5EORH

Structure of the murine antibody fab 8e3 bound to the vaccinia virus a27 peptide 101-110
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
214
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGLSLTSYGVHWVRQSPGKGLEWLGVIWSGGNTDYNAAFISRLSISKDNSKNQVFFKMNSLRADDTAIYYCAIYYRYGAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTGSSVTLGCLVKGYFPKPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti vaccinia virus A27 antibody 8E3 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 38
structure length 214
sequence length 215
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorH02
1NGQL 4LHQB 5IM7A 4G8IB 3GJEA 4XXDB 1I1FB 1VHPA 5LCVH 5HHNB 5EBLB 3ZYOA 2LVEA 4OFKA 1DL7H 5GS1B 1N2RB 1GC1H 5SWSE 5FK9A 3VXRD 4P23D 2IGFL 4M7KH 3V2AR 4MJ5A 5IVXB 1ZEAH 5KAQF 1Q72H 3BYYA 2XQBL 5C0NC 5A3IC 2O61A 4IOIA 4L4VA 4Y16B 2HKFH 1GZPA 3O4LE 4JZJB 5ESVA 4Y88A 4KJYA 1MY7A 2YD6A 2DM3A 3TNMB 4YHYB 3MTRA 1HHHA 2VQUA 5EZOL 1UWEL 3QIBA 3OBAA 5D5MF 2J1KA 4E41E 5I8OL 2L7UA 5HGDB 4RQQA 2IADB 2AJ3B 4JN2B 4PJEE 1MCKA 5MEOB 4X7EC 1T0MB 1S7SA 4PD4J 2FR4B 1XF5B 3D2UD 4ZS6C 1P7KA 3QDGB 1QBAA 5TH2B 4WDIB 3PHOA 3TCLA 4HJJH 5F6HJ 3ZDZF 3RWJB 5D8JL 3QIBC 5E7BA 4DAGH 4ZXBA 1CE1H 2NYYC 4Z9KB 1J0IA 4NJ9L 2ZCLL 5CEYB 3F7RA 4BZ2H 3LKSB 4YPJA 4IDLA 5SWZB 2MQ0A 3FO2A 3VFNB 4XT1C 4ODUB 1FAKT 4W4OC 2VSCA 3ZDYF 3SE3A 3O8XC 3ZMRA 5JQHC 1MJ7L 4YZFF 5ISZD 2IBZX 3X3FH 3QDMB 3QBTB 4ELMA 4KJQD 3D3VE 3MLXH 5F3HA 4L9LC 4F33A 5DHVB 4MAYC 4AQ1B 2W9DL 1B2WL 3GK8H 3ES6B 5HHMB 3FT4A 3PQYE 3VXME 5TE4L 5C0IB 2ESVB 4P5TC 4GFTB 1PYWA 5KANG 2PYFA 2XZCL 4Q74A 4OZHB 2V2WB 4L29A 3MRQB 5L2KB 2KQNA 4F2MA 2Z35B 3T0EA 4WVRA 5E9DA 4HQQH 1NBVH 1RK1A 1KXVC 4LHUD 3GBML 3LH2L 3TYFB 1JK8A 1G9NC 1KJ2H 1NLDL 1IGML 2DKMA 3MREB 3ME0A 5B38B 3BRGC 5E08L 1E6JL 3C87A 3ARXA 4P2CG 3ZTJH 4K3DH 2LV4A 4KRPD 1W0WA 1SBSH 4UNUA 4YK4B 4GKZA 5CILH 5KVEH 1JPSL 1AGBB 3KVQA 8FABA 1BQHA 3Q0HA 3T0EC 2BNRA 3KJ4B 1AQDB 5FECA 1N0XL 1MCBA 2VLJA 4TVSa 1AO7A 3V52L 5IMOB 2DQIL 5JDSA 2BCKB 2BVOB 1I85C 4PJBE 2E6QA 2EDXA 3GMMB 4Z7WB 3IU4L 3RWDB 4HUKB 3IDMB 3V0VA 1RUKL 3BT2H 3NCJH 2O5XH 5T33L 5C0GB 3TT3H 3IAQA 2P5WA 4HUMB 3GSNL 1D5ZB 3IDUA 3MLWL 4XPFL 4N0YH 3JV6A 1J1XH 1D6EB 3F12A 5DQJB 3RL2A 3WJLC 4Y4KB 5JLZA 4KU1A 5DD5L 4YXHL 1MI5D 5HHOA 4GG6F 5TE6H 1XIWA 4JFOA 4PS4H 1I75A 4NJAH 3HUJE 1MCJA 3MUGB 3UP1A 1MHHA 1V3LA 4U7MA 2CIIA 2EDRA 4WCYH 5EU7E 4LLVB 4AEEA 4R4ND 1VCAA 4W81A 2IANA 3QRGH 1PAMA 1ES0A 4JDVA 2YZ1A 3SOBH 4HBQA 4ZPVB 2WINB 3OKKA 2BNQE 3D87B 3V4UH 3K7UA 3O9WD 2CDEA 1FZJA 2IJ0C 2ZG1A 4RDQF 5BRZD 4RX4D 3VI3E 2DLGA 4HC1H 1FVEB 5IW1A 2E7CA 3DGCR 3O6KH 1JIBA 1IEAB 1CXFA 1NGYB 5ICYB 2R8SH 3F6IA 5J06A 1D9KA 3MNZA 5KOVC 5LXGL 3O6FB 2Q6WB 4PJIE 2DD8H 2ED8A 1UJ3B 4WFGD 3HR5B 5TPWL 3EO9H 3QXAB 1T5XB 3SKUD 1WWCA 1I8MB 3LSOA 1OT2A 1HH6A 3DXAD 4KWUA 2WMPA 4HUNB 2YPLD 4J1UA 1S9XA 5BZDB 4Z77A 4MCZA 4OZFG 4NN5B 3V6OA 1DBAL 1X5HA 3U9UA 2NTFA 1EGJL 4NRZB 3MLRL 2A74A 1T2QH 2ED9A 3C2AL 4NT6B 4QHLB 1OP9A 3ECBA 5EFIA 4OB5H 1ZHLB 3B2UC 2ZCHH 1MCWM 3ARUA 2VH5H 5DMIH 1TVBB 2X40A 3VFMB 5TDPA 5ECJE 5F7KC 3FN9A 1HHGA 1A6WL 4HXAL 1DTUA 4CJ0A 1N8ZA 5KVFL 4XBEH 4FQ2H 1KEMH 1OAZL 4G8IA 4XXDA 1C1EL 1I8KB 1M6OB 3PL6A 4AEIL 1N7MH 1GSMA 1C5CL 3QEQE 2M26A 4DFHA 3QPQC 5IJKC 2L4OA 4CKVX 2ICWB 3AAZB 2VDOL 4F8TA 4BSJA 5IVXA 4K7PY 3AROA 3BSZL 3CFIC 4OI9A 1U8MB 2DQDL 2F19L 4ERSH 1CFNB 5CIPH 3UTQB 4Y16A 4ISVA 3ARVA 4JZJA 2ZCKL 1NCDH 3U4BL 3K74B 4HWZB 4U6VL 3TNMA 5I9QC 2OQJB 5I1IH 3UDWA 5LGHL 4WO4C 4YDVB 4BFIB 5GS1C 2FIKB 4WTZA 4XPGL 5M94B 5ILTL 4BKLB 2XZQH 1JGEB 5HGDA 5TE7H 3OJ2C 2IADA 1AI1H 5BQ7B 2KH2B 4UOJA 2IFFH 4S0SD 2AJ3A 2XI9A 4JN2A 4MQXC 5D7IA 3TZVD 5MEOA 1T0MA 2FR4A 1XF5A 1K2DB 2QHRH 4TYUA 5IHLB 5JPNA 3QDGA 4JQIH 2B1HL 5T3XE 4G8GB 1AHWB 4WDIA 4YHYC 3RWJA 2OBGA 3FFCA 4OCYL 4ALAL 4LLDB 1ZGLP 4EI6B 1BVZA 3VFTB 1MH5B 1O7VA 5CEYA 4RISH 3LKSA 4D0BB 2P46B 3ARGD 5SWZA 4WNQA 2BP3A 1FJ1A 3IU3A 1IAII 4QRSB 5E94A 3VFNA 3CVHL 4ODUA 1KTDB 1CFTB 1KLUB 2V5MA 5HI3C 1DLHA 5EIVA 3PWNB 3SCMC 4PRHE 3MOAH 3MLUL 4TRPL 1YY8B 4QXWA 1P4BH 4W70A 1X9QA 4PJIF 2Z9TA 3QDMA 1D5BB 3MOBL 1Z6JT 1JNHA 2HT3D 3GHBH 3OKNA 3T08A 5CJXC 4MA7L 3VDAA 5ABDE 5DHVA 1CTNA 3ES6A 4Z7OF 3G9AB 5C0ND 3AGVA 3GSXA 1JI2A 4RGNC 1Q0XH 4OZHA 2IG2L 2V2WA 5CCKL 3MRQA 4ZNCD 3FTGB 3CPLB 1RUPH 4N8PA 4QTIH 1BGXL 3QFDA 4JPVL 3Q5YA 4L3CB 4HFUL 5DT1H 3UJJL 1FFRA 2W9EL 4JVWA 4UT9H 5GRJL 3K81A 3TYFA 3MREA 4JCLA 5E70A 5B38A 3HG1B 4ZFGL 1F42A 4OZGE 1I1RA 3D0LA 4PGEB 4JG0H 1CVRA 2IFGA 3SKNB 4L4VD 4E42A 4PP2B 2MJWA 3OGOE 2AJXL 3KLHD 4F8QA 4KFZC 1AR1D 1FORL 1AGBA 1VESA 3QIBD 1AQDA 1W72H 2NYYD 1NKOA 2LVCA 3RPKA 2A1WH 4EZMA 4M48H 1NFIA 3HNTL 1IAIH 5IMOA 5KJRL 2BCKA 2BVOA 2OR9H 4FFYL 3OAZH 1F5WA 3GMMA 5EG6C 1T2XA 3O8XD 5TFSH 3RWDA 3IDMA 4FZEL 3IRZA 3RA7H 2EDWA 5C0GA 4A2LA 4X4MA 4HK3N 1J5OH 1NCWL 4KJWC 4ZXBD 1B9ZA 3KJ4C 4X5XB 2CJUL 4Y4KA 5DJCA 3WO4B 2FEEI 2VE6B 3I75B 2HT4D 4YBLC 2VLRE 3OJDB 3R8QA 3L5XL 4P5TD 4JRYB 5C0AB 1DBBL 4P5KB 2VAJA 2RBLA 3MUGA 4TSAL 4X4XB 1RURH 4HCRL 4U1JB 4HS6B 1F90H 4LLVA 5T1LB 4G3YL 2OL3B 2PR4H 2B4CH 5C1MB 5DJDA 