5EOWA

Crystal structure of 6-hydroxynicotinic acid 3-monooxygenase from pseudomonas putida kt2440
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
372
structure length
353
Chain Sequence
b'QKIAIVGAGLGGAAAATLLQQAGFDVEVFEQAPAFTRLGAGIHIGPNVMKIFRRMGLEQKLELMGSHPDFWFSRDGNTGDYLSRIPLGEFARREYGAAYITIHRGDLHALQIEAIQPGTVHFGKRLEKIDQVRLDFADGTHTVADIVIGADGIHSKIREELLGAEAPYSGWVAHRALIRQHADVFEPCVKWWSEDRHMMVYYTTGKRDEYYFVTGVPHVDSSQEEMRAAFEGYHPTVQKLIDATESITKWPLRNRNPLPLWSRGRLVLLGDACHPMKPHMAQGACMAIEDAAMLTRCLQETGLSDHRTAFALYEANRKERASQVQSVSNANTWLYSQEDPAWVYGYDLYGQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxynicotinate 3-monooxygenase
publication title Structural and Biochemical Characterization of 6-Hydroxynicotinic Acid 3-Monooxygenase, A Novel Decarboxylative Hydroxylase Involved in Aerobic Nicotinate Degradation.
pubmed doi rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Oxidoreductase
total genus 108
structure length 353
sequence length 372
ec nomenclature ec 1.14.13.114: 6-hydroxynicotinate 3-monooxygenase.
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5eowA00
4D03A 3L8KA 4Z2TA 3NH3X 2FJAA 4H2QA 3UP4A 2ZBWA 1NHSA 2X8GA 2VOUA 2X99A 4NZHA 3BNUA 1B5QA 4EQWA 2QCUA 2Q0KA 3P4RA 3AE9A 1Z6LA 4H4RA 1D7YA 3ALLA 2EQ9A 1IUVA 2J3NA 2BYBA 5KXJA 1CF3A 4D04A 1JNRA 2APGA 3LZWA 2C72A 4Y4NA 4BK1A 2ZZCA 3UKAA 1TDEA 5EB5A 1K0IA 1VDCA 3AEAA 3L1RA 4ADWA 3AE5A 2F5ZA 1GRHA 3FG2P 1OJAA 4XWRA 2GVCA 3B3RA 5L46A 5LV9A 1RSGA 2XFNA 1E1MA 4B69A 4GRTA 2WESA 2YLZA 3GRTA 4EMJA 2W0HA 2XYOA 4JDRA 3CNJA 1H81A 4EMIA 4CCRA 4PABA 3M12A 3EAOA 1S3BA 4NTCA 3SFDA 3VRDB 2JB2A 4AOSA 1E1NA 1BZLA 1LTXR 3AE1A 1TRBA 3II4A 4TM0A 4XXGA 3KA7A 4C3XA 1GNDA 2XLUA 1OJ9A 1GREA 1Y56B 3CGDA 5FS8A 3AE6A 2JK6A 2WOWA 2CULA 3BHKA 4K7ZA 3AEFA 1F6MA 3URHA 3ZYXA 3GMCA 4B68A 1XDIA 1GV4A 4UP3A 