5EORH

Structure of the murine antibody fab 8e3 bound to the vaccinia virus a27 peptide 101-110
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
214
Chain Sequence
b'QVQLKQSGPGLVQPSQSLSITCTVSGLSLTSYGVHWVRQSPGKGLEWLGVIWSGGNTDYNAAFISRLSISKDNSKNQVFFKMNSLRADDTAIYYCAIYYRYGAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTGSSVTLGCLVKGYFPKPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti vaccinia virus A27 antibody 8E3 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 38
structure length 214
sequence length 215
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorH02
2JB6A 5T33H 2ICEB 3MV8B 1PQZB 3NCBB 4LVNB 3O3BA 1QPPA 1HKLL 4RFEA 4U1IB 2AI0L 3OAYK 4Y8AA 4X80H 1I8MA 3UJIH 3S4SA 3VWKB 1DSFL 1T7WA 4GAYA 5ICXB 3TPUB 5EBWB 5GGTA 3RVVC 4QXTA 2PXYD 3MYJA 1WIOA 4XPFH 4ERSH 3OJDB 3MRFB 4RGNC 1BX2A 5FA3A 1LGVA 2ZSVA 2AJYH 1AO7E 4ZPTA 3BHBA 1O7SA 1XF2B 4HFUH 3CPLB 5FYLH 2ORBL 1CTOA 1FAIH 1GGBH 4OCNC 3JTTB 3LSOA 3ILQD 1MHEB 1AR2A 3GSXB 5DEGB 1FLRL 3L5WB 1I3UA 3X3GL 5TF1H 3RTQC 3FB8A 5LQBL 2VLKA 1L4IA 4JRXD 5D7LE 3U6RA 3U0PA 3O2DA 3ZL4H 3U9PL 4U1LB 2VDRH 1ZKAA 2F53D 3LS5H 4WHTA 5AZEH 1Q0XH 3UC0H 4OUUA 4XNYH 4R2GC 3EYSH 2XN9D 4M3JA 5EZIH 4ONHA 3P9LA 2DBLL 4MA7H 1T21B 5H35A 5HGDA 4PRAA 5F7WC 1F6AA 4KRPD 5I74B 5IG7B 1KNOA 3UBXA 4F33A 1EEZA 1AO7D 3VW3H 4NQVA 12E8L 2HLAB 3MSPA 4Z5RB 3MRDA 1XF5A 1I8KB 2ICWJ 2QSCH 3MO1B 3S35L 1TCMA 4I48B 5EZLB 4AT6B 3DMMB 3FO1A 3O4LD 2C3VB 3C5ZB 5C0BE 2F8XC 1OTSD 4ZAKB 4CL7A 2IALB 3QCUL 4XPTL 2Z91B 3RUGB 4XZUA 1I75A 1NKOA 4P3DB 5D7LD 5IGXL 1BM3L 1OP3H 4QO1A 4LHUG 3B2VH 1A6AA 4AZ8A 5KANG 1A1MB 5C86A 3BP5A 3GIZH 3FT3A 5C07A 2FL5B 4Y5YC 3QG6B 5DFWH 1NFIB 3T2NH 4NQCA 4UT9L 4X98A 3TWCL 5KSAB 3BD3A 1I1CA 3I6KB 2B0SL 4OQTH 4TSCH 1IJ9A 5D96C 1HNFA 4HS8L 3MLXL 4HZLA 3LRGA 1XH3A 1WICA 2QQLL 4GRLC 5J1SC 3MRIB 4U6YB 3NCEB 1MCHA 2DQFB 4WENB 3MLWL 1E4WH 4J4PD 1J05A 2P49B 1AE6L 1CDGA 1W72A 3SJVD 2R0KL 1TDQA 2R29H 1U8JB 3LQZB 4HGWB 1ETZA 3R8QA 3UTQA 43CAB 1H5BC 3MRQB 5EWIH 1JN6B 2J8UA 1OGAA 4XCEB 4MS8C 1LO2L 5GS0L 4F7TB 2P7TA 4PBVC 3NZHH 1W0WA 1T89A 2YWZA 4HPOH 3O6ML 5M94B 1SEQL 3T65A 1J1XH 1JIBA 5HBBA 1K8DB 4GXVL 1UKSA 4M7KH 3MV7E 3IGAB 1T2QL 1FYTD 4LLVB 5F89A 5F88A 2J6EH 3C60B 5FXCH 5SWQB 3JUZA 4OGZA 1MWAL 4OZHA 3MLTB 3TBVA 3MJ8B 5CP3A 1UM6L 4NQSA 1JGEB 1SVZA 2Z31C 2NXZC 4IOIB 5GGRB 3JV4B 1Z9LA 4YQXL 3N1GC 3QO1A 3HR5A 4BSJA 3K4AA 2D0GA 4LDOB 2AV1B 4WHCA 1AGBA 4ISVA 3VE0A 5LGHL 4OV6F 3KLDA 1EH9A 2XWTB 3QPQC 1VFBB 5D6CA 2XTJD 1NGZA 1K4DB 3LH2L 4WU5B 1IL1B 4KJYA 5FKPA 1LILA 3IJYA 4GRWF 4Y4FA 5HVHB 3EDJA 4QYOA 1LO0L 5DRXB 4A6YA 2PYEA 3GBNH 2ZUVA 2B4CH 2CKBB 4MB3A 3VXUA 3WNMA 5JIIA 4LOUC 2NY1D 3DUUA 3GMRA 3D3VA 1I9JH 4NUJA 1PVHA 1HK6A 3RWIB 5C07D 4GH7B 4FQXC 2DTMH 4DK3A 1EHAA 3FAXA 4OLXH 2W65A 1H3TA 1AKJD 4MCZB 5B8CA 3LDBC 3QQNA 5TPWL 5IR1A 3SHSA 3RVXD 4Y4HC 1IQWL 2WP3O 4K23H 2R2EA 1N4XL 2Y5EA 5DUBA 1XR9B 4UINL 5EORL 2X4UB 4XH2A 3DVGB 4R4BA 4ONGH 1U42A 1EUUA 1S9YB 4F8TA 1MCNA 5J4MA 2OL3B 2BFVH 1LO3H 3OF6D 1U95B 3PF2A 3TFKD 3NBNA 1BF2A 2NTSP 1JF6A 4EDWL 1OGAD 4V2CB 5JORB 3CDYA 1BQLH 2I07A 5INCA 2OI9B 4NKIL 3DROA 4PR5B 3GGWB 1WAAE 2WSKA 1AGCA 1F42A 3FQWB 1KB9J 3BH9B 3GSUB 4ODHL 4O5LH 4ZUTB 2DIJA 4Z18A 1E4KC 4HIHA 2OS7A 2A9ML 2DYPA 4I2XA 4QKXB 1OP5H 3EZJB 1S9VB 2P24B 3WS3A 3NIGF 2Z4QA 1EDQA 3MRPA 1DE4B 2YA0A 2HT3C 2CDFA 2F8OA 3N85H 4EN3C 5BV7C 1QFPA 1IGTB 5F97E 2FX9L 5DFTA 4ETYA 4HV8A 3GRWH 2EEAA 2V17L 3E3QC 4WV1C 1P7QA 2DQDH 3N1PC 3SDXA 5DK2B 4OV5A 3RKDD 1PG7H 2Z8RA 4CNIA 2DQEL 2W0FA 1IEBA 2DI7A 3DXAE 4Z7UA 3QP3A 3U48A 1NSNH 5DFVD 3I6LE 5DQJA 5FEBA 4WJ5B 3SGEI 4E41A 5HHNB 4Z7WA 4BZ1H 2JIXB 3KPMB 3B5GA 3O81A 4OGXL 4CU6A 2EDKA 5DURB 2O5XL 1SJXA 3LKQB 5F6HJ 3VXUD 2XNAA 1LHZA 4Y4KA 3VFNA 1PZ5B 3ARZA 2AJ3A 1X5GA 3D3VD 1A1NA 4ZFFA 1MJJB 4JHWL 2Z93B 1MLBA 1VKXB 2WLYA 3NFSL 1WZ1H 4JQVA 3DRTB 1ADQL 4QTHB 3HNTH 5K33A 1JZ8A 3UZQA 4QHMA 4PRHB 2R2BB 5I73B 3CFCL 5GGTH 3QFJD 3QUKA 5C92A 1RMFL 2FECI 4GAGH 3D69B 1XGYH 5HHVH 1A9BB 2BNRE 3K3QA 5C0EB 4IRSD 1P4BH 3F58L 1KACB 1KJVB 4FG6C 2HTKC 1RZIB 2YPKB 3I3DA 1XR8B 4X6CE 2ZSWA 3AUVA 2X4RA 3IB4A 3IAQA 5HHOA 4CVXA 1NCBH 4HLJA 1WBYB 4M1DH 4XXDB 4PPTA 2YEZB 3IRZA 3FQTA 3CD4A 3BKJL 4KHTL 1UXSA 2RGSA 1Z0MA 4JE4B 4HWUA 1XZ0B 3O2DH 1NANH 1QBML 2DM7A 1RJYA 4RBPH 4XC3H 1MOEA 1J1OH 4M8QA 4X6BA 5D7SH 4G6KL 4P4KA 5DD1L 2A6DA 3I2CH 5HGGS 1L9NA 3UAJC 1ZA3A 2VL4A 4PJEF 4PJAF 1FFQA 1QSEB 2Y4SA 3BPLC 3MXWL 1A3QA 3SKNB 3VDBA 4HKZA 3VGEA 1D5ZB 3DETD 3REVA 4JFQA 5D7KE 4XHJC 1J5OH 4K8RL 4YWGH 3RWDA 1U2CA 3ARFA 2Y72A 4LCCC 4YAQB 1UJTA 1AH1A 3WMSA 4D94A 3FT2B 5C8JA 3D0LA 5MEQA 5CJOH 3GI8L 1A14L 2Y6SD 4PG9B 4PRPB 4EUPB 3ZKND 2AJSL 1P7QD 4JFED 3ZDYF 4MMXC 1MCJA 2EKSB 4U1SA 4ZUUA 4FQLH 4YO0B 1N0LA 2VXSH 5TGBA 4BH8A 1KIRB 3IFLL 4X7CC 1FIGH 4PRBB 5H8DA 3TF7C 5DA4A 3W0WB 5CJQL 2R56L 1S5IH 2YHGA 4ZUSB 5D2NA 1UWXH 2NY4C 1CICA 4OZ4A 3VFGL 3C5JB 3EHBD 5EC1B 4KK5D 5EU5B 2ITCA 5D7KD 2DDQL 1UH2A 1XCQB 2D2OA 3RA7L 3WSQL 4DEPB 1RQ5A 3OKLB 1UWEH 5KVFH 1TITA 2H8PB 2C3XA 4NRXA 4O02L 1HXMB 5IB1A 2AEQH 4MD0B 1YUHB 5C08B 1CE1H 1JI2A 