Z7VA 3IDGB 4KKCD 1A14L 3PL6D 2DYPD 4HDIB 2AAVA 3QHFH 5J6GA 2QEJA 5KS9B 2Y5TA 1MFEH 4GAYB 2I9LA 3P9MA 4Q0XL 5IBTL 4X4YA 2WIMA 1QPPA 1OARH 1CK0H 1ZLWK 2C1PB 2JELH 5TE6L 1KENH 5IJKC 5FHAH 2MPAH 5EBWB 5EU3B 1BPVA 5KW9H 3T0BA 5CLWA 4D3CH 3D85D 1J1PH 3DV4B 5AWNH 3SE3A 2HJKB 4LMQE 4AL8H 4K3JL 4U6YB 3SDAD 1YEGL 5ADPH 2FB4H 5GGTA 4KUZL 1BGXH 3PWLB 5CIPH 5KVDL 1YYML 2COQA 2K7PA 4F2MB 3IU4H 3KNBA 1DLHB 1UM6L 4JRXE 4F33A 3Q0HA 3R1GH 4RFOH 1JYWA 4RDQG 2KQMA 5F6HJ 4MNHB 2A6IA 1FHGA 5TPWL 1IQDB 1MIMH 3O2VL 3GMPB 2EE3A 2WUBL 3THMH 4GXUN 2O61B 5D93B 3BDYL 1T20B 3OG4B 4XBGB 3UTTB 3MJ9A 4Y5VC 5DTFB 2PXYA 5DFWH 5L8JB 1HSBB 2HLAA 2CIIA 3MLXH 1JL8A 3MNVA 4LLWA 2P43B 1ETZA 1IL1B 1TITA 1BZQK 4PJ5B 1T1XB 2Y06L 3EOAA 1DBBH 3MA9L 2XWBB 4PR5B 4NT6A 2E7CA 4L8BA 4CN4A 4CMMA 1G7QA 1FYTE 4QRRB 3WFEL 1UXWB 1A4KB 4UZGA 4ISVB 3KWWA 2DL9A 5EBMB 5ALCH 3ZE0F 1F2XK 2H45A 1LO3L 4HMCA 3BD4A 2WBJA 2XT1B 3BYTA 4WU5B 3ZYJA 4MJ6B 3H9YA 5I30H 5I73C 2PYFA 3FB8B 3GFUA 5DURD 4MMXC 3CFJB 2FIRT 2LTQB 4C56A 4CDGC 3N85H 1OGAD 1UKTA 4GRLD 2MWCA 2QV2A 4NM4H 4WU7B 4A6YB 5I74B 3G5YA 3HC3L 3QFJE 1OSZB 1EHLL 1ZS8B 4BZ1L 5SX4H 2C4FT 1P9MA 3OJDA 1AGBB 3S5LB 4H88H 4R4NC 3C8KA 1GHFL 1ZANH 5C71A 1MFEL 3SDCC 5EZJA 4LHJB 3DV6A 3EBAA 3QFJD 1LGVA 1OARL 4UMGA 4Q97A 3PDOA 2VAJA 5CMAA 2JELL 2VH5L 1KENL 4PJAB 2UWEF 4PJBF 1CICA 5FHAL 1U0QA 2A74B 2MPAL 4UAOB 3GB7A 5KW9L 1NCCH 1OD9A 3WS6A 4NWUH 3ARDD 2QHLA 5C2BH 2DLIA 4D3CL 5AWNL 5T1LB 3UJTL 5C0CE 4AL8L 4JQXA 4NQEA 2ZCKH 1RIVL 5FGRA 1H8NA 1FH5H 4MZ2A 2FB4L 3LKQB 4G8GA 2MFNA 5E8PA 1BGXL 1GC1C 5DJ0B 1S7SB 3LEVH 3I3DA 3DPBA 1IGTA 3IU4L 1PSKH 1TVDA 1JTTA 5DD1H 3NBNA 5KVEL 2J1KA 3R1GL 4EN3A 2R8SH 4LOUD 5EOTB 5I0ZA 4KK8D 3ROLA 2HP4A 2ZUQC 1A6WL 1BQHA 1E4WH 4KMTH 3EFFA 1AI1H 3QXTA 1DLFH 4HGWB 3THML 3V6OC 3JSSA 2AS5M 4X9HA 2NX5D 1HINH 2GJJA 4R7DB 2YHGA 3QSKB 5DD3H 1MCPH 4JFYB 4Q74A 3ZO0A 1RJCA 3T2OA 5CUSL 1KLGB 3RDTD 1QSEA 1AXSB 1QG3A 3C6LB 1N8ZB 3PP3K 2E6QA 3LV3B 3QNZB 1HHHA 3S4SB 3X14A 5LBSH 5T3ZL 1T1ZA 5SWSB 5KVFH 1DBBL 4JFHE 3QUZB 4EUPA 2ED8A 3SY0A 4IIQA 4Q58C 3G5VA 3TO2B 4HUUA 2GEEA 2B5IC 4NQVB 3JVGC 3FAWA 3HG1A 1CFVH 1NEUA 5CSZB 5JMRA 5JDSA 2FHFA 1WWBX 3REWA 2CKBA 1MAMH 5SWZB 5D96C 1BQHG 4JFHD 2H1PL 1N7MH 1FL6B 2XZQH 1MNUL 3MGOB 5I30L 5DQJB 4HIEA 1U92B 2LU4A 4RGNC 2NNAB 1EHNA 3H3BC 2I25N 4ELMA 3U46A 