5SX5K 3BUYA 5HYSB 4ZPVA 2WINA 1WZLA 1LEIB 1LO3H 1HYSC 3VU2A 2R23B 4OFVA 4PJDE 4UZGA 1IC5H 1NGZA 1FRGH 1A3LL 2DJSA 3VMPA 4F37F 1MCEA 1FVEA 3WUWG 3T0ED 5E9DD 5FO7A 4XTRC 5H37H 2AEIT 3VFWB 4P2QE 1NGYA 1C8PA 5ICYA 5J1SC 5J6HB 1BLNB 1NGWB 4GXVH 3W39B 4S2SB 5DK0A 3O6FA 4YE4L 2O5YH 2Q6WA 1EDQA 5I75C 1Y0LB 4X80H 2Z8VC 3HR5A 1F4HA 1FGNH 3QXAA 1T5XA 2R4SL 5D96B 3UZVB 4AT6B 5KSBE 1I8MA 5M95B 5DRNA 1FNSH 2YC1B 1AH1A 5DQ9B 1NC2B 3DARA 3A67L 5FM8A 2VLJD 4HIEB 3JWOC 3SGDI 1XGQB 2UZYB 1AO7D 4XP4H 2A9NH 2QLVB 2AERT 1DBJL 2G2RB 1UJ3C 4NT6A 4QHLA 2VXUL 4H8WH 3LKNB 4RAUB 1R3IH 4MVBC 3BIKB 2IQAB 3WE6B 1BQSA 2YKLH 5ERWA 2P5WD 4LSQH 3TO4A 4H1LG 2VZUA 5FM5O 4NHUA 1QFWL 3JVGA 1KPUB 3S5LG 4YHLL 4ODSH 4TULL 1UM6L 5HHOD 1XIWD 2FLRT 1M6OA 4I18A 1X5FA 3RGVB 1U8NB 1HN1A 4JHBA 3BVNB 2RFXA 2BOCB 1R6VA 5LWYL 3VFPB 2X42A 1TJIL 5I1GL 4PGBB 2ZPKL 5GS0C 1AQKH 1U8MA 3MFGB 4L1DA 1CZ8H 4BQCA 2IAND 5IK3B 3JVGC 5E2JA 5CJQL 1FP5A 3VRLE 3EOTL 4HWZA 2Y07L 5EZIL 4OCRH 2OQJA 4ZSOE 5HHVL 4AZ8A 2C3WA 4BFIA 4ZNEE 3DETC 2R4RH 3OV6A 3HAEG 3QUXC 1OW0A 1CGYA 3HCVB 4GRLB 3O2DA 5F6IB 3ARBB 1YEEL 5J3HC 5BQ7A 1DSFH 3SGDH 1FBIL 1I1CA 3ZTNL 1CVSC 2F8VA 3IDIA 4JKKA 5LGJB 2CD0A 3BKCH 1OVZA 2ADGB 1D9KD 4K2UH 1UH3A 3S34H 3PV6B 4OQTL 5DJ0B 2FECL 4WFED 1V7MH 3A6CL 3DV6B 3X3GH 1NSNH 4LLDA 2QSTA 3ABZA 1VGEH 3MODL 3GBLA 3VFTA 1OLZA 2AP2A 3R8BB 1XGPA 4DKFH 4JPWL 4QRSA 4CADA 4KROB 1KLUA 4Q2ZB 4GRWE 1G7HB 4I4WB 5CFHA 3K4AA 3NIDE 3U6RA 1YY8A 4QOKB 5C0JB 3T1WA 4NQEB 3VI4E 1AHWC 4O58H 4Z7UE 3U4EA 4JR9L 5GGUB 4LHJB 1IQDB 1D5BA 4WGVB 3U9PL 5EN2B 1Q0YL 2EH8H 3AMLA 4BZ1H 3MJ8B 4OKVA 4NCC1 2HFGL 3EDEA 2XXMB 3Q6FB 4NSKB 4XP5H 3H3PH 4X6BB 3P0VL 2HVJA 5E2TL 4HAFA 2R0ZH 2GI7A 4UDUA 4Y0GA 3FTGA 3CPLA 1BWMA 1YEIL 3PL6D 1HHJB 3CSYB 4QRUA 3U0WH 4HKBB 4JKWA 4M93C 4TVPE 4YQXH 1BFTA 4H20L 3HG1A 3P77B 2CO7B 5EA0H 2AJZB 5DEFB 4PGEA 1T03H 5BCAA 4WJ5A 3SKNA 3MA9H 4Y16D 4PP2A 3I02B 5IFAH 1SY6H 2FHBA 1OAXH 1ZHBB 5IMKA 2L7JA 4A6YL 1EO8H 5K9QI 3OR6A 5I17A 1U93B 3WCYA 1HWGB 4KUZH 4OIAA 1TZHA 2WIIB 4NQSA 4UAOB 1WIUA 5CJOL 1LO5A 2WWKT 4NKIH 4PRIE 3ZL4L 3SGKA 4E0RB 4L8SA 1OAUH 4U49A 3ZYJA 3QDGD 5DWUL 1JHLL 1A6UH 5DD3L 4YHML 4LARL 3VD9A 5DMGC 1DQQB 5IR1A 2AV7B 4X5XA 2D9QB 2AGJL 1YNLH 2VE6A 3DSFH 3V0WH 1RZJL 5SWZD 4ACPA 3RI5F 3I6KB 3IDNB 3LEYL 5C0AA 2NY7H 3JWDL 4FXGA 5F89B 3QAZB 1QR1B 4X4XA 1YMME 2KZWA 4U1JA 1MFBH 2GY5A 4AG4L 1JUFB 1R5WB 2OL3A 4H0IA 4ZODA 4Z95L 2W65A 5JZ7D 3QDMD 3T0WA 4G6AD 1LEGA 1P6FA 2IH3A 1Z5LA 2YK1H 5FCUL 4N0CC 2YRPA 5HHMD 4LSTH 1LEIA 3GSRB 1JVKA 3FT2B 2R23A 5DVNA 2EE9A 3QDAA 2D7PA 2FD6L 3U7YL 5L2KD 4WFFE 1E4WL 1KXTB 1P9MC 4QRPB 4IBLT 5EORL 1I8LA 3UTPD 3U36B 4C55A 5L6YH 2AEQH 1BM3L 1FVDB 1RJLA 2NX5A 4NO5B 5CGTA 5EOQH 3WFEH 5J6HA 1NGWA 1T89C 1YJDL 3W39A 3MRKA 2Q1EA 5B4MC 5E03A 2JIXB 1Y0LA 1YEGH 3VFGH 1YNKH 4MSWB 2WBWB 1T80A 3CX2A 1PLGL 5CD3B 5BMFH 3CLEH 5IG7B 1XF4B 3FFDB 5DRWB 5DQ9A 3PDDA 3SEPA 4JQXC 1ZA6B 3MGOB 4WI2A 1C5DB 2CGRL 4HWBL 2PW1A 5EUKA 4RGNE 4HIEA 5C0BE 3NPZB 2X09A 4CVWA 2CMRH 4UT7H 3VRJB 2NZIA 3Q1SL 3VXQB 4NBYB 3ALPA 3L5JA 3HC4H 2D0HA 1F8TL 3KYMB 4RAUA 4F80A 4O2FB 4WI7A 3SE8H 3GBNL 3NABL 4WV1B 1ODAA 4HK3J 3WE6A 1L7IH 3D69B 3P4LA 3P9LA 1YPZB 3CFCH 2DQJL 3VXUB 3FQNB 5F21B 1N0LA 2OJEB 4Y4KD 1WUNT 1KPUA 2Q7YA 1RJZA 2DQUL 1S7XB 1A8JH 5BS0B 2J6EA 1HYSD 5GGRB 1QSZA 3RGVA 4TPRL 2GTZB 3PXJA 4MA3B 3RWHB 5GSVB 3RWEB 2BOCA 3VFPA 5DHXB 1UWXH 4XTRD 4KHTL 1INEH 4J3WA 5IK3A 4PRDB 1OPGH 2GJJA 1KJ3H 4GOSA 5T3ZE 2IPTL 2RJMA 2PW2B 3X14B 2I26N 1A7QL 5I74B 4J3XA 3FCTB 4HEPG 3RGVC 4GXUN 1JZ3A 4YNYB 3CDGB 4X5LA 1U3HB 1LNUB 3HCVA 2O26U 4GRLA 4HJGA 1UADC 3ARBA 3LS4L 3MCKB 1N6UA 4DVBB 2W92A 3D39E 2K3TA 1AD9A 5F1OB 1VGKA 1OAYL 4FQJL 4EUPG 5FYKH 5LGJA 3GNML 1N5YL 1ZLUK 3MYJA 3O6FD 2Z31B 2OI9C 1QLEH 3BP4A 3QQ4A 5DJ0A 3ULUL 4YR6A 1NCTA 2CR6A 3EDFA 1UB6B 4KQ3H 4FQQB 4N9OB 1MJUH 3BDYH 4WUKL 2BJMH 5C09A 2P5EA 4KZEL 3PG2A 3H9SB 5BZWB 5F6IC 5JNYB 4GXUM 4HS8L 2BXYA 3ZO0A 5EUOB 4Q2ZA 4ELKA 1G7HA 4I4WA 1CLOL 4PGDB 3DX7B 3WKNA 2ZUSA 4NQEA 3QUZA 2GQHA 4NQDB 5DRZA 1GXEA 1A1OB 3BEWB 3CMGA 5A40E 1FO0B 5EN2A 4TUOB 4NWUL 1EHLL 1OSZB 3L3GB 3S96B 3MJ8A 3UTTA 2BVTA 3TT1H 4JY5H 1MRFH 3E2HB 3Q6FA 3QHTC 3TO4D 4ONFL 1OAKL 5J56B 4X6BA 1KB5B 5IROA 1MFEH 1MVFA 4Z78B 4X7TB 3KHQA 1PKQA 1S9YB 2ILLA 3D48R 1I1AA 4FFZL 4L9DA 2WWMC 3CSYA 1ZHNB 2VLKE 1RIUH 4JFDB 4U7KA 3QP3A 3MPCA 4HKBA 3BO8B 3GIZL 3DUUB 1CDIA 3EFDL 5CBAB 5A2JH 2E9IA 1U36A 3P77A 1T1YA 5DEFA 4TSCH 3MCLH 3I02A 4U1IB 4GAGL 4OZHF 4I3RL 1SJEB 2UZXB 4UIMB 2IALA 3SN6N 1DUZB 2YD2A 4I0PC 2J4WL 5HYQB 1DEDA 5FHBL 2DJUA 3QHFH 1NFDB 1WBZB 5CJ5A 5EOCH 3CVIL 2YBRB 5IB5B 2HFFB 4MAUH 4E0RA 4PJ9B 1EEQA 2DDQL 1QP1A 4O2CB 2H9GB 4UT6L 5HDLA 2BRQA 1RZKH 3L3OB 5CKGA 1DQQA 1JFQH 2FZ3B 1ZAGA 1FNEB 3DRQB 4M8VA 4QLRA 5J1TC 3I6KA 1NANI 3IDNA 3MUHL 3RZCB 5JR1L 4A2MA 5I1LB 4Z7WF 4OLYL 5F89A 1SEQL 4XHJD 1T66D 3UJIH 3FZUC 2B0SH 4M62H 1R5WA 5E1AB 3SDDA 2HT2D 4GKSB 4XVJL 3DTXB 3SGJA 3QWRD 1NH6A 3DBXA 3CFEB 3KPRB 4F9PC 4D9RE 3KYKL 3QPXH 5HDQL 1QFWM 1EHAA 4OD2B 5MHSD 1M1SA 2W9LA 4XRCB 2FEDC 4YBHA 4U0RC 2YA0A 4WWKB 3QAZC 4G6MH 4DGIH 1TLKA 