5F9JB 1DTUA 3WUWA 2XA3A 2X7LA 4NNYA 3MROA 4XVJL 2UYLA 3PL6A 2BHUA 2IH3B 3IDMB 2GSIB 3FO0H 3RY5A 1R3LA 4X0KB 4YFLI 3QHFH 5HHOD 2ED8A 4RWHA 3QWRD 5DD3L 1DVFC 3QUZA 4Y5VC 1GSMA 4DKFH 1C12B 3T1FB 4NNXB 1MCBA 1H3XA 1JGDB 3E8UL 5FYJU 5IHBA 4KY1L 4OCXL 3U30B 2EE3A 4P4KD 2C1PA 5JO5B 1GC1C 4S0TD 5D9SA 1EHLL 5J13C 4G8GE 1U6AL 3SOBH 2VDKL 4L4VB 4G6ML 5T3XH 3VFSB 1NBYA 1DQLH 4FS0A 3TBSB 1T5XA 3VRLE 2ZCKH 4N5EC 1A5FL 4R90H 1HEZB 5D5MF 1B2WL 3TBTA 5CSZB 4Z9KB 1JUFA 3QQ9D 1LDPL 1DFBL 2Z35A 5EC2B 5FYJE 2AK4A 3VD5A 3U0TB 3IFOB 4DFIA 1KG0A 4KRNA 3QXDB 5HHMB 2FO4B 5ITFB 4UB0H 5EOQL 3WL9A 3BIBX 4F3FB 4ODWB 2NY7L 4U1HB 5I1GL 2AXFB 2VXUH 4OB5H 5E5MB 4J2XA 4RISL 4K71B 1JWSA 5IB5B 4OZFA 5BQ7A 2F5AH 5L88H 4FTVB 2GAZB 7FABH 1LNUA 5C0FB 3ESVF 1MFNA 1F90L 1X9QA 4HWEH 3FOLA 1XIWC 3EJZC 4LLWB 3FFCD 2PO6D 3M8OL 4LIQL 3G5ZB 5IHUL 1CDIA 4BQBA 1OF2A 5F9OH 4XNMA 2FD6L 4O9HL 2NY3B 2AAVA 2VKXA 5DMKB 1FPTL 4WI8A 3JUYA 1BREA 2EH7L 3PL6D 3F6IA 1N7ML 4LQFH 4B41A 1A21A 3P73A 4KTEH 5J6HB 4LVEA 4TUJB 3OKNB 3V0WH 2ICEA 3MV8A 1FVDB 5C0DB 1DDHB 4S1RL 2VSDA 2UZIL 1T7VA 1MF2H 4WY7L 2OTPA 4U1IA 3VI3E 3MZGB 5DQDL 5EO0B 2NXYB 1E6OH 4LSQL 1SY6A 3HPJB 1JHLH 3VWKA 2QQKL 3P30L 2VMFA 2CGRH 4TVPH 3OJDA 4CMHC 1BAFH 4PD4K 5DJZA 5AEAA 1T2XA 1IE5A 1WTGT 4FMFA 2X4TB 4MNGE 1DLFH 3MRBB 4L5FH 4O2FB 1XF2A 4OCRL 4PYHA 4QF1B 3JTTA 1KPVA 1NQBA 3TJHD 1S9XB 1GGCL 1MHEA 1ZT1A 5EDXA 5CSBA 3GSXA 5DEGA 4KJWC 2ESVB 3L5WA 2FJFB 3WJJA 4UMGA 1NBZB 1UXWB 1VGEH 3NA9L 4G7YL 5I0DA 5JOPD 5D7JB 4OF7A 3S37X 5IVNA 3PWVB 2FYYB 3L5XL 3GMLA 3DNKA 3SDDB 4U1LA 5I1KL 1ZV5A 3WFHB 3PXHA 1OM3H 2QHRH 1RJZB 4G9DB 1HE7A 3MXVH 1T21A 5E1AB 1PFCA 5CEZL 2JJSC 5IG7A 5DT1H 4QRPB 2ARJB 3PP4H 1TZHA 4FXGB 4HT1L 1HHKB 4Q0XH 2DBJA 5BS0B 3GO1L 3ARYA 4MWFB 3WXWL 1T1YB 2HLAA 4N0UB 4Z5RA 1I8KA 1QKZL 3MO1A 4P9HC 4HIEB 4JPKH 4I48A 3DMMA 2XPGB 4BZYA 2C3VA 3C5ZA 5ANMB 4KU1A 2NY0D 1SMOA 4ZAKA 3FJTA 1KC5H 5FDYA 2IALA 4DVRH 3ME0A 4KPHH 3H8NA 4ZFOL 4OZIE 1JBJA 4P3DA 1DQJB 2UWEB 3V52L 1FL6B 2ZOKB 2EZ0D 3EFFA 5KSVA 3HS0B 5I1HH 1A1MA 4H5SA 5FECB 5K9OB 1INDL 4R0LC 5CBEB 3R0MA 2FL5A 2FJHB 3QG6A 1F58H 3HFMH 3KYKH 1CL7I 1KENL 1NFIA 5IMOB 5LGKA 3O2VH 1QRNB 2VN7A 1YYLL 2YC1B 5KSAA 3EDEA 1WEJH 2BHYA 1A64A 1JVKA 3I6KA 2O5YH 4J6RL 4HGKC 2DTSA 1HH6B 3LKNB 2F74A 1JGLL 3DGGB 1T1XA 4U6YA 5DD0H 4E42B 1BQHG 1IAKB 4WW2B 2DM4A 3HE6D 3QEUB 5F1KC 2FB4L 4PJHB 4NZTL 2DQFA 4Y16C 5F7DB 4OSUL 4J3TA 5GRUH 3OG6B 3MLPA 5FGCE 3RZCC 3VWKD 4LLAA 1A6PA 3KYMB 1U8JA 4FQJL 3LQZA 3FHQA 4HGWA 4TYUA 1OCWL 3OR7B 4RA3A 43CAA 5E9DE 3GMOB 3MRQA 5TE7L 4HPYL 1JN6A 4XCEA 3OAZH 3BIKB 2P47B 4PV8B 1NL0L 4F7TA 4HKBB 3QEGH 2P8LB 4F80A 4H1LG 4GS7B 2HFGL 2OQJB 1K8DA 3R4DA 3IGAA 4U6VH 3RPKA 4GO6B 4LLVA 2VZUA 3FRPA 4P2RB 3C60A 4PJFB 3OX8B 5FUCC 3HUJE 4XI5D 3SQBA 3UJTH 2JJUA 4G80B 2DJUA 3MJ8A 1IGIH 1QYGH 5KS9A 1JGEA 1EO8H 5GGRA 3JV4A 3KXFB 5J8OA 5C0CE 1Z2KA 3MLSL 4WO4D 4WW1B 3FN0H 4C83B 4E0RB 1Q1JH 3LKRB 1OAUL 5KOMC 1OL0A 3D39B 5E70A 1I8IB 4PJCE 1IGFH 2HLFC 5J12B 1CFVL 3I6GA 2AV1A 1YJDC 5E9DD 5K9KB 1MFDL 5JMOC 2VAAB 2VZ3A 3S34L 4POYA 1UB5B 4P23C 2XWTA 4JO2L 1VFBA 3PQYE 2CUHA 4NO0B 1K4DA 4WU5A 1IL1A 4I77L 3IU4H 1E4XI 4JCLA 2D9CA 5DRXA 2EH8L 5DJ2B 1WSST 2CKBA 4XCYB 5HYJB 1C1EH 1YEFL 1NCDH 3UO1L 5J56B 3BFOA 3F8UB 1ERNA 4JVPA 5C0CD 3RWIA 4OQ1A 4Q97A 2MKLC 2XOTA 1G6RH 4G6JL 1T1WB 3CAFA 4OF0A 4Q9QL 4YHLL 4MCZA 4EJ1C 4CBPA 2EC9T 3WLWC 1BD2B 3ULUC 1MCPH 2DQGL 2P45B 4RGNB 3W9DB 3BE1H 3PQYD 1XR9A 4XHQA 1GAFH 2X4UA 1A7OL 4KGJA 3ARBB 3DVGA 3QIBA 3HLAB 5BJTB 1F6LL 2V2WB 2MHAA 4YDLB 2D7MA 4YFEA 4IRJB 3C8KB 1S9YA 5TDNA 1F11B 3K2MC 2VLRD 4UIMB 4X8XA 4L3EE 3KPSB 3MA9L 5CLWA 2OL3A 1KCUL 3I3EA 3ULVC 2Y07H 1U95A 4G5ZH 5D1ZC 2KBGA 3ZYIA 1T0MB 5JORA 1QUNA 4EXKA 4WUUA 3GFUA 4UAOC 5IBLC 2FEEI 3RU8H 4JR9H 4PR5A 3GGWA 3RVUC 1MIMH 1HIML 3C9NB 3JWDC 1YMMA 4C57C 4U1NB 1CR9L 2AEWA 4K94H 4O2CB 1U8QB 4TPRH 4QHNB 3BH9A 2X4OB 3GSUA 4L4TE 4ZUTA 1PLGL 1AXSA 5J11B 5EO9B 1S9VA 3O8XB 2P24A 3TO4B 3W5NA 3B9KD 1DL7H 4RAVB 3WFEH 1U0QA 2QSVA 1U91B 2FX7L 3ARGC 1IGTA 2DLTA 1E27B 5FYLD 3QZWB 3VMPA 4CGTA 4L9LC 4WI2A 2VXVH 4X6DF 6FABH 4U1MB 5KSBA 4R4ND 1KCVH 3D5OF 4OBSA 1FYHB 5EU6E 3CCHB 4PLKD 1GYAA 1A3LH 4WFEE 15C8L 2OSLB 2F5BL 2AJXL 2H2SC 4MAYC 4WJ5A 1P4IL 3D25B 4TRPH 2HVKB 4GSDL 4LAQL 1KELL 4XBPB 5CILL 5HHNA 3QI9B 5GRVL 2JIXA 3KPMA 1BGXH 5K59F 1CYGA 4JM4L 1CZ8L 2DLIA 5FO7B 3LKQA 1ZT7B 1PZ5A 5DVKA 2YRPA 1FP5A 4PB0L 5EUOB 3RWFB 1MJJA 1AQDB 5H94B 2AGJL 2Z93A 4KK9D 1D5IH 4R97B 5SX4I 3DRTA 2HKHH 1NMAH 4QTHA 3OMZA 5IOPB 4M93C 4PRHA 2R2BA 2HH0L 2CDEB 1WT5A 3D69A 1A9BA 4Z7OF 1H5BB 3GKWL 5HHXH 2HJFB 3RX5A 1A7PH 2H6PB 5C0EA 2A77H 5A2IH 1KJVA 3QIBD 5GGQH 1RZIA 3RDTD 1G7QB 2YPKA 4XCNB 1XR8A 5D1XB 5BMFH 4HXBH 3DLQR 3VFWB 1WBYA 4XXDA 3ARSA 2YEZA 3BQUC 3QIWB 4RQQB 4KJQC 4YDIH 1XZ0A 2J5LB 3BZFB 1HKLH 2Z31B 2AI0H 2NXZB 1BWMA 3O0RH 1QTYT 5EO1B 4WUUD 4OGYL 1ADQA 1IC5H 1DSFH 3F65A 3HI6L 3LN4B 1YMMD 5CZXC 2EKJA 3L6FB 5ICYB 1D3CA 5DK0A 1QSEA 1REIA 5KVEH 3SKNA 4UNTA 1D5ZA 3WFZA 4N9GB 2ORBH 5J6GB 2NR6D 3MRRB 4JFFE 4NQUA 1FLRH 5FIEA 3X3GH 2V7HB 3RNQB 2J8UF 4PRID 4YAQA 4Z7NF 4WNQB 