1MCBA 3BX7C 1V7NH 5IFHL 3RY6C 3I6KA 3KHQA 4NM4L 2DBLL 1TJHH 1Q0YH 5DS8B 1OSPH 5KVGL 1IM3B 5T3ZD 2Q3ZA 3QEGL 3VFVA 4WWKB 1I9IH 4CN1A 4EUPG 3NPZB 2BNRB 3P77A 4G9FB 4NRYA 4H88L 1I9RH 4HJGB 4ODVL 4XP6L 4DCQA 1ZANL 2ZUSA 4AH2A 5C0FB 3KYOB 3OF6D 4GAGH 2C7UB 2XQYK 2RHEA 4WJ5B 2ZNXA 3T65A 4OB5H 1AR1C 4Y1AE 4APQD 3O6LH 3L3GA 1A3RH 1MCKA 2EC9T 3O3BA 4K9EL 1CFTA 3FN9A 3PV6A 1YEJH 1NCCL 4NWUL 1OP3K 4YHOH 4KDWA 5D7SH 4OUUA 5C6PB 5I1DA 8CGTA 3DNKA 4LPUA 2ZOKA 4HPOL 1FH5L 4Y1AD 2OZ4H 3OXRA 4JHZA 4Z7VE 3U79A 3GJFH 3KJ6H 3LEVL 4LCCA 2VC2H 4WUUD 1VEOA 1PSKL 2VLJA 3P4NA 4XMKH 1A6UL 1T4KA 1U8KA 5I6XB 5GGTL 5GGRA 3ISWA 4YE4H 4X5XB 2VXTH 4HFWA 1BMGA 2AQ3A 3L5WA 5T1DH 3T4AA 1CD8A 3V5HB 5DFVD 2XQBL 2DD8H 4KH2A 5FOBB 5D2LB 5CZVH 2AERT 1FRGH 2Z93B 1FZOB 4LF3B 5EIIA 5MEQB 3BGMB 4TULH 4L1HA 1HINL 1AP2B 3QO0A 3EO0A 1QSFA 4KUCD 1DCLA 1MCPL 2BSTB 2I5YL 5T5NG 4CW1B 8FABB 4N0UA 2R2EA 4ZAKD 4IRJA 5C0DA 2BOBA 2HVKA 4S11A 4H1LB 4CMHC 4FXGB 3T04D 3EGSA 3F58L 3MJ9L 1B4JL 1OLZA 4DKEH 3QIWA 3BI9X 4BZYA 4K7FA 1RZFH 2BVOB 2QR0B 2FH8A 4Z78A 2ZUVA 5KG9B 1IEAB 4YWGL 1AQKH 1FNGB 3JV5A 3AREA 3QUKA 5E2TL 5IQ9B 1F4YH 1MAML 3KPPA 1KACB 5FA3B 4ZTPH 4DQOL 2B39A 2O5XL 1H5BB 1AGEA 1CE6B 2XZQL 3V5KB 4X4ZA 5IJKA 3AB0B 4XC3H 1DUZB 4ZQKB 1JF1A 2CLRB 4DWHA 1V7NL 5JA9A 2V2TA 4MDIA 4PRNB 2DDQH 2H3NB 4PJCE 4HG4K 1Q0YL 5ICXA 5C7XH 1T3FA 5J1AA 4BH8A 2VLKA 3AMKA 4K94H 3QJFB 1QYGH 1MQ8A 3TYGH 2KKQA 1U36A 4DZ8B 4WGVB 3U4EA 5IM7A 4MWFB 5B4MC 1F97A 4GAGL 4LLDA 1MFNA 3U36A 4XX1E 4HCRL 4N8CH 4PV9A 3D0LB 4N1HB 4LNRA 1Z9OA 1F11A 4KXZH 3O6LL 4G6JH 2VAAB 1A3RL 4KY1H 2F8VA 1PX4A 4X5WB 5FV2A 4Y5VA 1G7IA 5ESAB 2DQFA 2XZZA 3W82A 3ULUE 5D7SL 3T8XA 3UC0H 3CD4A 4YR6A 2OZ4L 4Q6YA 3SQOH 2G9HA 1KPUB 2L7UA 2IH3A 4XWOC 2VC2L 4C56D 5IW1B 1IKFH 1B9ZA 2VDLH 4RGMB 4NQUA 5KSBF 3QNYB 4U1GB 2X70A 4HXBH 4UDTA 5I8CB 3WKNA 5T3XE 3HUJF 3MMEB 3TPUA 4H26A 4NBZB 5T1DL 5HYJA 3BP6B 2DD8L 3MRFA 5F96H 3FJTA 4HLZH 2F5AH 2AV7A 5D93C 5CZVL 2R2BA 4ERSH 5CEXA 5H37H 3MREB 4TULL 5TDPA 2PF6A 4PP2A 4POZD 4TSBH 4KGJA 3ZSSA 4I0PB 1RAMA 5LGJA 1DDHB 4G8GE 3CDGA 3FFCB 3RQ3A 2J8UF 43C9B 1CICD 4BQCA 5A2LH 4XP4H 5F7LB 1JGDA 4DKEL 1RZFL 5F3BB 4AT6B 2UY7A 3SE4A 5DZLA 1KCSH 3MUY1 5C09A 1UZ8A 4NQED 5AZ2H 5IQ7L 5F9JA 3I6GA 2R2HB 3BWAA 1UACH 4G8GD 1AQKL 3UTSA 4F7CB 4EDXB 3MRIA 3D9AH 5BS0A 3RHWF 2ADGB 5EFIA