4UDQA 5DBJA 5FMHA 4EQSA 2VVLA 3DGZA 1XANA 4B65A 1VG9A 2R4JA 3KVEA 1QLBA 2V5ZA 5EB4A 1PBDA 1EL8A 5IQ4A 3VR8A 2YAUA 1GESA 2BS2A 1JRXA 2XFPA 3REDA 2BXSA 1YY5A 3KU9A 4B63A 4USRA 1RP0A 4WCTA 4J2WA 2Q6UA 4U8JA 3LXDA 4UDRA 3LADA 1OJTA 3DK9A 5M10A 4X4JA 1UKVG 1S2YA 3F8PA 3GRSA 1PJ6A 3PVCA 1FL2A 3P9UA 2GH5A 3AEGA 1NAAA 3K7MX 1LV0A 2XVHA 2YVJA 4Z2UA 2NPXA 4AT0A 1ZY8A 3LB8A 3NN0X 1PBFA 4GUVA 4NEVA 3RP7A 1KF6A 3K7TA 1E1LA 1PDHA 4XWZA 5JCLA 2WP9A 1P2HA 4BV6A 2XVJA 2WETA 1IUWA 5HHFA 1PXAA 2WP6A 4M52A 2WOVA 2A87A 4JY3A 1NG4A 5GSNA 4Z43A 1IUTA 4OPLA 5BRTA 1D5TA 2RGJA 4JQ9A 2GR3A 2V60A 2R9ZA 4J36A 3VRAA 4GF7A 5KVHA 2B76A 3RP6A 2GV8A 1IUUA 2YLWA 3GMBA 1MXTA 5JCNA 1H7XA 4NTDA 1F8WA 2YM2A 4YSXA 2BA9A 4C5OA 2C65A 3H4KA 5IQ1A 3VR9A 1JEHA 1GERA 1ZDLA 4H4VA 5FS7A 1BGJA 1GT8A 2GAGB 1F8SA 2XVFA 2YG7A 3BI4A 3CPJG 1CL0A 1GSNA 2ZZBA 2UZZA 2YQUA 3AEEA 1REOA 3FMWA 3GDPA 4OCGA 3VRBA 1ZX9A 4U2SA 2C64A 3ICSA 3CNDA 4LA1A 2BK3A 4RG4A 3D1CA 3OC4A 1H7WA 2XLTA 1EL7A 1H83A 1H84A 3M0OA 4A79A 2JKCA 1LQTA 4U2TA 3SQPA 2WDRA 4APNA 1Q1WA 1K4QA 3AE3A 3CPHG 2GB0A 4U2LA 1EBDA 3AEBA 2V3AA 2C70A 2GQFA 3QSSA 1CJ3A 1N4UA 2BCGG 1GEUA 3NT6A 4H4WA 5U1OA 3GD3A 3QFAA 4C77A 1FEBA 1B4VA 4B67A 2BK5A 3AYJA 3V76A 2XVEA 2Y6RA 1PXCA 2BC0A 1K0JA 2R0CA 3RHAA 4U8IA 1PBEA 4X9NA 4YSYA 2B7RA 4TLXA 4FK1C 4OPTA 1YKJA 4CNJA 1JRZA 5KOWA 2B7SA 3NHOX 4GR1A 2XFUA 1EL5A 5U63A 2X8HA 3NG7X 4Z44A 5CQFA 1S3EA 1JOAA 2FJBA 3DK4A 4A65A 1YQ4A 3NYCA 2WS3A 4JN9A 5KOXA 4YT0A 1NDAA 2EQ6A 3CNSA 1PJ7A 4C74A 5M0ZA 4YSZA 3JSKA 4CY6A 3DK8A 2WHDA 4B1BA 4J31A 4A6NA 5JCIA 4REKA 3O0HA 4J57A 1D4DA 2C76A 4DSHA 2X8CA 3GSIA 2EQ7A 2YM1A 4EM4A 1EL9A 4O5QA 3IHGA 1JRYA 1JNZA 4H4PA 2FBWA 2DKHA 4U8PA 2B9YA 1CJCA 2QAEA 3ZDNA 1MOKA 4FK1A 2E1MA 2E5VA 2BXRA 2WQYA 2YLSA 3AYIA 3I3LA 1X31B 3ICTA 4IVMB 3AE8A 1H82A 4K8DA 3BI5A 1IUSA 4U8KA 3UTGA 