4UZGA 3FT2A 3WFBH 3I9GL 25C8H 1J11A 1OAYL 4PG9A 4PRPA 4EUPA 5ESVB 3U9PH 2DMKA 5SWZD 2EKSA 3GBML 4NBZB 3DO3A 4YO0A 4IJ3C 1QPXA 3V4UL 2M2DA 2DBLH 1KIRA 4QRRB 4PRBA 3QJFA 3VRJB 2DIBA 1WC7B 3W0WA 3BGFB 5DEFB 4MNQE 1HILB 3MBEC 5J1AB 4DN3L 4ZUSA 3WNLA 3ZT7A 3C5JA 5EC1A 1BEYL 5F9WB 5EU5A 4YK4C 2A0LD 3R8BB 3S35H 3UPAA 1XCQA 4NO2B 4YDVB 4HLZH 3OKLA 4YZFE 4KKCC 2CK2A 2H8PA 4MHHI 5CGYC 3BJ91 3QCUH 3TT1L 4XRCB 4XPTH 3JTSB 2GIYA 1HXMA 4MD0A 5IGXH 1NEZB 1YUHA 2CXGA 4TNWF 5C08A 5F9JA 2RR3A 4JKKA 2CUMA 3QYCA 3HE7D 2ADJB 1G0DA 2X1PA 3OAUL 4MJIB 1J8KA 4U3XA 5IB2B 3DI2B 3QFDB 3TPKA 1IAII 4UT9H 3WIFB 2IH3A 3IDMA 2OMBA 3LEXB 3GJFB 1G7LB 3L9RB 3TWCH 2GSIA 4NQXB 4OLVL 2ILLA 4X0KA 2DMBA 3O9WB 2B0SH 3G04B 1MI5D 4HC1L 5HJ3B 4OGAD 4HS8H 4OZGB 1K85A 3MLXH 2B2XL 1T4KB 2XTLA 3JWOL 2QQLH 4HCRL 1C12A 3T1FA 4NNXA 4L8SC 1JGDA 4XCFL 2BDNL 3DX7B 3KNBB 4G9FE 4P0DA 2DQIL 3SKOB 2CSPA 4EN3B 4K2UL 5BV7B 4O51B 1AE6H 5JO5A 2R0KH 4P46D 2XQBL 1CL7L 2EDRA 4N1HB 3VFRB 3RL2B 4WV1B 1QOKA 2Q87A 4X7SH 5JXEC 1KTLB 3UTSE 1LO2H 3AREC 5GS0H 3P2TA 4N8CL 1YEHL 3TBSA 3O6MH 3OKMB 1SEQH 5J7CC 2R1WB 5IQ9B 1T2QH 4OCMC 1HEZA 4PJIE 5HI5D 1MWAH 1U36A 3B5HA 3QDJE 4PJ5E 1QHOA 4XP9L 1UM6H 5DMIL 5EC2A 2FNBA 5F9DC 2YXMA 3IFOA 1CD8A 2IPUK 3QXDA 5LXGL 2FO4A 3X13B 5ITFA 4L8DB 1MCOL 3VD7A 4F3FA 1Z6JT 5D2LB 4ODWA 2APWA 5CUSL 4U1HA 2LVEA 5I1DB 3O3EA 3O41B 4S10A 4UV4H 3ZE1E 2FZ3B 5LGHH 4JAMB 4JQIL 3PIQB 1F8TL 3PE9A 4K9EC 4FTVA 5E2VL 1ZLWK 3LH2H 1AXTL 5C0FA 4DUXA 1G9ML 5D70H 1FZJB 3SDXF 2HG5B 1LO0H 3ARXA 1F4YL 4W6YB 4LFHD 4LLWA 5C70A 4PJ5D 4Z7UF 3MLZH 2OXGA 4NHUB 3G5ZA 1HNGA 2G75B 4NRZB 3Q6GL 3BYTA 3QEHB 1R0AL 5DMKA 1UZ6F 2VLKE 4LMQI 2ZUTA 3QXAB 4XNUL 4DAGL 1RU9L 1JF5A 1TPXB 5CWSB 5TPWH 4TUJA 3CVHB 3OKNA 1Y18B 4UT7L 1DDHA 4NM4L 3QEQB 5C0DA 1IQWH 1E4XL 1N4XH 3VXPB 4UINH 5EO0A 1FE8L 4YEEA 1HZHL 2NY5C 3UYPA 3HPJA 5CJBA 3RY6C 2ZWLT 2ATPB 4F8QA 4TNWK 2X4TA 3MRBA 2EYSB 4O2FA 2FH6A 5FUZL 3ILQC 4QF1A 1Z5LA 4Z7OE 2CK0L 3N1MC 1S9XA 1EVUA 4RX4A 4NKIH 2ESVA 2FJFA 4NQTA 1NBZA 3GSOB 3TGXA 1UXWA 4Y88A 5D7JA 2H32H 3SGKC 2CUIA 4ODHH 2C1OB 2FHBA 3PWVA 2FYYA 2A9MH 1LVEA 1I3GL 4N90E 1NMBH 4NQCE 5ERWB 2QADD 5SX5K 5C2BL 1OT2A 5IROA 4M7LH 3G08B 1RJZA 2ID5A 4MGXA 5E1AA 3MPCA 2FX9H 3GSWA 1FFPB 4FHBD 3CUPB 4QRPA 5DVOA 3V7MA 1YY9D 2ARJA 4FXGA 4Z77B 1HHKA 2FEEL 4XNZC 4ZG1A 1JPSL 1XF4B 5BS0A 1KPRB 1BBDH 4MWFA 2VERN 5DGQA 1WIUA 1T1YA 5F3BB 4N0UA 2YD5A 4H26B 3EYOA 4HIEA 2XPGA 3MJ7B 3UBXG 4LP4A 2ZOLB 5ANMA 5MP6L 3CLEL 4OKDA 3K4DA 1A2YB 4J3VA 5JTWA 4ZXBC 1ZA6B 3SE3A 3OTTA 1D6EB 1DQJA 3MA7B 4OGXH 4UUJA 2UWEA 4OI9A 5HYSB 3GMNB 1FL6A 1TFHA 2ZOKA 4Y19D 1YY8B 1LEGB 2O5XH 3FAWA 3HS0A 2BJML 5FECA 5K9OA 1NLDL 2CLZB 5CBEA 4Y5VB 5HD8C 2FJHA 5E2TH 4NCC2 1KJ2L 5JOEA 4RMUA 5E24E 4JHWH 2ZUYA 1D5XB 1V7NL 5IMOA 5DI8B 3NFSH 1QRNA 4DCQB 2YC1A 4OZHE 4X8JB 5HHPB 3CFCH 1FCCA 2MTPA 3T3ME 4MJ5B 1RMFH 1WCBB 4YHZH 1HH6A 3BDBA 3DGGA 4E42A 3EDFA 1IAKA 2Q8BL 2IPUG 3KS0J 4WW2A 1VERA 3QEUA 3INUL 4PJHA 4ZTPL 3U83A 1QSFB 5DZNA 5F7DA 3L5HA 1A47A 3K1KC 3VXQB 5I8KL 3WKMH 2DQHL 2E3VA 3KYMA 5SWSB 1DBML 1FGVL 3NCMA 4KHTH 3OR7A 3RX8A 1RIVL 4JJ5B 1KB5L 2YK1L 4EUPH 3BD4A 3BIKA 3VRIB 1F3JB 4G6AD 4PV8A 4HKBA 2P8LA 2RCSL 4PFEA 1QLRB 5DK3A 2HTLD 2OQJA 1ZAGA 4RX4D 4G6KH 2PYEE 5DD1H 3EO0B 4ZFGL 5EIVA 1BJMA 2BSED 4LVOB 4PJFA 5DRWB 3OX8A 4M6MH 4G80A 1XMWA 1DP0A 3DURB 3MXWH 5DJYB 3EGSB 2E7BA 1KCRL 3KXFA 1WJ3A 4K8RH 3FN9A 3RVWD 2E7LA 4E0RA 4WW1A 5BZWB 3ES6B 3MJ6A 3LKRA 1MUJA 4C83A 3D39A 1TTFA 3MUZ1 1N8ZB 2GTWB 1I8IA 4TQEH 5T3XD 1XEDA 1RPQA 3GI8H 1KB5B 1A14H 4PD4J 4HIXL 3BGAA 2VAAA 4OI7A 1UB5A 1U3ZA 4QRTB 2VC2L 3BWUC 3EYQC 3STZB 4KUCF 2NY6B 1VB9A 4GW5B 4NN6C 3IFLH 1X6NA 5C3LD 2B39A 5CJQH 2R56H 5DJ2A 1NDGA 3JV6B 5GJTL 5J3HC 1EX0A 5HYJA 3T4YB 4HWBL 3B8YA 2DDQH 4JM2D 4TULL 3WSQH 3IDYC 3CLFL 4MXQD 5L7XL 1E6JL 4GG6F 1RZ8B 4FZEL 1T1WA 2EIDA 1UCTA 3HG1E 3Q48A 3BEWB 5I18L 5LWYH 3SE8L 4GJTB 4I2XE 3U4AA 5DA0B 3MMEB 4HUXB 1BD2A 1JTTA 1PW3A 4Z0XB 2Y36L 3W9DA 3ZYJA 3ARBA 3BN3B 5JR1L 3HLAA 4XVJH 5BJTA 2V2WA 4HF5L 4IRJA 4XWOC 1A0QH 1MJUL 1Y6KR 5TQ2L 2PW2B 3C8KA 3SDXE 2IFGA 1F11A 5E95B 4ORGB 1CIUA 1H3PH 4UIMA 5DD3H 2IFFL 3F5WA 3OSKA 4Z7UE 1D5BB 2Q8AL 4GRWB 2VR4A 2KZ1B 5IWLC 4I4WB 3BAEL 5GS3A 1T0MA 3V2AR 5DO2D 1KTDB 4BZ2L 4Z7WE 3E8UH 5IW3A 4KY1H 3C9NA 4CKVX 4U1NA 3B9EA 4O2CA 4FXKB 3G6AB 1WK0A 5D7IB 1IAIL 4QHNA 4D9RE 2VISA 2FBOJ 4UQ2B 2ZCHL 1D7FA 2COQA 2VYRE 5DF0A 1EHLH 5EO9A 3O8XA 3TO4A 1I1AC 2VDKH 3DPBA 4G6MH 3T0EB 1P9MC 4HUUB 4G42B 4RAVA 4TVPD 4HJJL 4MCYB 1U91A 1A5FH 1E27A 3EOAB 5KOVC 2R15A 3ARVA 3QZWA 3OZ9L 3NIFE 3ULUH 4KROC 1B2WH 4DKDC 4U1MA 1LDPH 1DFBH 2VQTA 3U82B 5SV4A 3MV9B 2FIKB 3CCHA 1RK1B 1RFDL 4LGRB 5B21A 2OSLA 4NP4L 4R0LB 5EOQH 3D25A 2HVKA 4XBPA 2X89A 5D71L 3QI9A 2NY7H 5DHYB 3T4AB 4YHIB 5B38B 4RISH 4APQB 1YNTB 4JPWL 1IAMA 2FRGP 4NNPL 1A4JA 1JFQL 1ZXQA 4HBQA 2YPVH 5EUOA 3RWFA 1AQDA 3FCTB 5H94A 1F90H 3DOSA 3JWDH 3N9GH 3MUY1 1C16B 4PGCB 5IOPA 4PJGA 1FSKC 4OLYH 4LSSL 2BSTB 3M8OH 1U3HD 2CDEA 4LIQH 3RVVD 2R0ZL 2UUDH 1H5BA 2C26A 2FD6H 2HJFA 4O9HH 4RFNC 2H6PA 2WUCL 2R0WL 1FPTH 3LS4L 3BZEB 3L7EB 3H9SB 2BRQA 