5DJXB 3KYOB 4QRPA 5IFHH 4MDIA 3MROA 3U36A 4XP1H 1DQML 5JOFB 3SGJC 4W6WB 1P84K 4EOWH 1JTOA 3MCG1 1FVDA 3U7AA 3FO1B 2HJFA 4M3KB 4R7NA 3HG1D 5DJ6A 3THML 2NXZB 4G8GE 1A7RH 5D7SH 5FYLE 2JIXA 4MX7B 3W0WE 1DLFH 4MSWA 2I5YL 3VXSE 4WU5B 5FYJU 5CD3A 2D4DA 1MIMH 2ATPA 2D4FA 4LSVH 4X9FA 1LO2L 1MFNA 1JRHI 3O3UN 4WHCA 2MPAH 1ZA6A 4PJ7B 5ADOH 2H2SD 2MKWA 2X70B 2ICEB 1C5DA 1CGSL 3E8UH 1B0GB 4CU6A 1EHNA 1NANH 4IMKA 3EIFA 3I3BA 3VRJA 5FYKE 3VXQA 3RRQA 1IKFH 1ZLVK 1OB1B 2DICA 5GGQH 2JK5B 3KYMA 4KQ4L 1BAFL 4O2FA 1G7LB 2DYPA 4U1MB 2BHYA 2CPCA 4WV1A 3RVTC 2BNUB 3ULVL 2JCCB 4NM8H 1XH3A 4XWGH 1YPZA 3KPPB 3FRPA 3VXUA 1MPAH 3FQNA 4ZQKB 2OJEA 1S9WB 1VERA 1U6AH 3MXWH 3TV3H 1G7MB 3LHPH 2DS4A 4OLVL 1S7XA 5BS0A 3P9MB 2G60H 3GI8L 3T3PE 4OLZL 4TNWK 3BGMB 5GGTL 5C0AD 1BX2B 4WY7L 2GTZA 2WLYA 3FQTB 5AZEL 2QL1A 5T5NF 4MA3A 3U30B 4L8DB 4LQFL 1QO3B 5GSVA 3RWEA 3KXFB 5T1LD 2AK1L 5CLWA 4WV1C 1IARB 1ZE3C 3PGCA 4YXKL 1FYTA 3IKKA 1C12B 3WXVH 5JW3H 5HYFA 2NW3B 3B2VH 5B4MD 2PW2A 4M7LH 5C6TL 2NCMA 4K3JH 4P46B 4NRYB 4M8QB 1JRHH 1V05A 4OF5A 4YNYA 1U3HA 5INDB 1WEJH 3MCKA 4OFDA 1GGCL 1T20A 1EMTH 5DUBA 4KK8D 3MV8B 2P49B 4D9LH 2R69H 4WEUD 4GMTL 3H9HB 4RFNB 2QSCH 2Z31A 3SO3B 2APTA 4RAVB 1LHZA 3ARQA 4H88H 3RVUC 5I1HH 3MJ9H 1UB6A 3RNKB 3FRUB 5HYJA 1BFOB 4FQQA 5F6HI 3VE0B 1BFVH 1H0DB 5DFTA 1DFBH 1KC5H 1CXLA 3MRMB 4EXPX 4UB0H 5I15H 3O4OC 2J8UE 4CN4A 5IUSA 1NMCB 4K8RD 1ADQL 4LQ1A 4PGDA 3DX7A 3GJFB 4XNYL 2VWEC 2EH7H 5L2JB 4H0HB 3LD8B 3C5SB 5EU6E 3V6BR 1FO0A 5F7MC 4E5XB 5F70A 2C7UA 3O2VH 1OSZA 2NQCA 3L3GA 4WI5A 3S96A 3OX8B 1MEXL 1OQOA 1NCCH 1OCWH 2DQEH 1E6OH 5DYOA 4L4TB 1T83A 1KB5A 2WBJB 1LDSA 3WIFB 3WD5H 4Z78A 4ZTPL 4RMUA 3S7GA 4OZFB 4HMEA 1NAML 1X7QA 3TF7C 1PFCA 2KPNA 4ZFOB 1BBDL 3NCFB 2H1PH 4EVNB 3RGVD 3S36H 1ZHNA 1P4LB 3G5XB 1YUHB 4JFDA 2ITCA 3PV7A 3O2WH 2QADB 3HC3H 3BO8A 3DUUA 4P4KB 1T21A 3WJJC 2YSSB 2WWKO 3PWPB 4M6NH 3LPGA 2XKNB 2ID5A 1FN4B 4L8CA 4G9DB 2XY1A 3NIFE 3QG7L 1T83C 1FL6A 4U1IA 3WXWH 5BV7B 1I3GH 1Z9SA 3CLFL 1MCCA 4HIJA 1JPTL 1DUZA 3IDJA 5HYQA 3KPSE 2ZOKB 2PYEE 4GRLD 3ARBD 1WBZA 3VFVB 5D2LB 5BOZG 4GQ9L 2YBRA 5IB5A 4PJ9A 1PBYA 3O6LH 3IJSA 1CDYA 2X9XA 4O2CA 1W8NA 4JM2B 1NCAL 4P3CH 5FO8B 4Y2OA 4Q6IA 1TIUA 3PGDB 4FFWC 3L3IB 3KLSA 2JF1A 3Q5OA 5FYJL 1FNEA 2P5ED 2BDNH 3G6DL 1F3RB 4OD1H 5KG9B 1Q38A 1Z0MA 5I1LA 4KROD 2A9MH 4PJ9C 4XNZB 4NQTA 1JCKA 1FNAA 4IRZH 4QOKD 5FUOL 1R3KB 4NQED 3F6LA 5E1AA 3DTXA 1RJCA 4RMSA 2R9HD 4JHZA 1JZ4A 1OP5H 3CFEA 3QO1A 4C4KO 4EQ3A 4M1DH 4KPHL 4OD2A 4FNLH 4PYGA 4XRCA 4D9QD 3H9ZA 3BE1H 4LK4A 4Y4FA 2O5ZH 3BP6B 4RNRB 3RZCC 1YEKH 4ODXA 4RIRA 3GJFK 4WWKA 4XVUC 4P59L 3FJTA 1UFUA 2P8PB 5FM5M 3CUPA 2AW2A 1TXKA 3KYOA 1GH7A 1BD2E 5AWNH 3BXNB 1UCTA 3KGRA 2D31B 5IOPB 2HMIC 3TFKD 4V1DB 5CD5C 1UXWB 4LSSL 4LCIL 4PIRF 4PRPE 1A0QH 4OZIE 1TQBB 5DI8B 1RZ8B 3UAJD 3NFNB 1AKJB 1U3YA 4FP8H 4OIIL 5DJAA 1LK2B 1JYVA 1EVTC 2YPKB 1HILA 3RNQB 2DQTL 1OD7A 5FUZL 1XF2B 4HX1B 4PJ5B 3BAEH 4XZUB 2X70A 2ICEA 3MXVL 3MRDB 3LOWA 1B0GA 1MFCL 2GSGB 5CSBA 5KZCB 1P84J 1ORSB 1Q9LB 43C9A 1FAIH 4I5BA 2F54A 2EE6A 1KBGL 1OB1A 2APBA 1ITBB 5J11B 1AGDB 3FZUD 4NM4L 5C9JB 4U1MA 5IEHB 1TETL 2BNUA 5GS2D 2E9JA 4G7VH 5IT2H 5H94A 3NVQA 2V17L 2YEZA 1VPOL 2HWZL 3KPPA 4MB3A 32C2B 4ZQKA 1S9WA 3WMSA 1RMFH 3B9DA 1KELL 4P48A 5F9JB 2VR9A 3TO2B 2FEDD 3MBXH 4KVCL 5DZLA 5ANMB 3BGMA 4EN3A 3FQTA 1ZTXL 1BQLL 4L8DA 1ORQB 4WI3A 4LASH 1IE5A 1AGFB 1ZKAA 4LSRH 5D4QA 1JL8A 3KXFA 4JAMB 4CL7A 3DMMA 3REVB 4DEPB 1A3RL 5IMLB 1NAKL 2P1YA 2WNGA 2W60A 1K8DB 2EZ0D 1C12A 4G6FB 1LE5B 4JRXE 3I9GH 3FB5A 2NW3A 3OHXA 1B88A 4XP9H 2APVA 2Y36H 4UV4L 3T4YB 3QYCA 4N8CH 4PJHB 4NRYA 3BGFC 3MJ7B 1RZJC 1CICA 2X4NB 5J57B 2ZJSH 5HHPB 5HGBB 1ZANH 4NOBA 3ZTJG 3PWJB 4QRPD 4XC1H 3JWDC 2D7TH 1FNLA 2VDKL 5AD0B 5AEAA 1ZA3B 2ZUTA 3H9HA 3UPAA 4QYOA 4NZUL 2FL5A 4RAVA 4ZUTB 2JIXD 1F2QA 3RNKA 3FRUA 2JJTA 1MHCA 4P46C 4FTVA 1E4KC 3VE0A 5MERB 2YN5A 1YY9C 1MWAL 1U95B 1ZT7B 3MRMA 4KVNH 4NZRH 3QEGL 4KHXL 1DE4A 2PXYB 2Q8BL 4OSUL 2MWCA 1QLRA 1ZGLB 4RWHA 4JM4L 3O11B 1MF2H 4LKXB 2JLLA 1F11B 1YJDC 5L2JA 2JJTC 3GMRB 3C5SA 3SKJH 3B4NA 4OF6A 5FAAA 2EXWD 1MHPH 5GGVH 3GSQA 4JHWL 4R4FL 1GGBL 3OX8A 3GMOB 4YX2L 3I6LD 2E27L 4Z76B 5FFLA 4NDMB 5EC1A 3VXUD 4O51A 4Y89A 3S37L 2F58L 3QJFB 5BS0D 2DI9A 4G5ZL 4TTGA 5L9DH 4ZFOA 1QVOB 3DUSB 1HXYA 1P4LA 1K85A 1YUHA 2HLFC 4KUCD 1HEZA 3IFLL 1YYML 4MD5B 5C9KA 2IC2A 1EV2E 4X6DB 2Z91A 3SBWA 2R39A 1SM3H 3PWPA 1MAML 2SEBA 3WHXB 2ZUQB 4NN6C 3HNVH 2XKNA 1FN4A 4L3EE 1WZ1L 2H32B 5D2NC 4M43L 2WBJC 3RVUD 4H1LB 4M7ZB 1Q9WA 3D9AL 3B5HA 3S5LB 1I4FB 4F7EA 4L5FL 3OXRB 4GBXB 1MHEB 4UOW0 3IFNL 4N90E 1U3HD 1OOAA 4OLXL 4P4KC 1F4YH 3HFMH 3VFVA 1LQSR 4M3JA 2X4QB 1J1PH 4DQOH 4R90L 3A6OA 4DGVH 2MQCA 3F7PC 4KI5C 4HBCL 2C26A 2Z31D 1PSKL 3BIAX 4JM2A 2GYSA 5FO8A 2VDPL 2BOBB 4JFFB 1ZGLM 4I77H 1FFQA 1IILE 2XWJA 4Y8DC 1IC7L 4NQCE 5F7LB 1OARH 1YC7A 5D7JA 3HAEB 3TWCL 3U46A 5CEZD 5IB3A 5C8JB 3EO0A 1IEBB 3AS3A 1NEZB 1R3KA 3T65B 3WNKA 1EXUB 4JFZH 4XP6H 1FSKB 3F58H 2D0FA 3IXAA 5B39B 3ULUC 2KL6A 4LFHG 3N9GL 4QTHB 3RKDC 3RY5A 2B1AH 1AXTH 3V9FA 1SJVA 4N1HB 2LE9A 3SDCB 4RNRA 1UZ8B 4XNZC 3FONA 1F97A 