1GRGA 4IVOB 1FEAA 1PHHA 1ZMCA 2XLPA 2YR4A 3BHFA 3C4NA 3CGEA 3M13A 4FX9A 4K2XA 2IVEA 4K5SA 2XFQA 3P4SA 2BC1A 4WX1A 3VQRA 4GDPA 4B66A 1DJNA 4H2RA 5KRQA 2YLTA 1ZKQA 1YQ3A 3NK0X 4H7UA 1FOHA 3AEDA 1CC2A 4USQA 1F3PA 4N9XA 5U25A 4H4SA 2R46A 3NYEA 3Q6JA 2C67A 3GD4A 4MJWA 2V6OA 1NHQA 2R45A 4YTMA 1L9EA 2Q0LA 2EQ8A 2ARDA 1BGNA 3GWDA 3UTEA 1BF3A 3AD8B 2AQJA 4YTNA 1XHCA 2XCGA 2VQBA 1FCDA 3ALMA 4CY8A 3PO7A 3DJDA 2H89A 2VRLA 3QSEA 3CIRA 3UKLA 1P2EA 3EANA 1HYUA 2FJDA 2GEWA 1CC6A 1KNPA 1V59A 4BK2A 3UOXA 4B64A 2QA1A 2YG6A 2R0PA 3AECA 4AP3A 3GWFA 3FIMB 4Y4MA 1NHRA 3UKHA 2BS4A 2BABA 3BNMA 1NPXA 1VRQB 4UDPA 4DSGA 5FS9A 2A8XA 1GRBA 3PS9A 4FDCB 1N4WA 2VVMA 3NLCA 3SGLA 3UKQA 1D7LA 5HXIA 2VQ7A 1L9DA 2C7GA 2C66A 2XVIA 4AP1A 3NRNA 3UP5A 1D4EA 3AWIA 4Y4LA 4JNQA 3IC9A 1PN0A 4H4TA 3DMEA 3C96A 3KLJA 2YVGA 3CN8A 4ZCCA 4Z26A 1NHPA 5BUKA 4EQRA 3RP8A 4JY2A 1W4XA 5BULA 4NEWA 1CBOA 1NENA 2VZ2A 1ZMDA 4E0VA 2I0ZA 4A9WA 2RGOA 3Q9TA 3BI2A 3H8IA 1PJ5A 2XLRA 1COYA 2TMDA 3GDNA 1MO9A 5HY5A 2C3DA 2WEUA 4LIIA 3NYFA 1KFYA 1LJ1A 2JB3A 4Z2RA 3DJGX 2WDVA 3UTHA 2Y6QA 4I58A 4OPUA 1GRFA 2YG3A 3UKPA 3QVPA 3QJ4A 2GAHB 3DH9A 4EM3A 4EIPA 3ICRA 3HZLA 1L0VA 3LZXA 3RNMA 1GOSA 1Q1RA 4U8NA 2V3BA 3IF9A 3LOVA 4A5LA 2WU5A 2WPFA 4CBQA 4YSHA 5HYMA 5IPYA 1N1PA 2WPEA 1BKWA 4EMWA 1NEKA 3SFEA 3KD9A 2A89A 1DOEA 5ER0A 2BK4A 1PXBA 2JB1A 2GQWA 4P9SA 5KWFA 3QFBA 4DNAA 2GMJA 3NIXA 2VVLG 3AE7A 1TDFA 4BK3A 2B9XA 1GXFA 1CJ2A 2X50A 1K0LA 3COXA 5JCKA 1H6VA 2GMHA 3I6DA 4HB9A 1H86A 1M6IA 4KX6A 4U8LA 1L9CA 4YTPA 1DOCA 1N4VA 3EF6A 1LVLA 2NVKX 4TLZA 1ZP0A 2O9ZA 3NKSA 4RG3A 1KNRA 4BJZA 4LU6A 3P1WA 3UKKA 2JAEA 3KKJA 3P4PA 4YKFA 4AT2A 3NK1X 3QVRA 3K7QX 2QA2A 3NTDA 3NTAA 5KVIA 3V3OA 3FBSA 1DODA 5J60A 3ATRA 4TM4A 3EPTA 5EOWA 2BACA 5JCMA 2R4EA 1SEZA 3SM8A 1Q9IA 2Z5XA 1DOBA 4A6NB 2IIDA 3S5WA 4A7AA 3LJPA 4DGKA 2HQMA 3AE4A 5EBKA 