1N7MH 1G7QA 2VZTA 4HIIB 3Q5TA 4XCNA 4DGVL 5L8JB 4FQ1L 1J8HB 5GS2H 3VFWA 3EJYD 4H20H 2DM3A 4H25B 3RTQD 3QIWA 2R9HC 4RQQA 5GS1C 2UZIH 1U8HB 2GFBB 3BZFA 2ZKHL 4WY7H 4C4KT 5DQDH 3STBA 2Z31A 1FN4A 1FHGA 4M4RA 5EO1A 1MJ8H 3WYRA 2RHEA 4R2GD 1MHPL 3HA0A 2QQKH 3P30H 5D2NE 3ZSSA 1ITBB 4PS4H 3LN4A 3C2AL 3L6FA 5ICYA 5DJCB 4OCRH 4N9GA 5J6GA 1AQKL 4GW1B 1IGML 4CAGA 1GGCH 4DOHB 4WCYL 4XX1E 2V7HA 3KJ4B 3RNQA 4PJXF 4G7YH 3NA9H 5ELIA 1NGWB 4WNQA 2Y6SC 1X4XA 3IDGB 2GITB 3OB0H 3L5XH 3C2SA 3OWEA 5ESVA 2F54D 4OCSL 5JMRA 5KZCD 1U93A 3HNSL 4FQHB 3AAZB 2WINB 4HKXB 4KV5F 1FG2B 4YBQC 2XZCH 2XWJB 1YZZA 2ZP0T 3TZVC 4QRRA 5CEZH 2X6MA 2ERJC 5KS9F 3VRJA 2O26U 5CHNB 1WC7A 3S88L 4HT1H 3QULB 5JW3L 1HILA 4YHPB 3GO1H 2GJ6D 5IBTH 1DANU 1A6WL 4KXZI 1QKZH 4NO2A 1QVOB 1BLNB 3UROR 2BNQD 2LQRA 4S1SH 4RMQA 4GRLD 5HYEA 2JB5L 4XMPH 4XRCA 1MCWM 3CXDL 3JTSA 1IM9B 1KGCD 4LSUL 1NEZA 4NZUL 3BPOC 1IEHA 3V52H 2B1HL 3D0VA 1XCTB 2ADJA 1P1ZB 1INDH 3AB0C 4MJIA 5IB2A 3SDAB 3QFDA 1KENH 4JDZB 5CS7A 3X11B 4MS8D 3B5TA 4XX1G 3WIFA 4UAOB 3LEXA 3VU2A 4GBXB 1YYLH 3GJFA 1G7LA 1ZVSA 3L9RA 4NQXA 3RPIB 2ICCA 3LQAC 3O9WA 3WUWG 4J6RH 3G04A 5HJ3A 4PJ8C 5GZNC 3V8OA 1T4KA 3HMXH 2WUBL 5I71B 1LEIA 1J0KA 1E4KA 1JGLH 1X5HA 3HZYB 1DJSA 32C2B 2CDGB 3BUTA 4NZTH 3HNVL 2D0FA 4NZJA 4OSUH 4H8WL 2XICA 4EN3A 1JK8B 2A9NL 1CGVA 4O51A 5I1EL 1H15B 3ARGB 3EYFB 4BFBD 5FGBC 4FQJH 3VFRA 3RL2A 1HHHB 4L9LB 2CKNA 5TE7H 4HPYH 2HYMA 4M7JL 4WV1A 1IBGL 4FXLA 1KTLA 4HQQL 1NL0H 1FJ1B 3OKMA 2HFGH 4J8RA 3QHZH 2IJ0C 3QPQD 2R1WA 4NQDB 5IQ9A 2C3WA 1BFTA 1V3MA 1JTPA 2V5SA 3E2HC 3MGTB 1RZKC 4HC1A 1EA9C 4KI5F 4F2MB 4X5WB 2UY6A 1CQYA 1JRHL 2NW2B 5DHXB 1AP2B 4JY6B 2HMIC 1OD9A 5I8EB 2KQNA 4OIIL 4RZCB 4LPXA 1FNGB 3MLSH 3K8LA 1VESA 3X13A 4L8DA 1OAUH 1FZMB 2VO5A 4HH9B 3MV8E 4BQ9A 5D2LA 2RFXB 4FQXD 2YSSB 1Q9LB 4R8WL 4I9WE 1V3JA 3KHOA 5I1DA 3O41A 3DVNB 3S34H 4JAMA 4U6XB 2CLRA 3PIQA 1Y6NR 4BK5A 1BOYA 1MAKA 4Y4HD 4JN2B 5LAXB 3NFPB 5TH2B 2NZ9C 1WV7T 4LLUB 4ZMAT 4I77H 1I7UB 2BVOB 5KSBF 1FZJA 2HRPH 2VLJD 3B3IB 2O5ZL 4OCYH 4U6TA 2HG5A 5T5NG 4F57L 2X4PB 3NCYS 4X4YB 2EH8H 4XB8A 5T1LB 2YUVA 4R7DB 1N2RB 4NHUA 4PJ9B 1YEFH 1UJ3B 4NRZA 4XNQB 1F2XK 3QDME 5F21B 4MJID 3QEHA 5D5MB 4G6JH 3NMEA 3H9YA 5FAAA 5L2KB 2LAAA 1VHPA 3QXAA 5K93A 4Q9QH 1PKQB 4YHLH 2R23B 4I9WD 2EDYA 5CWSA 3CVHA 5IVZB 1Y18A 2H1PL 2DQGH 1MFBL 3NFNB 1UM5H 4I3RL 3VXPA 1IM3B 1I85C 1A7OH 5FGRA 2NZIA 3WKNA 4N0RA 3DV6B 3L1OL 1NC4B 3E6FB 1E28B 1S5HB 4YGAB 4JHZA 1KJ3L 1ACYL 3MA9H 1TZIA 4PP2B 4X7FC 3HR6A 1KCUH 1WFNA 3KPRD 4ODBD 4YGVB 4XMKL 3QDMD 2EYSA 3ZHDA 4S11A 3S8WA 5GISH 1EHXA 3BDYL 3X14B 1TQCC 3AC0A 3RUGE 1VA9A 3JVGA 1OTUC 1X5AA 1YA5A 3KHQA 3GSOA 1HIMH 2PF6A 3EBAA 3X12B 4ZUVB 1CR9H 3S36X 1PLGH 2C1OA 4BSVB 1JI1A 2EXWC 1NC2D 4M5YL 3C6LB 5ERWA 4YK4B 3FZUC 3CK0L 4HMCA 4PG2C 3S96B 4JZJC 4WTWA 4Y7MA 4ZNEA 1FFPA 3CUPA 4ZDHB 1BPVA 3TA3C 4Z77A 2HT4C 2P8PB 1XF4A 3AS3A 1KPRA 3FQRB 5F3BA 2D7PA 5IQ7L 2EDJA 4H26A 2HWZL 4NKDB 2J4WL 5ACLA 1JYWA 1M7XA 3MJ7A 2FWOB 2F5BH 2ZOLA 2APFA 3SQOL 2AJXH 43C9B 1P4IH 1A2YA 4LAQH 1KELH 1ZA6A 3SO3C 4FG6D 1D6EA 2HTKD 2V2TB 2K7PA 5GZOC 3MA7A 5HYSA 3W39B 3GMNA 3DUSB 4JM4H 2KUTA 3VMOA 1CZ8H 1YY8A 1LEGA 5DUPH 2JK5B 3TJEL 3VXRA 5EIIB 5HI3D 2CLZA 4Y5VA 1T5WB 4PB0H 3TT3H 1D5XA 4KV5E 2AGJH 1JNHB 1S7TB 3GK8H 3GUTB 5DI8A 1CF8L 4L8SB 4Q7DA 4DCQA 3EOTL 2M26A 3PGCA 5D1QB 4X4MA 3TYFB 4KMTH 5HHPA 2I9LB 2BVPB 4MJ5A 1WCBA 1EZVY 2VDPL 3O3DA 1NGQL 3GKWH 1WUNT 3UAJD 1JF1B 1QFOA 4ALAL 4MDJB 4D9LL 4ACPA 4XHJD 1QSFA 4YPGB 1BVKB 1H9VA 3VXQA 4N9OB 5EBLB 5EOCL 2X41A 2E7CA 3MLVL 2FGWL 2YKLL 3A67L 5L0QB 2Q7YB 1MCIA 3PHOB 4ZNCD 4JJ5A 4MXVF 4KFZC 3BESR 4JGUA 4RNRA 3VRIA 1F3JA 1S3KL 1N6UA 3KWWB 2G9HB 1QLRA 3JV0A 1JZ3A 3BD5A 5KVDL 5L8KB 3EO0A 2H3NB 1YPZB 3HI6H 3MODL 1AGDB 4XI5C 5DRWA 4KZEL 1G7HB 3DURA 5DJYA 1X5IA 4RIRB 4WO4C 1D6VL 1CGYA 4RCAA 2NY4D 3G5VB 5BZWA 3ES6A 3HAEB 3A6OA 1OAZH 1N8ZA 2GTWA 4IDLA 3DX9B 3WFDL 2NY5L 3NIDE 3I9GH 4RWYL 1KB5A 1OAYH 3LD8B 4WI7A 4QOKB 2XV6B 2BSSB 2LU4A 3LKOB 5J0BA 3IFNL 4QRTA 3GBMH 4C56B 3STZA 2EO9A 3V4UH 1QD0A 1QFUL 1RV6X 5TFSL 1F6FB 5K9QG 4LEXL 1SJEB 1ZHBB 5F1SA 1N6QL 4DN3H 4QHKJ 3BKML 2O61B 1QSVA 2V5YA 4LNRB 1BEYH 2CRIA 3ECBB 3WIIH 3VXRD 4LLQB 1DVFD 1DZBA 3MGAA 1I3VA 2WBKA 1ZEAL 1RZ8A 5IB3B 3QDAA 3BEWA 4JREC 4EZMA 4P5TD 4BQ6A 3BW9B 5KTEL 1FVEB 4AH2B 3OV6A 2PXYB 2FGZA 5IIEB 3MMEA 3OAYH 5CCKL 5FK9B 1B9ZA 5DVLA 4MB5A 1PEZA 5T3ZL 4HUXA 4JGMA 4MQ7B 1QBAA 1ZLVK 3BZDA 3OAUH 4MB4A 4V2BA 4LCWD 1MCRA 2X70A 4M9OA 3NH7H 5MHSE 1S7WA 2PW2A 1TVBA 4OLVH 1P84J 4OFPA 1DBKL 3TVMD 3O6FD 5E6ID 4BQ8A 3ARWA 5CIPH 4JRXB 3NTCH 4N5ED 3H7BB 2B2XH 4HWZB 1KV3A 4X5LA 5GRWA 1D5BA 5HYIA 3JWOH 2F53B 2W9DL 4HCRH 4I4WA 1QFWM 4NN5C 2EXYC 1KTDA 2IG2H 2VOTA 1SHMA 1MFAH 2XN9B 4LCUB 3RY4A 3BVNB 4XCFH 2BDNH 3PABB 3NABL 4NJAH 3GNML 1NAML 2DQIH 1T6VN 2CJUL 4K2UH 3BPNB 4P9ML 4KRPB 3SCMC 3DVFA 4GUPB 5BW7C 2XQBH 3G6AA 5D7IA 1CL7H 4AIOA 1BVLB 4UQ2A 3ARDC 2IPTH 3B9KC 1AO7B 4XNZB 3U46B 5E99L 4HUUA 4G42A 2UV3A 3Q1SL 3BJLA 1YEHH 3O4LB 2VH5L 4PLJC 5EN2B 4MCYA 4PRHE 2DQUH 3QRGL 5HDLA 5MHSD 4OUOA 5CGTA 3EOAA 3IS0X 1F4AA 2R8SL 5D7LB 4R4NC 