2PKDA 4OM1L 4P57B 4NP4L 3RU8L 3HE6B 3HRPA 5H2BA 1R3JB 4XNUL 3LKPB 1NC4B 2XRAH 3BXNA 2DWEA 1ERNA 5TQ2L 4JFDD 4V1DA 4HH8A 1UXWA 1EZVX 4Y5YA 3C60B 3A6BH 5SWQB 5AG9A 1T6WA 1NMBH 3D85B 5DI8A 2VWEE 2DKUA 3UBXB 4OTXL 3V4PH 4Q9QH 3NFNA 1AKJA 4F7CB 1LK2A 5FA4A 2YPKA 5C0RL 3RNQA 1WK0A 1XF2A 1Q9OB 4HX1A 3H9SE 1RFDH 3MOQA 3O3DB 3BRFA 1RUAH 1H3PL 5D1QC 1XGUB 4Q9BA 2Y7QB 5D70H 4XZUA 5E8PB 4L4JA 3MRDA 5EUOE 3DVNA 3MRPB 1MUJA 2GSGA 3GSUB 3R0MA 2I60H 4ELME 4WEBL 1TQBC 3IETB 4PJ9D 3T8XB 4M6ML 2MCPH 3QFJE 5C9JA 4DOHB 3RAJL 2DI7A 5IEHA 2E9BA 4KTEL 4UILH 1AIFB 5GGSB 1KN2H 1FV1A 43CAB 1RUQL 4ZUUB 3WFDH 1KCRH 5EWIL 32C2A 3PP3K 4U6YB 4G7YH 1BJ8A 4YHOL 4DKDC 1DQTA 1LO4L 4MNQE 4NKOB 4PLKC 4M6OH 1S3KL 3RZCD 4ONHA 4P3WA 4D0CA 4HWEH 3DX6B 1D6VL 4XVUD 1WLHA 1I9IL 4M9OA 1T4KB 5J11C 1ORQA 1AGFA 3RY6C 1DDHA 3D5OF 5F9OH 4YBQD 1S7UB 5IMLA 5CD5D 2I24N 1YPZF 5EU4A 2BNRE 1HZHH 3ARTA 1LE5A 1HDMB 2E7BA 1Q94B 4OT1H 3FB7B 4ZFZB 3INUL 4RFEB 4DN3H 3IJHA 4Y4FD 4U1HB 4PJHA 2A6KB 4R4BA 4WWKD 3UO1H 3EOAB 4KUCF 5HHPA 3WUZA 2D7MA 4UV7L 1NFDE 3PWJA 4LGPB 1Q1JL 4X99B 4PP1C 4I0KA 4LVNC 5FDWB 1VENA 3A0OA 2VXSH 3CU1A 5AD0A 5SV3A 4DEPC 5BOPA 5KVDL 1LDPH 2P5WE 4H25B 4KKAD 4XCEA 3MRRA 1BZ9B 5DK2B 5DHVH 1H15B 5FXCH 4KKNA 3MRJB 1DN0B 5MP6H 2NXZD 3VFUB 4XB7A 2HAZA 1WBXB 5DQDL 4ZUTA 5ICZA 3DYOA 3R06B 1WAAA 4TUKL 4XXCA 5DZOA 4CNIB 5HJ3A 1BPVA 5C3LD 4LVHC 1G7JA 5MERA 5I16B 5A16A 3U0PA 2V5SA 1ZT7A 1KIRB 3HZKA 3ARFA 3UYRL 3OKYA 4LLAA 4PJFA 4JO3L 4OLWL 5FGCE 4YDIH 4RA0C 1ZGLA 1QUNA 3DSNA 3O11A 5C07E 4WHDA 4HXBH 4HIIB 5IHZB 2F54D 3RP1A 1F11A 4PJGB 1MIEL 4DGYL 4M02A 5CIPA 5T1KA 4OAWB 4RMVA 3GMRA 3KPRE 3O3AA 1OSPL 1MNUL 4DFIA 1S78C 1NBYA 4HUUB 3GMPB 1KCUL 2VB5A 1CD9B 2PXYC 1JNNH 3ARZA 1DQDH 1BP3B 5EUOF 3MLSH 1I8IA 2GJZB 3QJFA 4I3SH 1CL7I 1DBKH 4QXUH 1JV5B 1EJOH 3NZHH 1T7ZA 2ATKB 2YD8A 4I2XB 3QHZL 2GK2A 3LZFH 4EN3D 4NZTH 3U1SL 4WFHD 3EJYD 1OGTB 5DEZA 4MD5A 3ZHKA 2R2HB 1OGAB 3K1KC 3LN9A 3KXFD 4DTGL 3OKEB 4S1RH 4FFVD 3UMTA 3QI9B 2QSQA 3WDIA 1CDUA 3ULVC 1NUNB 4IRSB 5D1XC 3NH7H 5IBTH 4FXKB 3WFCL 4B7IA 3QQ9D 4P46D 3OXRA 3MRNA 1IC1A 4GRMA 4GBXA 3UTOA 2XOTA 1QBBA 1YY9D 2EC9T 3MLZL 3TLRA 3VWKC 2W38A 2EXYC 2XXCB 1NCBL 4MMXC 4K9EH 1BVLB 3VCLA 1T0NA 2FH8A 2X4QA 4JZOB 1FLRH 4LCWE 2ZUQC 3MV8D 4MCYB 5ETUB 2NW2B 3KJ6H 3KPQB 2R0WL 3SDAB 1MFDL 3D25A 2ORBL 5EOTA 4PJXE 2CK2A 2J88L 1CFSB 5ACZB 1IGYA 3DROB 5CAYB 4NO2B 4Z7NF 4Y1AA 2JCCE 2BOBA 3BUTA 1PGRB 4JFFA 4NFDA 3J7HA 5GRVL 2VQ1A 1KCSH 3BWAB 1KT2B 4FTVD 4NC2B 2FGWH 4R0LB 4AEHL 1BOGB 5H8DA 1YQVH 1NFDF 2AK4A 3CK0H 1S8DB 4XCFH 2NXYB 2LTQC 5EO1B 2DM4A 1DANU 4J4PA 15C8H 1CL7H 5C8JA 1I9RL 1DUYB 3PDOB 1IEBA 4U3CA 1NEZA 4WI8A 5JUEH 5B39A 4JHAH 4XMLL 4QTHA 1RJYB 3ZYZA 3ZSTA 3T0DA 1PKOA 2BRRH 3C5JB 2C3XA 1EEZA 5EBWB 2G5BA 3RDTB 3ZT7A 3SDCA 4LEXH 4LL9A 1MCPH 1UZ8A 5D7IE 2WBJD 5TDOB 5I18H 5JHDE 1G7PB 1X4ZA 4PREB 4PB0L 1YEHL 3GGWB 2E5EA 3HE6A 1R3JA 1IBGH 1NC4A 1G9EA 1SYVB 1FIGH 3PIQA 4LVOB 5DD6B 3TJEH 2QADD 4DWHA 2YD3A 3FFCE 5LCVL 3LQMA 1TQCB 3JXAA 4P2OB 2WP3O 3PWPD 1DL7L 2HG5A 3UBXA 3V7AE 1GC1L 5FGSA 1WWAX 4P5MB 3GM0A 1P1ZB 5I0DA 4WHYG 2KQMA 1OLLA 4M7KL 4ZUVB 5JHLL 2JB5H 1Q9OA 1ZEAL 5HI4D 3O3DA 1Q72L 2Y7QA 3ROLA 3HE6C 2HKFL 5E8PA 5HYIA 2EDTA 4LSPH 3MRPA 3GSUA 3DVIA 4RAHA 5JORB 3C60C 4NYLA 5F88A 4YC2B 3IETA 3HZVA 5DMKA 5BW7C 3T8XA 1G6VK 2BY0A 5ICXB 4P9MH 3VGEA 3Q6GH 4MJIB 4QRRB 5FB8B 5L8KB 4JM2D 4JY4B 1YNTA 1AIFA 1FC2D 1GGTA 3ULUD 4PJ7F 3VXNB 3SKMB 43CAA 3GHEH 5D2NE 2DQFA 2PF6A 4MXWH 3O2DH 3WSQH 4U6YA 4OLUH 3KNBB 2VRAA 4HJJL 1MFAH 4XPHH 5DFVC 5DLMH 4NKOA 3MV7E 1QBMH 1ZHKB 2XN9B 4DAGL 1CE1L 3ZKMD 2RCSH 3T04D 3B9KB 3DX6A 3P0YL 4XVTH 2HLAB 3PABB 4BZ2L 2RHEA 4W4NA 3FOMB 5CP7B 4EI5C 1ZVHA 4MDJB 1IGFL 2JCCF 5JXAH 2X4TB 3CGTA 4UINH 2P7TB 3SDYH 3MRLB 4DVRL 1HDMA 1Q94A 4KI5E 3VGHA 5SX5H 3X3FL 4ZFZA 3NPSC 1U3ZA 4RFEA 2ZNWA 1MCLA 3MLXL 4HWUA 1KPRA 4G6JL 5CHNA 3EOAA 5E4EB 5GRZA 3GK8L 3TBTB 2NZ9D 4X6EB 3O0RH 1F58H 3H9YA 4X99A 4OLEA 5FGBC 4H25A 4V1DD 3QIUA 5DK2A 1I7UA 4WEMB 1H15A 4F7TB 4PUBL 2I9TB 2A77H 1I7RB 1NBVL 1FPTH 1WBXA 2EICA 4FXLA 4GSDL 1AKJD 3R06A 2FATH 2OTWA 1NDGB 1KJ2L 1CGUA 4PBXA 2W0LA 1Y18A 5I16A 4EQ2A 1KIRA 4K3DL 3S88H 4PJ5D 5KVMC 3CCHB 3I6GB 4XI5C 1SBSL 3OKOB 2XKUA 1RZFH 1KENH 5F1SA 5CILL 3MMEB 3OKLA 5KZCD 5KVEL 1ZXQA 3ARDB 3S35L 5DJ2A 2R0KH 2PCPB 4OAWA 5HGHB 1A9EB 1B6DA 5I8KH 4HLZG 4HUUA 3GMPA 2EIZB 5MEPA 4OZ4A 1QSEA 1N5AB 4BM7A 3BT2L 3K0WA 3NCJL 2O5XL 2GJZA 2DMKA 4IS6B 3OGCB 1JV5A 3SDXE 3V5HB 4N0YL 1J1XL 2ATKA 4I2XA 2QQLH 4OCSL 1OGTA 2NR6C 5BXFA 2UWEB 3L5WB 1OGAA 3VH8A 5TE6L 3G08B 1K8IB 2OZ4A 3VGDA 2F74A 4NJAL 1QTYT 3LV3B 1KV3A 4WRLA 4YPGB 2XPGB 3QI9A 4G6FD 5K9QG 4WCYL 5LBSH 1JGVL 4HMDA 5B8CA 4IRSA 1F13A 5B22A 4MS8D 4HJ0D 4FXKA 5SWSB 4MMZC 3F7YB 4H26A 4UQ2B 2XQYK 3MRBB 3QQ3A 2GUOA 4X8XA 5KAQG 3SOBL 4R96A 3U7WH 2OL3H 4AIZB 3V4UL 3FT3B 2IAMB 1FLTX 3OJVC 1BVLA 3O4LB 2ZUYA 4FABH 2NW2A 2QTEA 3VXPB 3CX5K 4HC1L 5E8NA 1EFQA 3QI9C 5ACZA 4KV5F 3VFOA 3O6KL 5HY9B 4NO2A 4XNMA 3OAYK 4E41B 4XMPH 2R8SL 3CSPA 5TE4H 1KT2A 2VABB 5AUMB 2XZCH 4KK6D 4PJEB 4R0LA 2DD8L 1BOGA 4O9HH 3ARFD 3EO9L 2UVEA 5D2LF 