2YWLA 3S61A 2YVFA 1O94A 1KDGA 3DJJA 3F8DA 1M64A 1Y56A 2BS3A 4GCMA 2RABA 1E6EA 1GALA 2WP5A 3ADAB 4PAAA 3V3NA 1LQUA 3H8LA 3CPIG 1GRTA 3AB1A 3DA1A 2CFYA 1O95A 2GR1A 2YG5A 4RSLA 2AAQA 4H2NA 1YQZA 4OPDA 3G5QA 4EQXA 4K5RA 4O5UA 4H4XA 2FJEA 3K30A 3NN6X 3NGCX 3GYJA 2WDQA 1DNCA 2AR8A 2YLXA 5C2TA 4CCQA 2X3NA 1E7PA 2Q7VA 3CGBA 3T37A 3IWAA 2R0GA 2YG4A 3ABVA 3CNTA 2PYXA 3WE0A 3P4QA 3UOZA 4BURA 1ZK7A 2OALA 1GTEA 1GETA 3UKFA 4I59A 2V61A 3KPFA 2OLNA 1Y0PA 4K22A 1TDOA 4KPRA 1PS9A 4OVIA 4NTEA 2CDUA 1TDNA 4TM3A 3AE2A 2WOIA 1CC4A 4ECHA 4GDEA 2CVJA 1GRAA 3AD9B 4CRTA 4U8OA 2ACZA 1BWCA 1B37A 3DGHA 4HA6A 1TYTA 1ZOYA 2C75A 2JBVA 4JNAA 2C3CA 1AOGA 3UTFA 4ICYA 2XLSA 3G5SA 2WPCA 2XFOA 3QSMA 1D4CA 4AOXA 5FS6A 5BVAA 2RGHA 2TPRA 1NG3A 1VG0A 4IV9A 4BJYA 1E39A 2B9WA 1OJCA 3UOVA 4H4ZA 4H50A 3NNEA 1ONFA 2OAMA 1JU2A 3GYIA 2YLRA 2WU2A 3R9UA 2E4GA 1ZOVA 1PBBA 2OA1A 4H4QA 4OPGA 4Z24A 3AXBA 3G5RA 5GRTA 4A99A 4OPIA 4Z25A 1B8SA 3IHMA 1QJDA 1DJQA 4J56A 4TM1A 2DKIA 4J34A 2H88A 4H4YA 4YXDA 3OZ2A 3NK2X 3ALJA 3ATQA 2YR6A 2PHHA 2IVDA 1CJ4A 1IJHA 4U8MA 5C3JA 3CGCA 3B6DA 3UOYA 3C4AA 1OJDA 1IUXA 2YR5A 5CKUA 5J7XA 4EIQA 2GR2A 3AYLA 3E1TA 2GF3A 4IA6A 3UCLA 2C73A 4YKGA 1PBCA 2XDOA 1KSSA 4H2PA 1ELIA 1O5WA 4IA5A 1TDKA 2BCPA 2Z5YA 3CTYA 2GRTA 1XPQA 3D8XA 4C3YA 4CNKA 3FPZA 1QO8A 3CNPA 4X9MA 3AD7B 5TR3A 1GPEA 1VQWA 3ITJA 1KSUA 4ZCDA 1DXLA 1F8RA 2VRMA 1E1KA 4OPCA 1RYIA 3F8RA 1FECA 1CHUA 3DJEA 2OLOA 2ZZ0A 4ZN0A 1S2QA 1LPFA 2WBAA 1GTHA 4J33A 2GR0A 4YWOA 3ISHA 4H4UA 1TYPA
chains in the Genus database with same CATH superfamily
4D03A 3L8KA 4Z2TA 2BRYA 3NH3X 2FJAA 4H2QA 4GAVA 3UP4A 2ZBWA 1NHSA 5KMPA 2X8GA 2VOUA 2X99A 4NZHA 3BNUA 1B5QA 4EQWA 2QCUA 2Q0KA 3P4RA 3AE9A 1Z6LA 4H4RA 1D7YA 3ALLA 2EQ9A 1IUVA 2J3NA 2BYBA 5KXJA 1CF3A 4D04A 1JNRA 2APGA 3LZWA 2C72A 4Y4NA 4BK1A 2ZZCA 3UKAA 1TDEA 5EB5A 