4ZXBB 3TCLB 1M7DB 2IMMA 5H2BA 4XP9H 3Q0HA 5DMIH 2GI7A 1XIWD 3EJZD 4WI3A 3MV9A 4PRNB 2FIKA 1RK1A 3VH8G 4BK4A 5BVPH 2QTEA 4R0LA 1MCOH 4DQOL 1JMXA 5CUSH 5DHYA 3DV4A 3REWB 2C4FT 3T4AA 4YHIA 1DQQB 5B38A 4APQA 1YNTA 2BVTA 2JB6B 2BP3A 4GKOA 3QSKB 1G1CA 4JQIH 1F8TH 2NNAB 1EPFA 5E2VH 4RFEB 1AXTH 3BPCB 3FONB 4KK9C 1G9MH 2AJZB 1I8MB 3S4SB 1C16A 2Q76B 1QSEE 1F4YH 1Y6MR 4PGCA 5JHDE 3SJVB 4MXWH 4LRNL 3RZCA 2BSTA 1VPOL 2XFXB 1QFWH 2K1MA 4HGMA 5FA3B 3Q6GH 4G8EB 1NCNA 1J1PL 1EIBA 2WZPD 1HHGA 2UWEF 3BZEA 4X6DB 3L7FB 3L7EA 4PTTB 1UKQA 4TVSa 4XNUH 3FHAA 4HIIA 4DAGH 1J8HA 1W0YT 1FYTB 4YDKL 2NQCA 2HJKB 3UTTD 1A4KB 4H25A 4UT7H 4NM4H 2W60B 1U8HA 1E4XH 2GFBA 5L6YL 5IEKB 2LAGB 4N5UA 2ZJSH 3NAAL 1FE8H 1WFUA 4OUUB 1HZHH 2Y23A 3W0WE 5C09E 1Z9MA 3VXSE 5GGVL 5JHDD 2AQ1A 3MJGX 5F7FA 4WWKD 5HDBE 3WIHH 2IAND 2JJTC 4PJHF 3FN3A 2NR6C 3WNPA 1P53A 5FUZH 4LDEB 5CINL 1F3RB 1B90A 4GW1A 1RZFL 2CK0H 3Q5YA 3MRDB 1A9EB 2XTJB 4AG4L 3KPQB 5C08E 3VD4A 3NACH 3K7UA 1NGWA 4NN6B 2J12B 3HHRB 1YC8A 3V4VL 2X05A 2GITA 1KXTB 2OJZL 4JRYA 1GJIA 5F7EL 4IIQC 1W72L 2NY1B 4MXVE 4BSWA 1UWXK 4FQHA 2D9QB 3QR2A 2WINA 5C2BH 4HKXA 4PJFF 3FT3B 2DICA 5C09D 3VWJD 3VXSD 2XWJA 3RVTC 4EUPG 3LRHA 4JO3L 1AKJB 1ZHLB 4X98B 5CHNA 5DRZB 4U2YA 4JKPH 2E7HA 4YHPA 3EIFA 2HVJB 1NLBH 4LLDB 1MQ8A 5EULV 1QVOA 1BLNA 2WAHA 1MVFA 3MQIA 5MP6H 4XC1L 4HS3A 5F44A 3QO0B 3T3PF 1GGUA 3JV5A 5I6XC 1X6LA 1IM9A 2E8ZA 4Y16D 1F4XH 4L4VE 4U0RB 1GIGL 1IC4L 2KL6A 3U4EB 3RZCD 1XCTA 4NFBA 3S3JA 2BJMH 1P1ZA 1MCFA 1NLDH 1OGAB 3ZHLA 1MSPA 1MCDA 1OD7A 3SDAA 2B4CC 1EUTA 1I9EA 1KJ2H 4XAWH 3JWNC 4JDZA 2QR0B 3X11A 2XQYK 4GBXA 5I8OL 1GPOH 3RPIA 4F58L 2PCPA 5B39B 4PV9B 2DMCA 2HKFL 3C08L 3P0VL 1V05A 5HHME 4A6YL 3LMJL 1QEWB 4ZYKB 3RWGB 1RZJL 3HZYA 2XACC 2Q8BH 3RQ3A 4F7CB 32C2A 4BUGA 5HSFA 1Z9SA 4JFZL 2CDGA 1ONQB 1KN2L 4POUB 2DQHH 1JK8A 3FOMB 1H15A 3ARGA 3QO1B 3EYFA 1U41A 1DBMH 3FQNB 1FGVH 3LN5B 1VSCA 2HP4A 3VFTB 1RIVH 3IDXL 5GGSB 4BM7A 3K74B 4HK3N 1IZJA 1HHHA 4FTVE 4L9LA 2HLFD 1QRKA 3RI5F 4LAJH 5F6IC 3O4OC 1FJ1A 4P23D 5DC4B 4NQDA 2OX5A 1GZQB 4KVNL 2B5IC 3IJYB 4ZFGH 5HI5C 3I50L 1B0RB 2XZAL 4F2MA 4CU7A 4X5WA 2NW2A 4JRYD 1AP2A 3H3PH 4O58L 4G8IB 4K7PY 5I8EA 3U0WH 1O7VA 1KCRH 4RZCA 3D3VB 3GHEL 4J3OC 1FNGA 1Q0YL 3CMOL 1LO5B 1CXFA 1FZMA 4HH9A 4R26L 1Z3GL 3A0OA 1MCQA 1AJ7L 2RFXA 4EQ2A 2YSSA 4AIXA 2N1KA 2W65B 4WRLA 3QFJB 2EEBA 4HIXH 1RSFA 1IAIM 3DVNA 1AHWC 2BNUB 2IMNA 5C0NC 3NCYP 2VC2H 4U6HB 1LEKB 5KW9L 4JN2A 4IRSB 1IKFL 1V8HA 4P5MB 4Z0BL 3ULUD 5LAXA 5DMYA 3NFPA 5CD5C 5TH2A 4LLUA 3ZKXB 1CFQB 2BVOA 4LIQE 1MPAL 3B3IA 1YYMH 3VGHA 5KVGL 5DHVB 4Z76B 2X4PA 4KRLB 2JTDA 2OP4L 3MUHL 4X4YA 1C08B 4TNVF 1G1YA 5T1LA 1N2RA 4PJ9A 4K3EH 2DWEB 1UJ3A 4HWBH 4D0DA 4TULH 4XNQA 4GRWH 3CLFH 5L7XH 4KK6D 4LP5A 3ULVD 5L2KA 5D1ZD 1CS6A 5AWNL 4FZEH 2P42B 1RZKH 4IS6B 3SE8H 3DROB 1G7JB 1UGNA 4YFLF 1PKQA 5CD3B 2R23A 3D2UD 3GSVA 2GK0B 3JBG7 5IVZA 5EU3B 3KPNB 5EUOF 3RVUD 1A6ZB 4P59L 4IDJL 2E6QA 3NFNA 2Y36H 2XI9A 2YZ8A 4D8PB 1IM3A 1EJOH 5C7XH 5JR1H 4PJGF 3DV6A 4QRPE 4HF5H 3VXMD 1NC4A 3E6FA 1E28A 1S5HA 4M48L 3S5LB 1MJUH 4X6CB 3VGGA 5TQ2H 5BS0E 2JCCF 1FAKT 4N0UE 3ARGD 3JSSA 4PP2A 2IFFH 1MEXL 4UTBL 1P7QB 4YGVA 3CH1B 4JFEB 2Q8AH 4NO3B 5ANME 4JN1L 4OV5B 3F62A 5GS2D 5MENE 2GJZB 4BZ2H 1WIPA 1X5XA 2ADFL 3DJ9A 2UWEE 3FRUB 3LAFA 5F93C 4NQDD 3X12A 2C4FU 4ZUVA 1AFVH 5F9AC 5FYJH 4XVSL 3KPOB 3ZLQC 2ERJB 4MAYD 4AEIL 2R1YB 5M7QA 2ZCHH 1RUQL 4BSVA 4JFXB 4DK6A 2QADC 3N1FC 2VDLL 4LBEA 5CEZE 1J87A 1QRNE 3C6LA 3VFNB 4RRPA 4HJJH 2VN4A 1XF3B 3S96A 1CXEA 4ZDHA 3OZ9H 1YDPA 2E9JA 1AI1H 4NZDA 4QLRA 1F00I 4XMLH 4QHMB 2P8PA 1MCCA 3QIUC 3FQRA 3SO5A 4GKSB 3BPOB 3ZE2E 4NKDA 2WWKT 1AC0A 5MEND 3P3YA 3RI5K 1KIPB 2PW1B 4NP4H 2FWOA 3C09C 5BO1L 2IPKB 2G60L 4FFYL 1YECL 43C9A 4HHAB 3IF1B 3QXTA 3OXSB 2ZSWB 2V2TA 5HHOB 3L3OB 4JPWH 4U7SA 5E00B 3W39A 3DUSA 4OLUL 2CMRL 4NNPH 1JZ7A 2WW8A 1JFQH 3TEUA 4BQCA 4PJ8B 5EIIA 1OAXL 3BQUD 4GMSL 1T5WA 4KJQD 1DR9A 1JNHA 1S7TA 4P2RE 4PJFE 3GUTA 4L8SA 1EFXD 3U7WL 4N0YL 5JNYB 3KPLB 1KTRL 3QDGD 1D9KD 5D1QA 3TYFA 3BIAX 1C7SA 4LSSH 2I9LA 2BVPA 4PREB 3E6HB 3KXFE 1TNNA 1SBBA 2R0ZH 5GGUB 5C9KA 2FBJH 4KDWA 5CZXD 5CEYA 3D39E 4HKZB 2WUCH 3H3BC 4PJBF 3RP1A 2R0WH 3QUYD 4MDJA 3LS4H 5FHBL 2NMSA 4YPGA 1BVKA 4DGVH 3BN9C 3T3PE 4FQ1H 1A3RL 5EBLA 2KQMA 2KZWA 2OTUB 1R3IL 5BCAA 1MVUA 2B1AL 2Q7YA 3PHOA 2FR4B 4TNVK 3ROOA 2ZKHH 1WLHA 3KWWA 1YN7B 2G9HA 3AXLB 2CO7B 5LG1A 1MHPH 2H3NA 1YPZA 4JFHD 5HYJE 3C2AH 4M1GH 3CIQA 3PGDB 5D72L 4LSVH 5GRJL 3S37H 5ABDE 1G7HA 5LBSL 2E9WA 1KPUB 5ENWB 2GCYB 4I0PD 4OZ4B 3MBED 1AQKH 1TETL 4RIRA 1ORQB 1IGMH 1GXEA 3G5VA 2ZG3A 4LPVA 1EVTC 4NRYB 4JO4H 2EDTA 5ACZB 1S7UB 1BD2E 1HH9B 4YHOL 3DX9A 4NZRL 5J9PB 4RGNE 3KS0H 3FFCB 4QOKA 2PO6B 2BSSA 3LKOA 4L29A 1CU4H 1Q9KB 3KPPA 3HNSH 4MAUL 1SYVB 2BXZA 2X7LB 4C56A 5E8OB 5ILTL 4LCIL 1K9TA 3KPSE 3HPLB 3PL6B 4LVHB 1HYSC 4UTAL 4QY8B 3S88H 1SJEA 1L0QA 1ZHBA 1X5KA 3H2WA 3M17B 5JW3H 1NGYA 3TLRA 2NX5D 4JM2C 2O61A 3TP4A 4X9BA 4LNRA 1T04B 1ZGLA 5JA9A 1N0XL 1Y0LB 4LLQA 5AG8A 1OWRM 2JB5H 5IB3A 2CD0A 3CSPA 2XXMB 4OKVB 3CXDH 3OKYA 3BW9A 4LSUH 1FVEA 4LASL 4NZUH 2PXYA 4AH2A 4ELMB 