3UTZA 5EO1A 3TN0A 4LGRB 3SDAC 2IBZY 2ZUVA 4OGAD 1DUYA 3PDOA 3RPIB 1A47A 5J12B 1EVUA 2BVPB 4JM2F 3V79C 5T1KD 3ULUF 1RJYA 1T2QL 3LB6C 3C5JA 4JZNB 4PJ8B 2OSLA 3RDTA 4MWFB 1FYHB 4OGXH 1UQSA 3HC0A 4ZFFB 2NXYC 4K8RH 4L3AA 2C4FT 4OB5L 4Z7VB 2ZCHL 5TDOA 4ETQB 1E27B 1NDMB 2VH5L 4K7PX 5DMIL 1H5BC 4IRJB 3GGWA 3SQOH 2CIKA 3D3VB 2IEPA 4PB9H 1YEDB 1NGPH 4ODTH 3ILPB 4XBEL 4FQ2L 5DD6A 2YPVL 1KEML 4BK4A 3PQYB 3VXMB 2EO9A 1N7ML 5JOEA 3I50H 5K93A 1WISA 2WLZA 1IGIH 5GSRA 3BIBX 1VACB 3UJTH 1DVFA 5EU3B 2BMKB 4ZUVA 2AXFA 1VSCA 2J6EH 3IS1X 2PO6C 3QDHA 4RCAA 3ARWA 5DD5H 2ZG2A 4ERSL 1EFXB 3G9VA 1I3RB 4BUGA 4GBXD 1WZKA 3LRHA 2D3VA 3T2NL 2NPLX 5JORA 3ALWA 5MENA 2X1QA 5I1IL 1VFAA 2QQKH 4GKOA 4CGTA 5E5MB 4P2OC 2AQ3A 3HLAB 3TP4A 1X5GA 5ICXA 2XZQL 4WI6A 4R7DB 3EYQC 3DRTB 1KPVA 5TE7L 1CFQB 1AI1L 3TJHC 4MJIA 2IFFL 1U9KA 3P2TA 4JY4A 2NTSP 3QIWA 1U8HB 3H7BB 4JFFD 2IPUK 2QHRL 3SKMA 3VXNA 3CH1A 3ULVE 4JQIL 2ZWLT 4WIQA 4PJBB 1AE6H 2C1OB 3KNBA 1U8KB 4IMLA 2AK4D 4YC2C 1ZHKA 4LOUC 4J4PD 5FHAH 1FVCB 2DBLH 5GIRA 4RISL 1N64H 3BH8B 4M4PA 4C83B 5CP7A 4YJZL 5SX4H 2LAGB 3DIFB 5LXGH 3B9EA 1G6RA 1T2JA 1OL0A 4ZUSB 3MOAL 4S1DC 4LIQH 4LU5H 3BYTA 1P4BL 1SQ2N 2V7HA 5JIKA 1AJ7H 4MYWB 2P45B 3VWJC 5D5MA 1CF8L 3HUJB 1CLCA 1XGRB 4HUWB 4ESKA 3SDCD 4UIKH 3B9KC 3GHBL 3PWLB 5AAMA 4IJ3B 4X6EA 1BWWA 3MLRH 3QG6B 4U3XA 3HE6D 3OPZL 4ZAKC 1NC4D 5DXWA 2QHLA 2OR7A 1Q0XL 5F97E 1RUPL 2BNQB 3D85D 4QTIL 4RDQG 4U2ZA 2I9TA 1I7RA 3MX0A 3B8SA 4JFYA 1GGUA 2B39A 4UDTA 5DT1L 1TITA 1IC4L 2YS4A 3BJ91 4PJHF 3RUGE 1NDGA 1QR4A 3BP5B 3REWB 1OY3B 2VTFA 5KVFH 2JJWA 4TOYH 1OAZH 4JG0L 1C1EH 3CCHA 4J3VA 1XGYH 3I6GA 3RWFB 2X1OA 3OKOA 2Y06L 3I3EA 3KS0H 4JE4B 3MMEA 1A1NB 4OBSA 1BIHA 3WHE1 4CVZB 1A6TA 1W72L 2A1WL 4LPTA 1IAIL 2JTDA 1KIQA 2OR9L 1A9EA 1OWWA 4U6XB 2LU3A 5TFSL 3B5TA 1NLBH 3AMKA 3BN9D 4LLUA 1WC7B 2VL5B 1K4CA 3C08L 1QRKA 3RA7L 1ZSDB 5I8EB 1CIDA 2H2PC 2NX5E 3N1PC 4IS6A 5FYJD 3ARDC 3C6SB 3V5HA 1UXSB 2YMXH 1J5OL 3HNSH 3UTSE 5I1DB 1UH4A 3DURA 9CGTA 4C56E 3BISA 3BZDA 3V6FB 3L5WA 5GS2H 3L95B 3G08A 3ULSA 2Y4SA 1MJ8H 3KPTA 5GRVK 2XPGA 1RURL 3BPNB 4Q97A 1EAPB 1EEYB 2AKRB 2EDJA 1CD1B 1F90L 4KKLC 5HGGS 1YDPB 3CDYA 3GRWA 2PR4L 3QEQB 4V2CB 4Q9RL 1VFMA 2B4CL 5T5FH 1H8NA 4HKXA 5SWSA 3GEWB 3F7YA 3VRIB 4BK5A 3MRBA 4HPYH 3PE9A 1FFPB 1TJGH 1HIMH 1LO3L 4X6DF 4AIZA 3OF6D 1F02I 1UCBH 5E6YA 2IAMA 3ZE0E 4XI5D 1IC5L 4X6FB 1FRGL 2HTLD 1JGLH 3G6AA 4LHUG 4S1SH 5HY9A 1ZLUH 4NPYB 3WIIH 3BD4A 1GAFL 4E41A 3RBSA 2K1MA 3QXDA 3NGBB 5E99H 3NAAL 4GAJH 4GXVL 2VABA 1TZIA 2O5YL 3EYOA 2F5AH 5JOPD 4PJEA 1KJ2B 4X80L 3AREA 1J86A 1FGNL 3K80A 2IAMC 1IAKA 5E6IC 1KFAH 4NIKB 3L3JB 3G04B 1QRNE 4MNGE 5IW6A 1FCGA 1FNSL 5JIHA 3RPIA 1IM3B 1I3UA 3CX5J 4QHNB 2BVPA 4NKDB 1XF3A 2FEEL 4APQC 1T3FA 2VXVH 3CXDH 2NR6D 3T2OA 4FG6C 4JDZB 1CFVH 2A9NL 2OTPA 1M71B 2BVQA 2Q86B 3ZYIA 5K59E 4X7SH 4MWFA 3HHRB 4H8WL 4LLQB 2VN4A 3JSSA 3VXRA 1TPXC 3GO1H 1R3IL 2ZSVB 3R0NA 4ETQA 5A2KH 1E27A 1MAJA 5I1CH 2YKLL 4LSQL 5EBMB 4AEFA 2X4PB 2Z8RA 4IRJA 5J12C 1MAKA 3IFPB 1IL1A 3QUMB 4R9HA 1CE6B 1MOEA 1FG2B 5D72H 1OGAD 4F58H 3K4DA 3EDDA 2A6IB 1HNFA 3PQYA 2NY6C 3VXMA 3RWCA 4PJ8C 5C09E 3QEHB 5DS8B 3G6JE 5JTWA 1NCWH 1VACA 3QI9D 2FO1A 2BMKA 4JCMA 4WI9A 4IRSD 1AQKL 3QB7C 1CZ8L 5DD0H 5IB2B 3OWEA 5F1NB 5JXEA 5DVMA 4OZGB 4OCRL 1T0PB 5EIIA 3JTTB 4DW2H 1G9MH 4HZAA 4PY8J 4G3YH 3SDAD 3HLAA 4Y5XC 3UTTE 4KJPC 3CFKB 1J10A 4R7DA 3DRTA 1CFQA 1DEEA 1DSFL 4D3CH 1AP2B 4JFHD 3L1OH 3V95A 1U8HA 3H7BA 3AY4A 1PZ5B 3BKCL 2NY2C 4K2UL 3S34L 4LEOB 5F71A 2X4RB 2C1OA 1R0AL 2NY1C 1T7WA 4Z7QE 2O93L 1PY9A 5DSCB 2NXYD 3V5DB 1IQWH 1NSNL 5CLTA 4KRLB 1VGEL 1Z9MA 4GS7B 4Y5VA 1CCZA 4JFXA 4DKFL 5FOJA 3KPNB 1P6AB 3DIFA 4DCQB 5E8DL 1CGVA 4F9LC 1ND0B 5CSZA 1WBYB 3RVXD 2B7DT 3CD4A 3QCUH 2BFVH 2VLRB 1OTSD 5HD8C 5D6CA 3HA0A 5EZLB 5JW4Q 4BSWA 3RDTD 3HUJA 5CEZH 4Q0XH 5GRUH 1JF6A 2EH8L 1REIA 4BZ1L 5F3BB 5JQ6H 3FO9A 3TNNA 1W0YT 4OFYD 3EYFB 3C6LA 1EAJA 1D5XB 4XP5L 4UU9B 1RQ5A 5HPMB 3FAWA 3H3PL 2HTKD 4HMCA 4RFOL 1FO0H 4MD4B 1RIVH 4QCIA 2R0ZL 5IESH 3LQAH 1PDKA 4UUJB 4UTAL 4PJDB 4J6RH 3U0WL 1KB5H 4FN0A 4AQOA 2OMBA 1GOHA 4LPYA 4YQXL 1DVFD 3TJHD 3BP5A 1CU4H 1QFWH 3SE4A 4Z8FH 5C2BH 2ZKHH 2X1WL 4WUUA 1T03L 4P2QB 5ITFB 4FQIH 3MA9L 3MBEB 5JMOC 1OHQA 4U33A 5IFAL 1SY6L 2E7LA 3AVEA 1OAXL 4PJIA 1YEJH 2ZSWB 3P4OA 1EO8L 2M8XA 3STBA 4CVZA 3C8KB 5IB4B 1ONQB 1TJIH 1LVEA 5KSBB 5L88H 1ZLVH 2FYYB 2XWBA 4G9FE 4N8VG 5E95B 1GC1C 4MJID 4QRRD 5D7KE 1AY1H 4U6XA 1UA6H 3QIWD 1OAUL 1SVZA 5EZIH 1DQLH 3QCTH 1WC7A 1DBMH 2DIBA 1ZWIB 3HPLB 1A6UL 3TH3T 1JE6A 3NFPB 1ZSDA 3C6SA 1IGCL 1UXSA 2XA3A 5I1DA 1A6AA 4PJGF 1J9CT 1YNLL 2I9LB 3DSFL 1NUDA 1GGIH 4M00A 3L95A 4M7JL 5IJVA 1G7QB 2NY7L 4RA3A 5DUPH 1A6VH 1EAPA 1MFBL 1CD1A 1I7ZB 1NPUA 1FQ9C 3HE7C 3NACH 1YDPA 3ZKNC 3QEQA 5D6DA 2DWDB 2YK1L 2GCYB 5CP3A 3SJVE 4KDTA 3G5YB 1FFPA 1H8OA 3FMGH 2EYTB 5LQBL 3B43A 3E3QC 3HB3C 1U8PB 5D1ZB 4DKEH 4X6FA 3WN5A 5JIIA 2ARJA 3T0BA 2CRZA 5KSAA 3QNYB 4PJCE 1Y6MR 4XGZB 3TVMB 1SHMA 3BPNC 4ZSOB 3S4SB 2Z8SA 4QRQB 5IHBA 4NPYA 3TA3C 2GSIA 2DB8A 5L6YL 1M7IB 2AEQL 2GITB 5EOQL 3WFEL 1J0ZA 5IKCA 5K9OB 4JPKH 5DJZB 1I9JH 1NBZB 1EPFA 