1K0IA 1VDCA 3AEAA 3L1RA 4ADWA 3AE5A 2F5ZA 1GRHA 3FG2P 3SZFA 1OJAA 4XWRA 2GVCA 3B3RA 5L46A 5LV9A 1RSGA 2XFNA 1E1MA 4B69A 4GRTA 2WESA 2YLZA 3GRTA 4EMJA 2W0HA 2XYOA 4JDRA 3CNJA 1H81A 4EMIA 4CCRA 4PABA 3M12A 3SXIA 3EAOA 1S3BA 4NTCA 3SFDA 3VRDB 2JB2A 4AOSA 1E1NA 1BZLA 1LTXR 3AE1A 1TRBA 3II4A 4TM0A 4XXGA 3KA7A 4C3XA 1GNDA 2XLUA 1OJ9A 1GREA 1Y56B 3CGDA 5FS8A 3AE6A 2JK6A 2WOWA 2CULA 3BHKA 4K7ZA 3AEFA 1F6MA 3URHA 3ZYXA 3GMCA 4B68A 1XDIA 1GV4A 4UP3A 4UDQA 5DBJA 5FMHA 4EQSA 2VVLA 3DGZA 1XANA 4B65A 1VG9A 2R4JA 3KVEA 1QLBA 2V5ZA 5EB4A 1PBDA 1EL8A 5IQ4A 3VR8A 2YAUA 1GESA 2BS2A 1JRXA 2XFPA 3REDA 2BXSA 1YY5A 3KU9A 4B63A 4USRA 1RP0A 4WCTA 4J2WA 2Q6UA 4U8JA 3LXDA 4UDRA 3LADA 1OJTA 3DK9A 5M10A 4X4JA 1UKVG 1S2YA 3F8PA 3GRSA 1PJ6A 3PVCA 1FL2A 3P9UA 2GH5A 3AEGA 1NAAA 3K7MX 1LV0A 2XVHA 2YVJA 4Z2UA 2NPXA 4AT0A 1ZY8A 3LB8A 3NN0X 1PBFA 4GUVA 4NEVA 3RP7A 1KF6A 3K7TA 1E1LA 1PDHA 4XWZA 5JCLA 2WP9A 1P2HA 4BV6A 2XVJA 2WETA 1IUWA 5HHFA 1PXAA 2WP6A 4M52A 2WOVA 2A87A 4JY3A 1NG4A 5GSNA 4Z43A 1IUTA 4OPLA 5BRTA 1D5TA 2RGJA 4JQ9A 2GR3A 2V60A 2R9ZA 4J36A 3VRAA 4GF7A 5KVHA 2B76A 3RP6A 2GV8A 1IUUA 2YLWA 3GMBA 5KMSA 1MXTA 5JCNA 5KNLA 1H7XA 4NTDA 1F8WA 2YM2A 4YSXA 2BA9A 4C5OA 2C65A 3H4KA 5IQ1A 3VR9A 1JEHA 1GERA 1ZDLA 4H4VA 5FS7A 1BGJA 1GT8A 2GAGB 1F8SA 2XVFA 2YG7A 3BI4A 3CPJG 1CL0A 1GSNA 2ZZBA 2UZZA 2YQUA 3AEEA 1REOA 3FMWA 3GDPA 4OCGA 3VRBA 1ZX9A 4U2SA 2C64A 3ICSA 3CNDA 4LA1A 2BK3A 4RG4A 3D1CA 3HYVA 1H7WA 2XLTA 1EL7A 1H83A 1H84A 3M0OA 3OC4A 2JKCA 1LQTA 4U2TA 3T31A 4A79A 3SQPA 2WDRA 4APNA 1Q1WA 1K4QA 3AE3A 3CPHG 2GB0A 4U2LA 1EBDA 3AEBA 2V3AA 2C70A 2GQFA 3QSSA 3T2KA 1CJ3A 1N4UA 2BCGG 1GEUA 3NT6A 4H4WA 5U1OA 3GD3A 3QFAA 4C77A 1FEBA 1B4VA 4B67A 2BK5A 3AYJA 3V76A 2XVEA 2Y6RA 1PXCA 2BC0A 1K0JA 2R0CA 3CMMA 3RHAA 4U8IA 1PBEA 4X9NA 4YSYA 2B7RA 4TLXA 4FK1C 4OPTA 1YKJA 4CNJA 1JRZA 5KOWA 