5IIEA 5FK9A 3T1WA 3KLSA 4K3DL 1JTOA 4MQ7A 5D9SB 3P40A 2A6IB 1PKOA 4X83A 2VIRB 5JXED 3ZE0F 2C4XA 3ARED 4V1DD 1TQCB 3MREB 4KH2A 1VCAA 4WTZA 3F6LA 4M7ZC 2OZ4H 4JRXA 3SGKA 1DLHA 4HWZA 1MAMH 2WUBH 3E0GA 4KJPC 4ZQKB 2F53A 4Q58C 1JUFB 5DO2C 5I1JL 1RIHH 1RY7B 5FM5M 2Z35B 1FFRA 3IDIB 5EOTB 2XN9A 4LCUA 5CAYB 3BVNA 4OD3L 3QXVA 1KG0B 3HNVH 4OF5A 3PABA 3W5MA 4CJ0A 4H8WH 4QT5B 4NT6A 2A9NH 2WQRA 3WL9B 2AXJA 1F3DH 1FL5B 3D85D 1FH5H 3ARPA 1S7XB 1BVLA 1HHJB 4LHUA 4GG6B 1AO7A 4MNGB 4M7JH 5E6ZA 5EUOE 1IBGH 2OM5A 3U46A 2BVYA 4HQQH 1OSPL 1XAUA 3CXHK 1KLFA 2NY2C 4EDXB 5JW4N 3O4LA 2WV3A 5EN2A 4P2QD 2NY0B 4YBLC 1QO3B 1P5VA 1CXKA 3V95A 4H88L 1X7QB 1SY6L 3MACL 5D7LA 4ZXBA 1CGUA 1JPST 4QGTA 3TCLA 1OARL 1M7DA 1L7IL 4GAJL 4PRDB 1JRHH 1BIIB 4QOKD 2QSQA 3UMTA 2ZPKL 4PRNA 1BQHB 4OIIH 3CC5A 1OF2B 4KDTA 1MCEA 3GJFK 3WNKA 3VGAC 4Y4KC 2WM0A 3REWA 5F72S 3P73B 1IILE 1DQQA 2P5WD 2ADGB 4JQVC 3VD3A 2Z0BA 3TNNB 2NNAA 4Y1AD 3QDHA 1BVZA 3BPCA 3FONA 3HE6B 3N06B 2Z8SA 2P5ED 2AJZA 3IVKB 4WIQA 2O5ZH 1QBBA 4J4PA 2Q76A 4F57H 4OZIB 3LHPL 1U3HC 5GHWL 3SJVA 3RIFF 2XFXA 2JELL 3O3AB 5DJZB 3FO2B 4G8EA 2DIAA 2Y5TB 2N7BA 5DR5L 1M7IB 4AMKL 5FA4B 4M6OL 2DD8L 1KPVB 4LU5L 5CJXC 4X6DA 3L7FA 4PTTA 1ZT1B 3LB6C 1BECA 2IQ9L 4FQCH 2DLHA 3EJYC 2CRMA 1XGRA 1FYTA 4K55A 4U31A 2HJKA 4AEEA 3MCLH 3OG4B 1A4KA 4YXHL 2H1PH 2W60A 1MFBH 4TUKL 3GMLB 1XFPA 3QHTC 5IEKA 1T03L 1DQDL 3EO1B 4UQ3B 2VXQH 4QRRE 3L1OH 4WO4B 3THML 5FB8B 5DGRA 1HDMB 4NKQB 2GYSA 4GT7A 3S36L 2BOCA 2EDLA 2WBJC 1KJMA 4JY5L 3VXNB 3X3FL 1TZHB 4GMTL 5FO9B 5E9DB 3ARFC 3HB3C 4QWWC 3OPZL 4ZS6C 2M1KA 4XMKH 4LHUD 1T2JA 2XT1B 4Q2ZB 1CQKA 5GJSL 2MCPL 1A9EA 2OR8A 3BDYH 2P46B 35C8L 2BVQA 3KPQA 1KYOJ 4DKEL 3MV7A 5HY9B 4FA8A 3CFBB 4NCC1 5I9QC 1MFCL 3HUJB 1YN6B 4ZXBD 3MNZA 4M5ZL 3TYGL 4HBCH 1QR1B 4L8BB 3AS2A 3EFFB 5KSVB 2DLEA 1JV5B 4M5YH 5C0CB 1JCKA 4H5SB 4KZDH 4NGHH 1KEML 5D2NC 4TSBH 5HD8D 4OZGE 1WBXB 3MRNA 4PJCB 5I30H 5DRZA 1AKJA 1GRWA 1ZHLA 3TN0C 5JPMA 3QAZC 5IJKA 3ZTNL 1VFUA 3KG5A 2Z8WC 5IQ7H 2HVJA 4GG8B 4JVUA 2J4WH 3PQYB 4Z7VF 4LLDA 1NUFA 2F74B 1OHQA 1T1XB 1W2KT 3SQOH 5FO8B 1T0PB 5C0BD 3QO0A 3DIFB 5C0RH 3EDDA 2BOBB 2VLRB 1HXYB 3HMWL 5FYLL 2R2HB 5TE4L 1S7QB 4IMKC 3U4EA 3OF6A 2ENSA 3S3PA 5J1TC 3WXVL 1TQBB 3MOBL 4PJXB 4UOW0 5TF1L 3V5HB 5IWLA 4OF3A 7CGTA 2QR0A 2DKSA 1CF8H 1NEZG 4S1DC 2QKIB 2HJLB 3WHXB 3L95B 3EOTH 2BHZA 2D4DA 5M95B 4FFVC 2K7QA 1SEBB 4NKMB 5B39A 4PV9A 3SCMB 2XY1A 2YMXL 1NGQH 3B9KB 1JHKH 1QEWA 3RWGA 4ZYKA 5KS9B 2CKBL 5D2LE 4F7CA 1P9MA 1ONQA 4XPHH 3RAJL 3HAEH 4HD9A 5EOCH 3FOMA 3MLVH 2FGWH 3VGFA 2YKLH 3FQNA 3LN5A 1EMTH 3A67H 4NBYB 3VFTA 5GGSA 3I6GB 3RIFK 5JHLL 4ONOA 5DZLA 1S3KH 2MPAL 4JFDE 2LABA 3PGFL 2XY2A 4XPBL 5KVDH 1GZQA 3EYQD 1WAAA 1YNLH 3ZE0E 3AM8A 4GXUM 5B3JE 3MV7D 3UP1A 1B0RA 4Z7QF 3ILPA 4KZEH 5FDWB 4TN9A 2YUXA 3OKKB 1FC2D 2GHWB 4K94C 4ZO7A 4G8IA 2YR3A 5J3HD 2OL3L 2GSGB 1D6VH 2DQJH 1J7VR 2VJXA 3RFZC 1NCAL 4XB7A 5D7IF 2A73B 1LO5A 4ODVL 2NPLX 4NN7C 4DUWA 4WEBL 3QEQE 3K4ZA 2P1YA 3WFDH 1OT1A 5EA0H 1U8IB 4RWYH 5KAQF 3QFJA 3OJVC 3G6JB 2BNUA 2YN5A 3WO3B 4U6HA 4JFDD 1LEKA 1E4WL 4P5MA 4IRSA 1KFAL 3DX8B 3JZ7A 3QIBB 1QFUH 1B4JL 5TFSH 1CFQA 2MHAB 3RDTB 2WLZA 4LEXH 5EWIL 5DHVA 2W9EL 3HC0B 4Z76A 3GKZA 5TDNB 1FRGH 4XWOD 1N6QH 1C08A 3PWLB 3BKMH 3NZHL 1I1YA 2DWEA 4J3UA 3R0NA 4E9LA 4G3YL 4LSPL 2A6JA 1FGNL 2PTTB 1U8NB 3MRCB 3V6OA 4LVNC 1ZEAH 4WUUB 4IS6A 3OKOB 1G7JA 5CD3A 4WUKL 5MEPB 5KTEH 2GK0A 1YMMB 5CCKH 4MSWB 5EU3A 3KPNA 1A6ZA 5T3ZH 3HTLX 4UDTB 1AXSB 4MA1B 4D8PA 2DL9A 3FMGL 5IK3B 4FZ8L 4ZNEE 1I1AD 2SEBB 3S5LA 4X6CA 4Q9RL 1AIFB 4PRIB 4JO1L 2WIIB 1CVSC 2J7LA 4M03A 5TJWK 1JWMB 2R1XB 3B9AA 3CH1A 4JFEA 2W9DH 4NO3A 4NYLB 5KSBB 5SWZB 4KROD 1UKTA 2GJZA 5IM7B 3AROA 5E8DH 4DKAA 3NABH 2P8MB 4JDTH 1NAMH 3FRUA 2CJUH 3PWNB 5C0GB 3KPOA 1I9JL 2AJVL 4WI9A 2R1YA 4JFXA 5E99H 1O5DT 2J88L 5AAWA 3QJHB 4FQ2L 4P99A 3Q1SH 2VH5H 2XIDA 1XF3A 4OFVA 2R8SH 1WITA 4MA3B 1RUML 5HGHB 4U1GC 2OLDA 3GIVB 4BYHA 4PGJA 4ZAKC 5E1HB 4GKSA 2CH8A 3HE7B 2LU3A 4QHUB 2OR9L 3UDWC 1QSFE 4QRSB 2E9IA 1KIPA 2PW1A 4HK3J 3DXAD 4NKOB 4J3SA 3ZKMC 2IPKA 5SWSE 3I6LD 4HHAA 3IF1A 2X10A 1UG9A 2J8OA 3G6DH 2WP3T 4HG4J 3VFPB 3OXSA 2QL1A 1JL8A 1MI5B 3L3OA 5E00A 1PSKL 1AGFB 3QWRA 5HI3C 3MLRL 1K6QL 5KSAC 4M61B 4PJ8A 3PWPE 1QG3A 4RDQF 2R9HD 5TDOB 1NFDB 4C58B 1KN4L 3BT2L 1DCLA 4LGPB 4QRUB 1IGYB 5JNYA 3KPLA 4P46B 1TNMA 4LRNH 2KPNA 4PREA 1VPOH 3OGOE 3E6HA 4XAKE 4WFGE 2D7TH 5GGUA 3P4NA 3N85L 5DK0B 4X7EC 2IH1B 2BNRD 5IB4B 4QNPF 4IOSD 3NCJL 3V7AE 3UPRB 1MQKL 3S6CA 3R1GL 1NUGA 1CXLA 2VQUA 4WGWB 5F7UA 1INEH 3ULVF 1JMZA 4YDKH 2B5IB 3J8F7 2OTUA 3O2WH 2ED9A 4JB9L 2FR4A 1NSNL 3PWPD 4FFZL 3NAAH 4P2OC 4NPYB 4RGMB 5GPRA 5C0AE 1WWWX 2VDML 1YN7A 3AXLA 1NMCC 5GGVH 5FM8A 2QSTA 3PGDA 4YBQD 3QJFB 4JFPB 4FP8L 3TZVD 3H9HB 5JQHC 3QQ3B 1KPUA 5ENWA 2EDWA 4XP5L 5CINH 2GCYA 1C8PA 1RZFH 1ORQA 3M1BB 1WZ1L 4HXAH 3L5JA 4UV7H 4AG4H 3HNTL 4NRYA 5GS0C 5ACZA 1S7UA 3QB7C 1HH9A 5LCVL 4KMLB 5HHVL 3V4VH 5J9PA 1LQSR 1ZLWH 2OJZH 4PJ5B 3FFCA 1TZGL 2PO6A 1NBQA 4MJ6B 3PV6B 3MBXH 2I9TB 1W72H 4MQTB 3ZDZF 2V5MA 1Q9KA 5I66B 4KMQA 3WS6C 1G9NL 1SYVA 5C0AD 5EU7E 3V7AG 