3VFGL 1YNKL 1AR2A 4LLMB 3STLA 5JPMA 3G04A 3L6FB 5BMFL 3CLEL 3CMOH 3RWGB 2DLIA 2ADJB 4P3DB 1FYTE 5FOBB 1IM3A 4QHNA 4DK3A 4NKDA 5CSGA 4I9WD 3EW3B 4N0UE 4JANB 1T1WB 4JDZA 1FE8H 3T3ME 4XC3H 3NA9H 4UT7L 4XH2B 2X1PA 4ONGH 3HC4L 4PRAB 4GRWB 4PRHA 3ZDXE 1KJVA 3SE8L 2R1WB 2ZSVA 5DURB 4LKCA 4XVSH 1ACYL 4Z7UB 4HIXH 1L7IL 5EBMA 4U1LB 3CFCL 5MI0C 4HV8B 3QUMA 1R3LA 1CE6A 1FG2A 5HYJE 2P43B 4QT5B 1RV6X 4OQ1A 4CMMA 4ORGB 2A6IA 2ERJC 4U1GC 1A22B 3UCRA 1PX3A 3QEHA 4AENB 3S9DB 3D0VB 3WFBH 3DVGB 3B9VA 5D93B 3FQWA 5CEZE 4HUXB 3QCVH 4FQXB 4LGSB 3OZ9H 4JREB 1INEL 5SWSD 3EJZC 1OPGL 1ZT4B 5IB2A 3LEYH 1ZS8B 1KJ3L 1DQJB 4M5YH 2CUHA 5D9SA 3JTTA 5GGRY 2IAMD 4NGHH 3MC0A 4BQ6A 3O4LD 1WJ3A 5DGQA 4AG4H 1A5FL 1JYNA 1HOCB 3CFKA 3E1F1 5LAXB 5C92A 5FCUH 4U6HB 12E8H 1AP2A 5BVJA 3VFRA 3MZGB 4E41D 5FYKL 5F96L 1PZ5A 1MCIA 4LEOA 1JPGB 4JO1H 1QLEL 2X4RA 4PRIB 3HMWH 2GHWB 3N50A 3O3EB 3ZE1F 2NY0B 4KQ3L 5DVOA 2FX8H 3WFZA 5DSCA 1MJUL 3V5DA 1T22B 2UV3A 2BJML 5FEBA 2H8PA 4BZYA 1BQHG 2LABA 5HGAB 1AC0A 4KMTH 3MR9A 3KPNA 5J89A 1ND0A 1WBYA 4HAGA 5I9QB 3P4NB 2VLRA 4B7LA 4WO4B 4K7PH 1UACH 4AMKH 2APFA 2BVYA 4PJ8D 3BKYH 5EZLA 5IBLD 3DGGA 5F1IB 5FA3B 1C08B 1YMMB 3KPLB 2PETA 1BFSA 5F3BA 2GY7B 3W9DA 2X7LB 3GJFH 5IBUB 5GQBA 3OMZA 3BKMH 5JW4R 4GS7C 3QDJE 3EYFA 3TBWB 4GUPB 1U8JA 1MRFL 3I3DA 4JY5L 4IRJD 2JELH 4UU9A 4K23H 3D3VD 4GW5B 1FZKB 1XAUA 1UWGH 1MFEL 4OGYH 4KZDH 3L5IA 3BD3A 2Y5TB 5F93C 1CS6A 3DOSA 1U42A 3STZB 25C8H 5IWLC 3PQYD 1JWMB 3VXMD 1QD0A 4U1KB 4NZJA 3LMJH 1RIUL 3UX9B 5I76B 1NJ9A 1KEGL 4HFWB 4OZFH 2K9UA 5BO1H 4W4OA 1KTKE 3O8XA 5E00B 2DQUH 3SCMB 1EFXD 3B3IB 4F7PB 4BH7B 1A7NL 3BZFA 3MCLL 1E4XI 1DZBA 5JXED 4YFDB 5CGYD 4PGJA 2FCBA 4J8RA 5J4MA 3C8KA 2HFEA 4L9LA 4LCCB 1ONQA 5IB4A 3DNKA 1V7NH 1ZV5A 4MAYA 2FYYA 4M9PA 3BP7B 5EDXA 4KHTH 3QHFL 5BV7H 3H0TB 2XFXB 1SJXA 4J12A 5EOCL 4P5TA 2CKBA 1IGTA 2IPTH 4MAUL 4RGNB 3G5ZB 2UYLB 5C0BB 2CLVA 3MBEC 1MQKH 4N68A 3RY4A 4Z7VE 3HPLA 1ZWIA 1P4IH 1HHIB 2ADIB 3NFPA 3HZMB 4XBPA 1IKNC 1JFQL 4XCNA 2I9LA 1JTPA 3BQUB 3LKRB 4OF3A 2XKSA 3GUTB 4X6CE 3X11B 3ULUH 1EUUA 1G7QA 4HW6A 3MNWB 3UJIL 1ZVSB 4JLRB 2B0SL 4M62L 3BKJH 4IM8A 2DWDA 5KTEH 2GCYA 3QPXL 1RHHB 2F54E 3MRFA 2D7QA 1KXQE 1I85A 3G5YA 4GQPH 1JBJA 2UWEF 1CLOH 3C6LD 1E4XH 5JW4N 3MSPA 3PDGA 2DTMH 3C5ZC 1S9VA 3QNYA 3WNOA 1OTTC 4DGIL 4ENED 4ZSOA 1OQXA 5IFHL 3FB8B 1J87A 3MLVH 3S4SA 3SPVB 4ZNEA 4QRQA 4GW1A 3WJLA 4XP1L 1S7QB 4F57H 2GITA 4EOWL 1WTGT 5ID1B 4YBLB 4JFEA 4LLYB 1JPFB 5DJZA 2D7NA 4P4RA 1A7RL 3D39B 5D7SL 1J05A 3S6CA 4WUUD 2HJKB 4LLMA 4B41A 1DLFL 5D1ZC 3ISWA 4FQLH 3MO1B 3L6FA 1IEHA 1MIML 3NTCH 3RWGA 4LSVL 3TVMC 5JW4M 2ADJA 4P3DA 2B8OT 1MCSA 2MPAL 4WTZG 1TENA 1KIPA 4LRNH 3E8UL 2OR8A 2JB6A 1JZ5A 4JANA 1RK0B 3HRZA 1T1WA 2HJLB 2BHZA 1HHKB 3AM8C 5AYQA 4CU8A 3OG4B 2Y1VA 4MQ7B 4PJEF 1IKFL 2X5PA 5KS9E 4FZ8H 4PRAA 2XZAH 5GGQL 2ITDA 1RULH 3LEVH 5TQ0H 2YD7A 4PGZA 4PV8B 4BFBD 4CMHB 4Z7UA 3N0PB 3WL9B 5FHBH 3WNNA 3EHBD 4I3GA 4XWGL 5EU5B 3PNWB 4HV8A 3V7AG 1MPAL 4MLIA 1U6AL 3MXWL 3TV3L 3BEVA 3LHPL 5I75B 2JE8A 1JWSB 2G60L 4ORGA 4K94H 3HB3D 4FTVE 5HDOA 1N6VA 3QUYC 2Y6SD 4OI7A 4AENA 1U8LB 3D0VA 3L9RB 2HA1A 1G84A 3DVGA 4Z7VF 2P48B 4X4YB 1LD9B 2VLKB 3QEQD 1ACZA 4G8FB 4FQXA 2N7BA 4G8EB 3WXVL 4F7MB 5JW3L 1JN6A 3HI6H 1TVDA 1ZS8A 4UQ3B 1DQJA 3B2VL 1Z2KA 2W0PA 2VAAA 4GAFB 4X6CF 1KGCE 1N4XH 1CI5A 1UM4H 1OF2B 1HOCA 5KSAD 1JRHL 4HGMA 1CLYH 1XEDA 3MLTB 3VG0H 5LAXA 4U05A 2EYSA 5D93C 4PV9A 5F8QC 2ZUXA 1EMTL 2I07A 4EBQH 4FQXC 3LN4B 4D9LL 5B38G 4JREC 2R69L 3TESA 3NCYP 1QBLH 3KLAB 3VDBA 1JPGA 2B4CC 1M7DB 4PRIA 5ESQB 4H88L 5I1HL 1LILA 3MJ9L 1GOFA 5IJKA 3WLBB 3F7VB 2H41A 5E5RB 1BFVL 1NFKA 1DQMH 5T3XD 5HGAA 1DFBL 1WGOA 1KC5L 3E3QE 3RTQB 2VXTH 4OCLC 5D71H 2HKHH 5I15L 2HRPL 2VITB 1U8IB 1I1FA 1RUMH 2I5YH 5HHNA 4WO4A 1UENA 4PJBF 5EBLA 1MCNA 3IDYB 5GS1A 1N2RA 2EH7L 2NY0C 3LS5H 5KVGH 3QUXB 1C08A 3KPLA 3HKFA 3DLQR 4PRHD 3OKMB 3P0GB 3BFOA 1MLBB 3O2VL 3MA7B 1NCCL 1OCWL 4GUPA 3TBWA 2DQEL 1E6OL 3GKWH 3V5KB 5IHUH 3NCBB 1WCBB 2FIRT 2WIMA 2VDLH 2Y5TA 1N3NB 5C7XH 1JWMA 4LDLB 2H1PL 4LSUH 4YHNB 3S36L 3W11D 3HUJF 3AB0C 3O2WL 3CZFB 3RIFF 3OJMB 3V6ZB 3VMOA 1QPPA 4UMGA 4H8WC 5IQ9B 2R56H 4M6NL 1PQZB 4PPTA 2G75B 4WW1B 3SCMA 3B3IA 4F7PA 3C9NB 1MJJB 3TPUB 2ENYA 4KKCC 4OCWH 3WXWL 3NIGE 5TH2A 3ETBF 5C08E 4HLJA 4P9HC 4H5SB 4LQFH 3W0WB 3VXSB 1D5IH 2FJFB 5CJXA 2H32H 3I84A 4UBDC 2CUIA 3VI3F 4HG4K 5DMYA 4K07A 3H0TA 1FNGB 2GK0B 2E8ZA 5IQ7L 3ZT5A 4OUUB 1FZMB 3O6LL 4KXZI 3G5ZA 3U82B 5CEXB 5GISL 1CXEA 2IBGA 1HHIA 1SJHB 4XBGB 2ADIA 2XTJC 3PP3H 4P3CL 4WWID 2XWTB 1UYWH 4M93B 3R1GH 3UBXI 4LCCC 5FO9B 1QQDB 1YYLL 3G5VB 2BDNL 2VDNH 1F3DJ 4OD1L 1A4KB 3GUTA 3EJJX 5A3ID 5ACMA 1OP3K 2AI0H 5C0IA 2ESVA 3X11A 3GKZA 4POZC 2A9ML 3MNWA 1ZVSA 5L2KA 5FDYA 2VLRD 1F2XK 4IRZL 2X9WA 2Z35A 4IIQC 4U1NB 3MLPA 3UYOD 5L7XH 1CGXA 4W6XB 5J0BA 2H3NB 3L3DB 5FCSH 3RWIB 1RHHA 3L7EB 4GKNB 3VD3A 4AM0B 4M1DL 3BQUC 4FNLL 1ADQH 3FN0H 1GL4B 2F53B 3BE1L 2C3VB 1T5WB 1JZ7A 2FX9H 1YEKL 4ZS6D 1X5YA 1WFUA 4AH2B 1DJSA 4IOSD 3FB8A 3SPVA 4G6KL 3EO1B 4HIHB 4YO0B 1EO7A 1F4WH 5ID1A 1A0QL 1C5BH 4HKJB 4W68A 5C0FB 3IKCB 2NY5H 1XCTB 2P8MB 