2B7SA 3NHOX 4GR1A 2XFUA 4G73A 1EL5A 5U63A 4G9KA 2X8HA 5KMRA 3NG7X 4Z44A 5CQFA 1S3EA 1JOAA 2FJBA 3DK4A 4NWZA 4A65A 1YQ4A 3NYCA 2WS3A 4JN9A 5KOXA 4YT0A 1NDAA 3T2YA 2EQ6A 3CNSA 1PJ7A 4C74A 5M0ZA 4YSZA 3JSKA 4CY6A 3DK8A 2WHDA 4B1BA 4J31A 4A6NA 5JCIA 4REKA 3O0HA 4J57A 1D4DA 2C76A 4DSHA 2X8CA 3GSIA 2EQ7A 2YM1A 4EM4A 1EL9A 4O5QA 3IHGA 1JRYA 1JNZA 3SX6A 4H4PA 2FBWA 2DKHA 4U8PA 2B9YA 1CJCA 2QAEA 3ZDNA 1MOKA 4FK1A 2E1MA 2E5VA 2BXRA 2WQYA 2YLSA 3AYIA 3I3LA 1X31B 3ICTA 4IVMB 3AE8A 1H82A 4K8DA 3BI5A 1IUSA 4NNJA 4U8KA 3UTGA 1GRGA 4IVOB 1FEAA 1PHHA 1ZMCA 2XLPA 2YR4A 3BHFA 3C4NA 3CGEA 3M13A 4FX9A 4K2XA 2IVEA 4K5SA 5KMQA 2XFQA 3P4SA 4II3A 2BC1A 4WX1A 3VQRA 4GDPA 4B66A 1DJNA 4H2RA 5KRQA 2YLTA 1ZKQA 1YQ3A 3NK0X 4H7UA 1FOHA 3AEDA 1CC2A 4USQA 1F3PA 4N9XA 5U25A 4H4SA 2R46A 3NYEA 3Q6JA 2C67A 3GD4A 4MJWA 3SZWA 2V6OA 1NHQA 2R45A 4YTMA 1L9EA 2Q0LA 2EQ8A 2ARDA 1BGNA 3GWDA 3UTEA 4GAPA 1BF3A 3AD8B 2AQJA 3SZCA 4YTNA 1XHCA 2XCGA 2VQBA 1FCDA 3ALMA 4CY8A 3PO7A 3DJDA 2H89A 2VRLA 3QSEA 3CIRA 3UKLA 1P2EA 3EANA 1HYUA 2FJDA 2GEWA 1CC6A 1KNPA 1V59A 4BK2A 3UOXA 4B64A 2QA1A 2YG6A 2R0PA 3AECA 4AP3A 3GWFA 3FIMB 4Y4MA 1NHRA 3UKHA 2BS4A 2BABA 3BNMA 3T14A 1NPXA 1VRQB 4UDPA 4DSGA 5FS9A 2A8XA 1GRBA 3PS9A 4FDCB 1N4WA 2VVMA 3NLCA 3SGLA 3UKQA 1D7LA 5HXIA 2VQ7A 1L9DA 2C7GA 2C66A 2XVIA 4AP1A 3NRNA 3UP5A 1D4EA 3AWIA 4Y4LA 4JNQA 4II2A 3IC9A 1PN0A 4H4TA 3DMEA 3C96A 3GYXA 3KLJA 2YVGA 3CN8A 4ZCCA 4Z26A 1NHPA 5BUKA 4EQRA 3RP8A 4JY2A 1W4XA 5BULA 4NEWA 1CBOA 1NENA 2VZ2A 1ZMDA 4E0VA 2I0ZA 4A9WA 2RGOA 3Q9TA 3BI2A 3H8IA 1PJ5A 2C4CA 1COYA 2TMDA 2XLRA 3GDNA 1MO9A 5HY5A 2C3DA 2WEUA 4LIIA 3NYFA 1KFYA 1LJ1A 2JB3A 4Z2RA 3DJGX 2WDVA 3UTHA 2Y6QA 4I58A 4OPUA 1GRFA 2YG3A 3UKPA 3QVPA 3QJ4A 2GAHB 3DH9A 4EM3A 4EIPA 3ICRA 3HZLA 1L0VA 3T0KA 3LZXA 3RNMA 1GOSA 1Q1RA 4U8NA 2V3BA 3IF9A 3LOVA 4A5LA 2WU5A 2WPFA 