5E8OA 1N6VA 5F96L 1T1ZB 2J1KA 1TENA 3HPLA 4ZODA 1R3HB 5E56A 4QY8A 5C0JB 2N56A 4AM0B 4GRWE 4PB9H 1OLLA 4LPTA 3M17A 3G5XB 2BX5A 2NCMA 3WD5L 1T04A 5D7SL 1CGXA 4IOFC 4PJ8D 5GZND 2BY2A 1Y0LA 5CP3H 4ODTH 5D7IE 4P5TC 1F5WA 1ZVHA 4OKVA 3T0EE 4ELMA 1KUMA 1GIGH 2BCKB 4CRPA 1J5OL 1IC4H 1ZLUK 2V9TA 2QLVB 2CIKB 1ZSDB 1RUAH 4XPAH 2Y06H 2AS5M 2A6IA 1N3NB 1M05B 1INQB 4LNVA 2VIRA 4J23A 4M00A 5CJOL 3TIDB 4N1CA 4IBLT 3TVMC 3V8CA 3O6FC 5E6IC 4HWNA 5I8OH 3CNKA 3MREA 4F58H 2IEPA 1HYRC 3MV9E 1V3LA 3F7VB 5E4EB 4X4ZA 2OI9C 2HKFH 3C08H 2VQ1B 1HI6B 3P0VH 4ZQKA 4A6YH 3LMJH 4MJ4A 4WEMB 3UCRA 1CGSL 2QADB 3IDIA 5EOTA 4KK8D 5DSCB 3SGDH 1WZLA 4JFZH 2KKQA 1V3KA 2HMID 3OR6B 3U36B 4PBWD 3F12B 4Y2DC 3UZEA 2X4SA 4QT5A 1KN2H 4PG2A 4JZJA 4QEGA 1FL5A 1LP9B 3L3KB 5SX5H 1S7XA 2EO1A 5IBUB 2YPLE 3TA3A 1R5WB 1HHJA 3MZTA 1U8LB 4GG6A 4MNGA 3MJ9L 3O3EB 3MNWB 1GCFA 1CTNA 4G8GD 3QPXL 1EGJA 3TH2T 4EDXA 4LRIC 3NIGE 1HN1A 2L0DA 2AEQL 1QO3A 2VDQL 4KVNH 5JXAL 1YMHB 2BXYA 1MY7A 1X7QA 2DN7A 2NZ9D 4PJ7F 1NBVH 1RZ7L 3MFFB 5T1KD 5DHVH 3BP4A 5HTSA 4PRDA 4Y19B 3WHE0 1BIIA 3NPSC 4O58H 3MTRA 2ZUSA 2VZVA 3H9SE 1BQHA 3ZYZA 5FYJD 5ESQA 3FO0L 5IF0B 1Q0YH 1J8HE 1CFTB 3CMOH 2VLME 2Y25A 4R26H 1KF9B 1KB9K 4YPJA 2HFTA 5IW1A 1Z3GH 1CXHA 1HSAB 4Y8DC 4WEUD 2YPLD 3RWHB 3AVEA 1RHHB 4KGLA 2ADGA 3QUXD 3TNNA 4B5EA 5KW9H 3WBDA 5I73C 4Z0BH 1IKFH 1S8DB 3HE6A 2MQ0A 4X7TB 3RGVD 3UX9B 2VITA 3WFCL 1WT5C 5B38G 1MPAH 1YNKL 2PETA 5KG9B 3IVKA 5KVGH 4OZIA 4CUCA 2OP4H 4AY0A 5T3XL 2VE6B 4DOHE 3O3AA 4BELD 3FO2A 3TESA 3WHE1 2ZCKL 2Y5TA 1M7IA 5EU4B 2X1OA 5FA4A 1WVZA 3VFVB 1Z5LB 3A6BL 4Y5XB 5D4QA 4JEGB 5ISZE 1OTUD 4MZ2A 1QNZL 1CFNB 1CLCA 4IDJH 4Y0GA 3IYLW 4CVWA 4G8FB 5CEXB 3EO1A 1AY1L 1X4YA 4UQ3A 1Z0NA 4PGZA 3RBSA 2QJDA 2EXWD 5EPMB 4WO4A 5FB8A 2NYYC 4FQQB 4OB5L 2FH8A 1HDMA 4JFYA 1U9KA 3CX5J 2NLJB 4WWKC 3FZUD 2FJGB 4HAGA 3U2SB 3GSWB 4MVBC 3VXNA 4M8VA 4DN4L 5FO9A 1UVQB 1MEXH 5E9DA 3TCXA 5L88L 3TA3D 2D31B 4JN1H 4L1DA 4BFGA 2HT4D 4HWEL 4PJAE 4PJEE 4Q2ZA 5B22A 4Z78B 1MREL 3EYOB 4MX7B 2RB8A 4KKLC 3TBYB 4QNPE 1C5BL 1YEGL 4FFWC 4OJFL 2ADFH 4PLOB 5T5FL 4OM1L 1HINL 5HY9A 1BFOB 1I7TA 3CFBA 4XVSH 1I9IL 4AEIH 3HUJA 4LF3B 1YN6A 4UUJB 1IGJB 4O00A 1QR1A 2VDLH 5GZOD 1T0NB 4L8BA 4JM2B 1UEMA 1UQSB 4CMMB 1JV5A 1YPZF 4KHXL 4MD5A 3W2DL 3VWJC 5C0CA 3ZDYE 1PZUB 1OTTC 2VXTL 1WBXA 2IAMD 4K8RC 3N1QC 4PJCA 4S1QL 3V5KB 1WZMA 4DEPC 1MF2L 3SPVA 1ODAA 4ZOAA 4GG8A 3PQYA 1MRCH 1NUNB 3TV3L 4XBGB 5FO8A 3KR3H 3LIZL 5BO1H 1I8LC 2G60H 1YECH 4G7VL 3DIFA 3AMKA 5JZ7C 4LEOB 1X5ZA 2BOBA 4AEFA 2VLRA 1YEDB 4L5FL 1HXYA 1X44A 2DM2A 3MGOB 4BH7B 4QXUL 5IESH 4OFYD 1S7RB 2R2HA 1CT8B 1C5DB 1S7QA 1GL4B 2I25N 2WNGA 4OLUH 3B6SB 4EI5D 1ZOXA 3N0PB 5ADPL 4I18C 1OAXH 1FNSL 3ZDZE 4PJXA 4OLZL 4GMSH 4FMKA 3V5HA 3UYRH 3GJEB 2D7NA 3HG1B 4NQEE 2CRZA 2QKIA 2HJLA 2XXCB 3WHXA 1JNLL 2FECL 3L95A 3U7WH 4N0YH 1SEBA 3IDNA 4NKMA 1MIEL 3WO4B 3SCMA 2OK0L 5BW7A 2Z92B 2YUWA 2QHRL 2VABB 3U30C 3B9KA 5JW4R 2HFFB 4MD4A 2CR3A 4PJDB 4D2NA 1FG9C 1NPUA 5FHBH 3B83A 1H3VA 1MUJB 1A3RH 3LOWA 5GGVY 1R3IH 3K0WA 3H6JA 4JPKL 3W11D 5E4IA 4BA8A 3U7YL 3MYZA 2PNDA 1KC5L 5IP4A 5E5UB 4KPHL 5TQ0H 4Q9BA 2Y9RT 2ICES 2YD1A 4NQED 4DZ8B 1S7SB 3VGAB 5D72H 1TXKA 5GRJH 1FIEA 3W9EA 3MCKB 4I1NB 4DGIL 5FDWA 5LBSH 1NDGB 3HFML 5D5ME 3CVIH 3OKKA 5L2KE 4HULB 1JP5A 1A7RL 1TETH 1K3IA 2GSGA 5K9QI 5IFHH 1PKQE 1WEJL 2A73A 1UZ8B 2DF3A 3VMNA 4NZRH 3PWUB 1U8IA 3KPTA 5E6YA 4NC1E 5DD0L 3OGCB 1U3HB 3G6JA 3FKUS 5DRNB 1G7PB 5EBMB 3DX8A 5ILTH 2ZCLH 4LCIH 5IVXB 3RDTA 4UTAH 1FDLL 4X7DC 3HC0A 4Z6AT 5IV2B 3A6CL 3GSRB 5EB9A 4M9PA 3PWLA 1FL3B 3RTQB 1RUKL 3QEGL 4AYFA 1JGVH 3M45A 4KK6C 5GIRA 3F5WB 5JOFB 1I3RA 3DHJA 4PY8I 1N0XH 4ELKB 2PTTA 3MRCA 1U8NA 4OQTA 2FLBT 2ZUXA 2GJJA 4R2GB 2GT9A 2EXYD 2FEDC 4U49A 1F4WL 3OKOA 4RMRA 1QBLH 5MEPA 2VDNL 1QYGL 2I27N 1B88A 3CZFB 2M8XA 4MQXD 4MSWA 3GSQB 4XTRD 4XP4L 3SCMD 2VISB 1R24B 2QQNH 4UDTA 1JJUA 1GGTA 3FN0L 4CN1A 3ARDD 5IK3A 4HKJB 4NIKB 4OZFH 1NDMB 2SEBA 3QT2A 1AIFA 4PLJD 4PRIA 3JXAA 5A40E 4L3AA 2WIIA 1WCQA 5DYOB 3KYAA 1DEDA 1P5UA 4L3ED 3U1SL 1JWMA 5I9QB 3BZ4B 2F54B 2R1XA 4NYLA 5I1JH 5EZJA 5KZCB 5SWZA 5D7JC 2C5DC 2VLLB 1KXVC 4YBHA 2PR4L 5IM7A 1CG9B 2X9XA 3SDDC 2P8MA 5BRZE 4HEME 3SDCD 3L3IB 4Y5YB 3PWNA 5C0GA 1VENA 1CWVA 5IROC 1NCDL 1UC6A 3BKCL 1A22B 3PV7A 2GJ6B 4KQ4L 4L4TD 4L3CB 3TN0B 3QCTL 1G6RL 2YZ1A 4J1UB 1A4JB 5D96B 3QJHA 3I02B 1TTGA 2Q6WB 2BNQB 5BXFB 3CFKA 1ORSB 4GRLB 5H37H 4R3SB 4AL8L 1SY6H 4QXGH 2EDQA 4MA3A 3V4PH 4YX2L 5HGHA 1OARH 3GM8A 3GIVA 1L7IH 2FO1A 4PJGB 3ZSTA 4ODXB 5I1IL 3ZYOA 3HE7A 2ZPKH 4QHUA 4RRPG 2DLFL 3SE3C 5EU6D 4QRSA 2JCCB 1B0GB 4WFED 1TCRA 2YS4A 3GMPB 4NKOA 2ENYA 2RBLA 5HYQB 5BRZD 3WJLA 5MEOB 1ZK9A 5CP7B 3VFPA 5I0ZA 1WWCA 5CBAB 1G6RB 1MI5A 2BY0A 1RAMA 1AGFA 1ES0B 4ODUB 4M61A 3NCCB 5TDOA 1NFDA 1MIML 2C7UB 4ZSOB 5DMGD 5C1MB 4IMLB 1FN4B 1CI5A 3H3KA 4GXUN 1D9KC 4DTGL 4QRUA 1IGYA 4AENB 5GHWH 4WW2C 3MRLB 4P46A 4HZAA 1T83C 4XPGL 2Z9TA 3WFEL 4ZTOL 1E0OB 4JDVA 2JELH 4JANB 3ZKQD 3QUYC 5DR5H 2IH1A 5IB4A 2ZUQC 3UPRA 5F7HA 2IQ9H 2KH2B 1UT9A 2VXVL 3TO2B 1KCVL 3MLYL 3I75A 2BY3A 4YXHH 5LQBH 4GS7C 3WUZA 4C56E 1S78D 5DLML 4TUKH 