3D39A 4KXZH 4LRIA 4WHTB 4Z7WA 4FP8L 4JKLA 3SQBA 1KUMA 2HJKA 4P2QD 3MBED 4YHKH 3EYUH 3MO1A 4KY1H 3ARSA 5EPMB 3LPWA 3RBGA 1D5ZA 1G1YA 1TCMA 2Z4QB 1D6EA 4XPBH 5DQJA 4LAQH 5KN5B 3BAEL 3PGFH 4NN7C 2VN7A 3QXTA 4MAYD 1PVHA 3RVWC 2HJLA 4ZTOH 2LU7A 1FAIL 4MQ7A 4FS0A 2J8UB 4LRIC 5E0QA 1Z9OA 3WNMA 5F7FA 3JV5A 4EEEA 1LP9E 1IT9H 5FF6B 2CSPA 2R29H 2CK0H 3BD5A 4PV8A 4G7VL 4JO2H 3WL9A 5IT2L 4S0TD 5EU6B 5CMAB 4NQVB 4P2RE 4ZO6A 1VEPA 4QGYA 5DC4B 1JWSA 3MBXL 2YHGA 4D8PB 4MXQC 4HT1H 4JN1L 1OTTD 3FKUS 3D2UB 1PJ9A 4LSRL 4PJFE 3IRPX 3UROR 5FYJH 2GT9B 4X4YA 1LD9A 3GMNB 2VLKA 2HN7B 4G8FA 4CMHC 1A14H 1B4JH 1IEAA 1R24B 3QH3B 1KB9K 3I9GL 1TZGH 4UQ3A 3EOBB 4XP9L 5CINH 4C59B 1UJ3A 2Y36L 1WFTA 3EFFB 2HYMA 4N8CL 3CSBA 5D1ZD 3CC5B 3MYZA 2ZJSL 3TVMD 1ZANL 3MLTA 3OKDB 2D7TL 5BZDA 4YXLH 4YIQB 2FB4H 4NRZA 3KPSB 5CBEB 2PYEB 4JFED 2FJHB 3KLAA 2IMMA 3OXSB 5ESQA 1MVUB 4OZGF 1CDJA 3MV9E 1PD6A 4JG1H 2F9BT 2EDKA 5FIEA 2X4UB 1PG7H 1UB5B 1ZHLA 2UY7A 3AS2A 5H35B 5C0CE 4DN4H 1KCVH 3TYGH 1UG9A 3KR3H 3RTQA 4KVNL 2UUDK 1TVBA 4NZRL 3VFMA 3ALXA 1SMOA 3GFUA 2FH6A 3RIAK 4LMQI 3GSNB 1KF9B 2Y9RT 5J9PB 1GPOL 2VITA 1L7TH 1U8IA 1I8KA 3ET9F 2WANA 1MF2L 2YD4A 2D7OA 1EIBA 2EO1A 5F9WB 3QUXA 1TTUA 2M1KA 4B53A 3SKJL 2ICWA 3AAZA 5DURD 5GGVL 1MLBA 4RGOL 3MA7A 4L8BB 1MQ8A 3MV11 3RTQC 2K7PA 4G43B 3S36X 5AYUH 4O5LH 4I8DA 3V5KA 1CFNA 3UTQA 4XPTH 1WCBA 2OI9B 4Y1AE 2OXHA 3B6SB 1N3NA 2BSED 3DX9B 5L9DL 4ETYA 4YDVA 4Y4HC 4YHNA 4PLJC 3IDYC 2V2XB 2FIKA 4XMKH 1TETH 2HVKB 1UEYA 4BKLA 3CZFA 1JGEA 2AK4E 3WIHA 4Z5RB 3V6ZA 1BD2B 5IQ9A 2Q20A 1PQZA 4FQXD 3HNVL 4NNPH 2G75A 4WW1A 1K2DA 1UZ6E 2J2ZA 4PRPB 5HBBA 4TVPD 3C9NA 3SKOB 4MA1B 4XAKD 3TPUA 4OZIB 3CFBB 5GHWL 4G8GA 1AHWA 4K3EL 2EC8A 2OZ4H 2ZG3A 2GW5A 3W0WA 4PG2C 4PJDF 3VXSA 1J1OH 2FJFA 3B2UD 4EI6A 5GZNC 1MH5A 3O41B 4D0BA 1F4YL 3HFML 1J1PL 4K7FB 1KTDA 4OUUA 1FZMA 1CFTA 4DQOL 4FQCH 4DZ8B 5CEXA 3PWNA 1FZOB 4DGVL 2OCFD 1YEFH 3NN8B 1GIGL 4PRID 4P49A 2XWTA 3MGTB 3QPQD 3QWRA 4AIOA 4I77L 3O9WB 5FO9A 5KSBF 5BRZB 3G5VA 4PJAE 4YDKH 3MNVB 5I71C 5GZOC 4HG4J 5DO2C 1H3WM 3M17B 4Q58C 4H0GA 4OM0H 4WO4D 4JDTL 5AZ2H 5ENWB 4XP6L 4I0PB 3F58L 4L3CA 4ODHH 5DDHB 2H3NA 3L3DA 5HDBE 2B1AL 3L7EA 4GKNA 1AGEB 4AM0A 2BSSB 1VFBB 1AXTL 2VR5A 4IEFB 5DEGB 4MQXD 1KNOB 1H3TA 4QWWC 2VZTA 4TSBH 1T5WA 2GAZB 2YPLB 4JRXB 1QHPA 4AH2A 3QO0B 4KK9C 2EYRB 2IWGA 3S8WA 1TJHH 3KG5A 1PX4A 4NC0B 2XRAL 4P0DA 4YO0A 3JUZA 3N85H 3MRIB 1IMHC 3OB0K 3A6BL 4WFFD 4HUVB 1NMBL 4NQUA 4HKJA 5C0FA 4YDLC 3IKCA 2P8MA 3V4PL 3ZZ1A 4Q9QL 4WHTA 2W1NA 5HI3D 4JGMA 5GJSL 3SCMD 2NMSA 1J8HE 1ETZB 3TIEB 3VRLF 3U79A 5EPMA 1RFDL 1RUAL 5D70L 1CBVH 2EC9U 4WW2B 3TEUA 3I75A 2HP4A 2I60L 2ICWJ 1WZ1H 3OJDA 1QSFE 3MACL 1I3VA 4U0RB 4M43H 2BVEA 4JRYA 4YUEH 2J8UA 4P5KA 4RGND 2MCPL 3U83A 5FF6A 3CVHB 1P9MA 4HS6A 2EDNA 4NHCL 3ZHDA 2OP4H 5T1LA 4UILL 1A7BA 1KN2L 4LBEB 1XCQB 1KLFA 2DF3A 3PWUB 1P2CB 1RU9H 5T1DH 5EU6A 2VDQH 3C09B 5CMAA 2ICCA 4NQVA 3WFDL 1KCRL 1T89A 5HYSA 2ENSA 2CQVA 4G7YL 3BQUD 3KYAA 2VKWA 5FKPB 4PFEA 5J6GB 4P23C 4M6OL 4D8PA 2ESVD 4LF3B 4HWEL 2EKSB 4GRWF 3TZVB 3NIDF 5DMJB 2ICES 4JQXA 1F4AA 3VI4F 2AXGB 2GT9A 1WTLA 5F9OL 4Z7UF 5GGSY 3NCCB 5IIEB 1NL0H 4S1QH 3VFWA 3QH3A 3BDXA 3IDGB 3ZE2E 3FO0H 1HZHL 1BLNA 4S2SA 4C4KT 4OT1L 2XTJE 3EOBA 3F8UB 4ZYKB 4DN3L 3EFFA 2FHCA 3ARGB 4L3EB 1G6RH 4O4YL 4AT6A 4IHOB 4PY8I 3KPMB 5T3ZD 2L0DA 5E5UB 2YC1A 3OKDA 3KDMB 1NC2A 1TCRB 1QSEE 1IFHH 4KJWD 2Y5EA 2VXSL 1A7PH 4YIQA 1LDPL 3VGAB 1XGQA 3OAYH 3KPSA 5CBEA 2XIDA 2PYEA 3P11H 4KTDH 3OXSA 1KB9J 4QNPE 4U3HA 4PG9B 4X83A 4MLSA 3D39D 3V4VL 2G2RA 3NFSH 4RRPA 3CZJA 3EUUA 3LKNA 2X4UA 1UB5A 1KLGB 3WYRA 5H35A 3BIKA 3KLDA 2IQAA 5JO5B 3VXOB 1EHXA 1J12A 4U4BA 5E4IA 4D0DB 3M1BB 3GSNA 3M8OH 4YDIL 3D18B 3DV4B 4NQCB 4KJQC 4HXBL 5LKNA 4I0CC 2E3VA 1U8NA 2MSPA 3WS6C 1RHFA 2X2YA 3DI2B 4JGJA 3BVNA 4IOIB 1GZPB 3FAXA 5DRXB 4PGBA 4G43A 2A6DB 2YD5A 4LCUB 5KW9H 1JNNL 1Y6KR 1DQDL 1X5LA 4JFHE 3MLSL 1DBKL 3QZWB 3B6SA 5I1JH 1EJOL 3NZHL 2BZDA 2QSVA 3DX9A 4RQQB 1B6UA 2C3GA 3LZFL 5JIPA 4NZTL 1RIHH 4QF1B 2HVKA 5F9WC 4XPAH 5F7UA 4B50A 3WKML 1BMGA 1IAMA 5EWIH 1AFVH 1BD2A 1TDQA 3O4OB 2VLKD 1R5VB 4NKQB 4S1RL 3PHOB 4LPCA 3O6MH 4PRPA 2ADGA 1LO4H 4QGTA 4ZXBB 1S3KH 3PV6A 5HHXH 1BVKB 4BQ9A 2J3SA 1I9IH 3NH7L 5IBTL 4XX1G 5EO0B 2DMCA 3DV6A 3FO2B 1YZZA 5IV2B 4MVBD 4PBWD 1KCLA 3O41A 4QHKJ 3GRWH 3QR2A 1HQ4B 3AFLA 4K9EL 1FLRL 4Y19E 4GH7B 3KJ6L 1V8HA 4DZ8A 4OGZA 4ELMB 3ZE2F 1FZOA 4MA1C 4QOKA 5F3HB 5C0JA 1UKSA 1EGJA 2GJ6E 1Z0NA 5GGUA 4ZMAT 1IQDA 4YHZH 3FT4B 3RJDA 5ALBH 1ZOXA 3QFJB 4N0FB 5EIQA 1PYWB 2FGWL 4YEEA 1YQVL 3RTQD 4XCCH 5GS0D 5C6PB 4OCMC 4Z6AT 5IGXH 3CK0L 4NSKA 1IAOB 4XCFL 4CJ1A 5AG8A 3O45B 1CXIA 5E9DB 1CL7L 1RK1B 3OB8A 1QFUH 1JK8B 5ENWA 4MNQB 2WZPD 3DETD 1UKQA 1HHJA 1S7VB 4I0PA 5E2VH 5MENE 5JUEL 3QUXD 4JHAL 2F5BH 3O9WC 1KULA 5J3HD 1AGEA 2BRRL 4GMSH 1KNOA 2AABL 2DQCH 2AJZA 3FRPG 2AV1B 4LEXL 1BQHB 1MCPL 2BNRB 5FECB 5JW5B 4FQ1H 1MIEH 1ZHBA 2EYRA 4B0MM 2VDRH 3N1QC 1IBGL 4OCXH 4OD3L 1FGVH 1U93A 2C1PB 4R8WH 3F5WB 1FIGL 4KAQH 3TJEL 2WIIA 1TNMA 4OJFH 2FX7H 3GZKA 1W2KT 3HI5H 2H45A 5J7CC 2X4OB 2P5WB 1VFOA 3WBDA 1QNZH 1ETZA 1JMXA 