4CBQA 4YSHA 5HYMA 5IPYA 1N1PA 2WPEA 1BKWA 4EMWA 1NEKA 3SFEA 3KD9A 2A89A 1DOEA 5ER0A 2BK4A 1PXBA 2JB1A 2GQWA 4P9SA 5KWFA 3QFBA 4DNAA 2GMJA 3NIXA 2VVLG 3SY4A 3AE7A 1TDFA 4BK3A 2B9XA 1GXFA 1CJ2A 2X50A 1K0LA 3COXA 3HYXA 1H6VA 2GMHA 3I6DA 4HB9A 5JCKA 1H86A 1M6IA 4KX6A 4U8LA 1L9CA 4YTPA 1DOCA 1N4VA 3EF6A 1LVLA 2NVKX 4TLZA 1ZP0A 2O9ZA 3NKSA 4RG3A 1KNRA 4BJZA 3T2ZA 4LU6A 3P1WA 3KPKA 3UKKA 2JAEA 3KKJA 3P4PA 4YKFA 4AT2A 3NK1X 3QVRA 3K7QX 2QA2A 3NTDA 3NTAA 4G74A 5KVIA 3V3OA 3FBSA 1DODA 2BRAA 5J60A 3ATRA 4TM4A 3EPTA 5EOWA 2BACA 5JCMA 2R4EA 1SEZA 3SM8A 1Q9IA 2Z5XA 1DOBA 4A6NB 2IIDA 3S5WA 4A7AA 3LJPA 4DGKA 2HQMA 3AE4A 5EBKA 2YWLA 3S61A 2YVFA 1O94A 1KDGA 3DJJA 3F8DA 1M64A 1Y56A 2BS3A 4GCMA 2RABA 1E6EA 1GALA 2WP5A 3ADAB 4PAAA 3V3NA 1LQUA 4G6GA 3H8LA 3CPIG 1GRTA 3AB1A 3DA1A 3SYIA 2CFYA 1O95A 2GR1A 2YG5A 4RSLA 2AAQA 4H2NA 1YQZA 4OPDA 3G5QA 4EQXA 4K5RA 4O5UA 4H4XA 2FJEA 3K30A 3NN6X 3NGCX 3GYJA 2WDQA 1DNCA 2AR8A 2YLXA 5C2TA 4CCQA 2X3NA 1E7PA 2Q7VA 3HYWA 3CGBA 3T37A 3IWAA 2R0GA 2YG4A 3ABVA 3SZ0A 3CNTA 2PYXA 3WE0A 3P4QA 3UOZA 4BURA 1ZK7A 2OALA 1GTEA 1GETA 3UKFA 4I59A 2V61A 3KPFA 2OLNA 1Y0PA 4K22A 1TDOA 4KPRA 1PS9A 4OVIA 4NTEA 2CDUA 1TDNA 4TM3A 3AE2A 2WOIA 1CC4A 4ECHA 4GDEA 2CVJA 1GRAA 3AD9B 4CRTA 4U8OA 2ACZA 1BWCA 1B37A 3DGHA 4HA6A 1TYTA 1ZOYA 2C75A 2JBVA 4JNAA 2C3CA 1AOGA 3UTFA 4ICYA 2XLSA 3G5SA 2WPCA 2XFOA 3QSMA 1D4CA 4AOXA 5FS6A 5BVAA 2RGHA 2TPRA 1NG3A 1VG0A 4IV9A 4BJYA 1E39A 2B9WA 1OJCA 3UOVA 4H4ZA 4H50A 3NNEA 1ONFA 2OAMA 1JU2A 3GYIA 2YLRA 2WU2A 3R9UA 2E4GA 1ZOVA 1PBBA 2OA1A 4H4QA 4OPGA 4Z24A 3AXBA 3G5RA 5GRTA 4A99A 4OPIA 4Z25A 1B8SA 3IHMA 1QJDA 1DJQA 4J56A 4TM1A 2DKIA 4J34A 2H88A 4H4YA 4YXDA 3OZ2A 4G6HA 3NK2X 3ALJA 3ATQA 2YR6A 2PHHA 2IVDA 1CJ4A 1IJHA 4U8MA 5C3JA 3CGCA 3B6DA 3UOYA 3C4AA 1OJDA 1IUXA 2YR5A 5CKUA 5J7XA 4EIQA 2GR2A 3AYLA 3E1TA 2GF3A 