3IETB 3T0BA 2NTFB 1T03H 1DQDH 1U93B 2UY7A 4NPYA 3TH4T 2A83B 3THMH 4G9FA 3VCLB 1BGXL 3S36H 1YEIL 2YD2A 4FQXB 4TOYL 3TH3T 4JFPA 2E7LC 3X3FH 3H9HA 3RVTD 2ICWI 3SKUD 4I0PC 3QQ3A 1EFQA 3LDBB 3GEWB 5GJSH 12E8H 3M1BA 4Y4HB 2MCPH 5J12C 1ZT4B 4JFFD 35C8H 5E2UL 2XG4A 1T3FB 4DKEH 2VLJB 1DBAL 1L6ZA 2N7AA 2W9LA 3B8SA 3P9WB 4PJBB 3PHSA 4PJ5A 4MJ6A 3MX0A 1A7PL 1BM3H 2ITDB 5BV7L 3PV6A 4M5ZH 2I9TA 1AD0A 3TYGH 5I8CB 3D0VB 5I66A 2YD7A 1WAAF 1DUZB 3HAEG 3IT8D 4G6FD 5DUML 2B20A 4BFIB 1KEMH 5DWUL 4KTDL 1T1ZA 5E7FA 4K7FB 4JRXE 1NAKL 1R3HA 4YDIL 5C0JA 1ZVSB 3IU3A 2Y1VA 4AM0A 2F53E 3P0GB 3TNMB 5JDSA 1JHTB 3ZTNH 4YIQB 4W4OC 3G5XA 5GXBB 4MNQD 1B3JA 4CW1B 2XN9E 3O0RL 2X4QA 4EIZC 1LEIB 1IC5L 2WANA 4JG0L 4AEHL 3TIEB 5T3ZE 1PJ9A 4X9HA 3GZKA 3MLWH 2I5YL 1B6DA 5KVEL 3ARBC 3OB8A 3HMWH 5TE4H 2BCKA 3Q5OA 4YDLC 2HN7B 4IRJC 2ZNWA 2CIKA 3KPRB 3O4LE 3WXVH 1ZSDA 4GRMB 3QWQB 3QDMB 5D6DC 3MOBH 1A1OB 3DECA 2Z8VC 5IHZB 4A2MA 1N3NA 1T22B 1M05A 1INQA 3G9AB 4L1HA 3WFBL 3TIDA 4HUVB 25C8L 4J8RB 4GXVH 3F7VA 4UDUB 4F9LC 4M1CC 4TTGA 1IGCL 2VQ1A 1HI6A 2YMXH 8FABB 4JHAL 2CKBH 1NC2B 1SJHB 4IRZL 2A2QT 5DSCA 2OR7A 2HAZA 3OR6A 4WTZG 4YQXH 3U36A 5T3ZD 1WFOA 5J11C 3O8XC 3F12A 3RAJH 3TO4C 4K7PX 4G9FD 4I3SL 5JDJA 2YBRB 1LP9A 5AD0A 3L3KA 1SVCP 1R5WA 2EC9U 2VDOL 1U8LA 4U1GB 3B2UC 3MNWA 5JHLH 3QIUA 3CVHL 1SBSL 4X6CF 5A16B 1D5MB 5F1IA 3UTSD 2CLRB 2MPAH 2EDFA 3KAAA 5C0ND 1KIUA 1PEWA 4LCYB 3MLUL 3PGFH 2I26N 4XPBH 3SJVE 3SBWC 2H41A 1YMHA 4YHKL 1U3YA 3MOQA 5CD5D 2XKSA 3MFFA 3D48R 4Y19A 5GSVB 3D9AL 3QDJD 4NHCL 2P4AB 4X6DE 3QI9C 2OL3H 1NCAH 4TUOA 5IF0A 1CFTA 1FYTE 2X2YA 4ODVH 3ARUA 4WEBH 4M4PA 1C5CL 1HSAA 2AKRB 3K8KA 3RWHA 1RHHA 3MJ9A 3VD9A 4R97C 1KSRA 3F7PC 5K59E 5E2WL 1B6UA 5I76B 1KFAH 3BPLB 2AXHA 5EORH 1S8DA 4HMEA 3LKSB 1F97A 1B4JH 4X7TA 4N68A 5KG9A 3CSYB 3QISA 4I13B 2W9EH 2K9UA 4X7SL 1ROWA 2DI8A 4HDIB 2VE6A 4LCCB 1TZIB 2XTJE 4JZNB 2FHCA 5D1XC 2OYPA 2VR9A 4PY7B 1Q9WA 2MFNA 4G3YH 5EU4A 4LSPH 4EDWH 1FGNH 1IFHL 3S9DB 3S4SG 3VFVA 3QIWC 4P2OB 4Y5XA 2J5LC 4K3GA 1VFMA 2VLKD 5IW6A 4XVTL 4WUKH 1NMCB 1VEOA 3HRZA 1CFNA 4CU8A 3HC4L 1ZS8B 5C07E 1FFOB 4G8FA 3CGTA 5CEXA 3FMGH 3MOAL 2CO6B 4FZ8H 2NY4B 5DJ6B 5EPMA 4FQQA 3RWCB 4Q9RH 4Q6YA 2NLJA 4PIRF 4UV4L 5DJDB 4JO1H 2FJGA 3U2SA 3MRKB 3MCG1 4F9PC 4GKNB 2R4RL 1UVQA 2V17H 4P49A 4HMDA 2D31A 5D70L 3QIUD 4Z78A 1GC1L 1QQDB 2DQEH 2MMXA 3BXNB 4MX7A 3TBYA 1MHHB 1MWAB 3H42L 1HOCB 3SE4C 3MLZL 5HI4D 1OOAA 1BFOA 5GRZA 2PYFA 2Y7QB 2AJVH 2J8UE 4LF3A 1OGAE 5F6HI 4D0CB 4Z7NE 2XKNB 4HUMB 1L6XA 4WI4A 1IGJA 1WWBX 4XGZB 1T0NA 2J88H 3MRMB 1TVHB 4JM2A 4WTXA 1UQSA 4FQ2H 4MJ2A 4N90D 3BGFC 4NQCD 3VXRB 3DX6B 2IF7A 4CMMA 5L8LB 1DVFB 1UCBL 3UTPE 3PP3K 3IXTB 5F9WC 3V6ZB 1NJ9A 4P5TB 3V5KA 2H2PD 1LK3L 1ADQH 1RUMH 3CJJA 4D0BA 3PGCB 3GMMA 1WTLA 2UZYB 4LSTL 4OD2B 3VRLF 3PXJA 4ZO9A 2OR9H 2XYCA 3O3DB 2APXA 3PDDA 1G9EA 1K4CB 5F7MC 1XF1A 5J13B 4LCWB 4XBGA 5I1CL 3WE6B 3LZFL 3F58H 1MH5B 1ZLVH 4LEOA 1NCCL 1YEDA 3TVMB 3O6FB 5E6IB 4JG1L 3MGOA 4BH7A 1PSKH 3BN9D 1S7RA 1CT8A 1C5DA 2VSCA 3B6SA 3MLRH 1CK0L 1K6QH 3BKJH 3SE9L 4ETQB 1QBMH 4NFDA 1FCGA 3O9WC 3QNZB 4RMWA 4RNRB 2XA8L 5A2LH 4JLRB 1MHCB 3GJEA 3UTPD 5DEZA 1KN4H 3HG1A 3BT2H 1UADC 4JPIB 4LK4A 4NO5B 5GQBA 2YRZA 4Y2DB 5EBGA 1N26A 1YEKL 4LDLB 1RURL 3VXUE 1NMBL 4ZFZA 2BSRB 5HPOA 1CGWA 2F8VA 2BY1A 2Z92A 3HN3A 3D3VE 4M7LL 2C3GA 2VKWA 2VABA 3FL7A 1UFUA 3VH8B 2HFEB 2HFFA 4NCDA 1NGPL 4PJDA 3NCJH 2HT2D 4X99B 5EUKB 1MQKH 4ELMF 2MNUA 3R1GH 5B39G 3T77B 2EE6A 3QFJE 2R2CA 4OLWL 4R6UA 1RULL 1BBDL 4Z7VB 1CDBA 5CSGA 3OBAA 1VACA 4JB9H 3KLAA 3D1MC 3IAPA 1XIWB 2AJSH 4FFZH 2X1XR 1H8OA 3NPSB 2H32B 4Y4FD 5ACMA 2VDMH 2DRUA 3JWOC 1FZOB 4DZ8A 2CQVA 3LV3B 1S7SA 3QCVL 2PYED 5E94B 3RWJB 1MCWW 3VI3F 4FP8H 3MCKA 1ZWIB 1HYSD 4A2LA 2JF1A 1FNFA 5E2TL 3EOYG 2OBGA 3P4MB 3UTOA 3V6OE 4XP5H 5K9JL 1Q38A 3VFGH 1F3DJ 4M6NL 4U7KA 3RA7H 3B4NA 4EOWL 1UZ8A 5HGAB 4LGSB 2EDXA 4YHZL 5LCVH 3PWUA 4JQXC 4KUZL 4O02H 5BZDB 3ETBF 1TZGH 3OGCA 1U3HA 1N5YL 4N8PA 5FM5O 5DRNA 4NUGL 1G9NH 3NOIA 1G7PA 1TJHL 4PP1C 4CMHB 3WKML 1FORL 5IJVB 4JCMA 5EBMA 1CD9B 5F96H 4GW4B 4WU7B 5IVXA 2X70B 3FB7B 5GGRY 5CJXA 4P9HL 3CFEB 4JFEE 1S7WB 1TVBB 5IV2A 3GSRA 3UTTB 4JHBA 1Q72L 1FL3A 3RTQA 3WD5H 4PGBB 1HCFX 1KBGL 1YEEL 3DVIA 1TPXC 5JOFA 2X09A 3O6LL 4ELKA 3CMGA 4KJPD 3ALXA 4E41E 3DRQB 1YQVL 4M6ML 3HG1D 1M71B 1G7IB 5JHDB 1UZ6E 2DYPD 1G9MC 3IDJB 1U92A 4OCXH 3VFUB 3CZFA 2E9BA 3L5IA 4WWKB 3GSQA 2IANB 1FNAA 2WBJA 3BEVB 1R24A 1K2DB 2X4NB 3DUHA 1UEYA 1ZANL 1U6AH 4YXLL 4OZIF 2ICWB 4TQEL 4HKJA 2D03L 4JPVL 1NDMA 2NY2D 4YDJB 3IDUA 2EECA 1SM3L 5DYOA 4KKAC 3MV11 2QV2A 3JVGC 3B9VA 2FHFA 3BZ4A 2F54A 5H2BB 4N1EA 1FNHA 3CU1A 1BZ7B 3S5LG 1EAJA 1CGSH 3P11L 2VLLA 2DQTL 5C6TL 1CG9A 4E41D 5C09B 3VWJB 4QHLB 5HHOE 5FKAB 3VXSB 5FHAL 3L3IA 4Y5YA 3PDGA 3QH3B 1JYXA 3DV4B 5I1GH 1MLCB 3M07A 4Y4KD 4D9RD 2GJ6A 3TN0A 4L3CA 3MJ9H 1EXUB 3SY0B 2XZQL 4J1UA 3QPXH 2W38A 3I02A 5LWYL 1DUYB 4X5XB 3CU7A 2Q6WA 2BNQA 3ZDXF 5BXFA 1ORSA 1I4FB 4GRLA 4O4YL 2R39A 2VDQH 5JXAH 4OF8A 4R3SA 2QHLA 3QQ4B 4KKBC 3KJ6L 1RZ7H 3BH8B 1EO5A 4Y16B 1PYWB 2AABL 4P57B 3RZCB 4ODXA 5HHQB 5IHUH 4IMKA 2WIMA 2JCCA