1RPQA 4G8GD 5FYLD 3MUZ1 3W0WD 4F9PA 3UC0H 3VXSD 1XIWB 4JFOB 2AV7A 4DTGH 1JMZA 4LSPL 5D5ME 4RWYH 4ZO7A 3VDCA 1RZ7H 1MHHB 4M6AA 1BZQK 2CIIB 5GZOD 4GO6B 5DO2D 2X10A 2MCG1 5FGCB 4P9ML 1QR1A 1Y6NR 1L6ZA 2FDBP 3CVHA 3WFCH 5C07B 2IANB 2VC2H 3Q6GL 4HSQA 1JUFA 2DMBA 1ES0B 2VIRB 4LBEA 1P69B 1J0KA 4IDJH 4U0QB 3ZDZE 1P2CA 5F9DC 1JJUA 4WW2C 4MXWL 1FZJB 3O2DL 3BOVA 3WSQL 2AJSH 4OLUL 1MFAL 4UNVA 3GSRA 5FKPA 5J6GA 5DLML 1YC8A 3FT2A 2V9RA 5IW1B 2RCSL 2FGZA 2EKSA 4XVTL 3ZKXC 3ZDYE 1UKTA 2AXGA 2COQA 4YZFE 5IIEA 3S3SA 5JXAL 3IDGA 4NO5A 3C09C 2WSKA 3SDYL 3S3JA 5EH1A 5D7LE 1HH6B 3L3KB 4L3EA 1OAQH 4J1UB 3PWVB 4Z77B 4MCZB 3KPMA 5IG7A 3TZVC 1XF4A 4U2YA 3FFDA 2NTFB 5DRWA 3O0RL 1F58L 1TCRA 2A74B 5DMGD 1L4IA 1TNNA 2YA1A 3MGOA 4A6YB 3ECBB 5EFIB 1FIEA 4PG9A 1FPTL 1C7TA 4LCWB 1HINH 1M7XA 3ARGC 2EEDA 4PJXB 3CFDB 5LJYH 4MA8H 5JO5A 3S88L 3D69A 4D0DA 4M7LT 3W82A 4LSDA 3PL6B 1RZFL 2UZIH 3M1BA 3DUHA 5DUMH 1KENL 3VGAC 4N0CD 3D18A 3DV4A 3KS0J 4NQCA 2GIYA 3GB7B 1NQBA 5GGRA 2HT3C 3TGXA 3BGFB 5JHLH 4JRYD 2GEEA 4JB9H 2R0KL 2JJSC 2XV6B 1RSFA 3RWHA 5F7YC 1XF1A 1UGNA 5FGRA 4ISVB 5I8KL 1UH2A 1CK0H 4HCRA 5DRXA 5EB9A 2F53E 2A6DA 5EU6D 4LCUA 2DKSA 4PRDA 1MREH 3EBAA 3X14A 3QZWA 1Z3GH 2DN7A 3FCTA 4X7CC 4GG6E 1DN2A 2QQLL 5D7IB 4POUB 2BY2A 4QHUB 4QF1A 1TVHB 3CDGA 3GMLB 5JHDB 1LNUA 5E2WH 4DVBA 2APXA 5JPNB 1R5VA 3KLHC 2VLMD 1AR1C 1FCCA 3C2SA 2W91A 3FFCB 2X89D 5LBSL 2YUVA 1BVKA 3P0YH 5CZVH 1HNGA 1HE7A 5EO0A 2XA8L 4WNQB 1FJ1B 3IU3B 5E94B 1IGFH 1T6VN 5IV2A 1FDLH 1HK6A 1VDGA 3U7WL 1DLHB 2OL3L 3H9SA 5BZWA 3VXRE 1NC2D 5JNYA 4DVRH 1HQ4A 3BX7C 2G9HB 4FABL 5CP3H 5EUOA 5C2UB 2Q87A 2FBJL 5F7EH 3KPSD 2PYED 2KDGA 2AJVL 4ZXBC 1JNHB 4G6JH 3OKNB 4NQDA 3NZ8B 1A1OA 4XMPL 3BEWA 2HT4C 4JEGB 3H3BC 1WFOA 4HF5H 3QFJA 3L7FB 4TUOA 3WJJA 4N0FA 3GSVB 3GSXB 3BZEB 3SE3C 4O9HL 3N1GC 4NN6B 1V5JA 2A6JB 1IAOA 4PUBH 1N6QH 3O45A 5D2NB 3QFDB 4GSDH 4D2NA 3PF2A 4X7TA 2WBKA 1DP0A 1T7YA 2DLTA 1WVZA 1S9YA 4LLWB 3IB4A 3MV7B 4MNQA 1S7VA 1GHFH 3D0LB 1AXIB 1NMAH 5T3XH 4E42B 5CBAA 4TNVK 4OV5B 5ALCH 2YOCA 1DANT 4OGXL 2AV1A 1RVFH 3S35H 3K1DA 2DQGH 4K8RL 2NY4B 5JW5A 4W6YB 1SJEA 1NFIB 1CWVA 5A2LH 1VEMA 3SQOL 5I30H 3T3PF 4UIMA 1FFNB 4PB9L 4ODTL 1NGPL 3LDBC 2C1PA 3TPKA 5ISZE 3EAKA 3F5WA 1D7FA 3PP4H 1FH5H 1GOGA 2EE2A 1NFDA 3QISA 1BD2D 2X4OA 3I50L 2HFFA 5I8CB 3QUMH 1IGIL 5I0ZA 1K6QH 4PRPD 3I2CL 3UJTL 5JMRA 4NCC2 2H9GA 4OCSH 2AS5M 2J6EL 5DJCB 1HKLH 3L3OA 2WUCH 4OQTA 2FZ3A 3W2DH 4ZD3H 4WGWB 3DRQA 5ITBL 3SE9H 2QQKL 3RIAF 3RZCA 1JGVH 3P30H 3NOIA 1CFBA 5L0QC 2XY2A 1AD0B 5GRWA 5C07A 5FV1L 5DJDB 4WENB 3VD4A 3BUYB 1JNJA 2WWMD 2VIRA 3BJLA 4GKSA 2YR3A 3QXVA 3KPRA 5IVOA 1XIWC 1KN4H 1NGZB 1AE6L 4TQEH 3TH2T 3WDJA 2J8UF 5FHAL 5FO7B 2WK2A 3MLYL 2DBLL 4WUUE 1JGUL 3GI9H 3O81A 1N64L 5DJXA 3VGBA 3SDXB 5D1QB 3EYVB 4HULB 5DK0B 1MSPA 4I0PD 1A2YB 5JOFA 5CGMA 1KYOK 4LIQL 3FO1A 4LU5L 1O0VA 1FNFA 4WTXA 1AJ7L 5DRNB 1MI5E 5B21A 3Q2CA 4MX7A 3L3KA 1YA5A 4Z7OE 1WF5A 4CVXB 4UIKL 3O3BB 4JRXD 3PWVA 4WU5A 1TFHA 1U92B 2W59A 1WWWX 4JKPH 1D9KC 4Z0BH 4PJ7A 2Z0BA 4QXGH 4A6YA 1OT1A 5GXBB 1EUTA 3T2QA 2WP3T 2YUWA 4Y8AA 3X12B 4LCWA 5ERWB 2JK5A 3TO4B 3NIFF 4PJXA 1G7LA 3CFDA 4NHUB 4OFPA 3V6OC 5BRZE 5C0DB 2BSTB 4TOYL 2YPVH 5K9JH 2JCCA 4X98B 5TF1H 1XGYL 4ODWB 4I18B 5CUSH 4GAYB 2VOTA 1G7MA 3P9MA 3GB7A 4MJ6B 2RFXB 3H42H 4C57C 4Y7MA 4MHHI 1BX2A 4XNXH 4CDHA 4QKXB 4WFGE 3UZEA 1QO3A 4JKMA 4LVNB 4N0RA 2DQHL 2VUYA 3T2NH 3DXAE 1NLBL 1PW3A 1MRCH 2YPLE 4JVPA 3H6JA 3PL6C 5MEQB 1A6ZB 5F44A 2XZZA 1KJMB 1BREA 2CKBH 2YMXL 1JZ6A 3HNSL 4P46A 4K3GA 1E4KA 4LVHB 1AGCB 4M8QA 4QHUA 1TVHA 3GMLA 2LFGA 5INDA 3IDIB 1RI8A 5JHDA 3BHBB 5ADPH 4Y16C 4JZJC 3QWOB 4FRWA 3CNKA 4MB4A 1G9NH 3MV8A 1MJ8L 2ZZUT 4Z18A 3UDWC 1HH9B 1X5KA 5BVPH 3TBVB 2H26B 1U8OB 2N7AA 4KH2A 5T5FL 1BFOA 4L3ED 1XGPB 3ELAT 5L8LB 4HPYL 1BIIB 1H0DA 1TJGL 4CADB 3RVTD 1HIML 1J18A 3U6RB 1UCBL 5A2FA 1RZGB 3CXHK 2G9HA 2XNAB 3WUWB 3U4EB 1CF8H 1HCVA 4N90D 4RGMB 1HQRB 1JGLL 4HWBA 4OZIF 3GJFA 4S1SL 5ESAB 3WIIL 4DK6A 3NZ8A 4TTDC 4OKVB 2CRYA 2OJZL 5E99L 5F7WC 4GAJL 3L7FA 4XB8A 3OPZH 4E5XA 2C3HA 2HVJB 2F5AL 3GSVA 2RAMA 3BZEA 2A6JA 2ZP0T 4UDUB 2QQNH 1KFAL 4L4TA 5D2NA 5GJTH 4QRUB 2WBJA 3WIFA 5JZ7C 4NQCD 4G6AC 5D1XB 3BMVA 1IC4H 4OZFA 4LLWA 2EEBA 1B0WA 3MV7A 2EDQA 4EVNA 2J8HA 2VXVL 3WDHA 3G5XA 3VWKB 3CXDL 3CFJB 4P4KA 1VFUA 4N5UA 4WJ5B 1CFVL 1HSAB 2YSSA 2Y06H 4EDWH 4OV5A 2Y25A 4X7SL 5IMKB 1L9MA 2WV3A 4XAWH 4G9DA 3GO1L 3OR6B 5I17B 3H8NA 5I1CL 1TZHB 4LPVA 4NQSB 3LRGA 1NBQA 1FFNA 4KGLA 1LO5B 4GRWH 1L6XA 4L8SB 4QXTB 4URTB 4HK0B 1ED3B 2ZOKA 5A1AA 4NO0B 5D72L 4F58L 5D2LA 2LTQB 4YK4C 3C08H 3IDXH 4AK1A 5I8CA 1QEWB 2NY4C 5IR1B 4PYHA 4S10A 3VXTB 3PGDA 5E8OB 1G0YR 3L3IA 5DD0L 3RUGB 2CRIA 4OF0A 2NNAB 3RKPA 3MUY1 4FXGB 1F3DH 1S5IL 3H9SD 3RJQB 2A0LC 4DW2L 3LN5B 4PR5B 1G9ML 5KG9A 4TVPH 2W65B 5E6ZA 4Q9RH 1EX0A 1LEGB 2IH3B 1AD0A 1Z5LB 4L4VE 4KDVA 4Y4KC 2IF7A 4D3CL 3L1OL 4NQDD 2RQ8A 3P3YA 3QFJD 4WW2F 3ZKSD 2F8XC 2AEPH 4O02H 2AJUL 5HVFB 2CRMA 5GS3A 5BJTB 3BP6A 1IQWL 1H3GA 2B2XH 1GAFH 2P8PA 4K9EC 1RJLB 2CO6B 2NX5B 3SDXA 5D1QA 3EYVA 3NAAH 4NRXB 1A64A 4MNQD 3UTSB 3MRKB 1A2YA 5IOPA 2D31A 1QKZH