4IA6A 3UCLA 2C73A 4YKGA 1PBCA 2XDOA 1KSSA 4H2PA 1ELIA 1O5WA 4IA5A 1TDKA 2BCPA 2Z5YA 3CTYA 2GRTA 1XPQA 3D8XA 4C3YA 4CNKA 3FPZA 1QO8A 3CNPA 4X9MA 3AD7B 5TR3A 1GPEA 1VQWA 3ITJA 1KSUA 4ZCDA 1DXLA 1F8RA 2VRMA 1E1KA 4OPCA 1RYIA 3F8RA 1FECA 1CHUA 3DJEA 2OLOA 2ZZ0A 4ZN0A 1S2QA 1LPFA 2WBAA 1GTHA 4J33A 2GR0A 4YWOA 3ISHA 4H4UA 1TYPA
chains in the Genus database with same CATH topology
4D03A 3L8KA 4Z2TA 2BRYA 3NH3X 2FJAA 4H2QA 4GAVA 3UP4A 2ZBWA 1NHSA 5KMPA 2X8GA 2VOUA 2X99A 4NZHA 3BNUA 1B5QA 4EQWA 2QCUA 2Q0KA 3P4RA 3AE9A 1Z6LA 4H4RA 1D7YA 3ALLA 2EQ9A 1IUVA 2J3NA 2BYBA 5KXJA 1CF3A 4D04A 1JNRA 2APGA 3LZWA 2C72A 4Y4NA 4BK1A 2ZZCA 3UKAA 1TDEA 5EB5A 1K0IA 1VDCA 3AEAA 3L1RA 4ADWA 3AE5A 2F5ZA 1GRHA 3FG2P 3SZFA 1OJAA 4XWRA 2GVCA 3B3RA 5L46A 5LV9A 1RSGA 2XFNA 1E1MA 4B69A 4GRTA 2WESA 2YLZA 3GRTA 4EMJA 2W0HA 2XYOA 4JDRA 3CNJA 1H81A 4EMIA 4CCRA 4PABA 3M12A 3SXIA 3EAOA 1S3BA 4NTCA 3SFDA 3VRDB 2JB2A 4AOSA 1E1NA 1BZLA 1LTXR 3AE1A 1TRBA 3II4A 4TM0A 4XXGA 3KA7A 4C3XA 1GNDA 2XLUA 1OJ9A 1GREA 1Y56B 3CGDA 5FS8A 3AE6A 2JK6A 2WOWA 2CULA 3BHKA 4K7ZA 3AEFA 1F6MA 3URHA 3ZYXA 3GMCA 4B68A 1XDIA 1GV4A 4UP3A 4UDQA 5DBJA 5FMHA 4EQSA 2VVLA 3DGZA 1XANA 4B65A 1VG9A 2R4JA 3KVEA 1QLBA 2V5ZA 5EB4A 1PBDA 1EL8A 5IQ4A 3VR8A 2YAUA 1GESA 2BS2A 1JRXA 2XFPA 3REDA 2BXSA 1YY5A 3KU9A 4B63A 4USRA 1RP0A 4WCTA 4J2WA 2Q6UA 4U8JA 3LXDA 4UDRA 3LADA 1OJTA 3DK9A 5M10A 4X4JA 1UKVG 1S2YA 3F8PA 3GRSA 1PJ6A 3PVCA 1FL2A 3P9UA 2GH5A 3AEGA 1NAAA 3K7MX 1LV0A 2XVHA 2YVJA 4Z2UA 2NPXA 4AT0A 1ZY8A 3LB8A 3NN0X 1PBFA 4GUVA 4NEVA 3RP7A 1KF6A 3K7TA 1E1LA 1PDHA 4XWZA 5JCLA 2WP9A 1P2HA 4BV6A 2XVJA 2WETA 1IUWA 5HHFA 1PXAA 2WP6A 4M52A 2WOVA 2A87A 4JY3A 1NG4A 5GSNA 4Z43A 1IUTA 4OPLA 5BRTA 1D5TA 2RGJA 4JQ9A 2GR3A 2V60A 2R9ZA 4J36A 3VRAA 4GF7A 5KVHA 2B76A 3RP6A 2GV8A 1IUUA 2YLWA 3GMBA 5KMSA 1MXTA 5JCNA 5KNLA 1H7XA 4NTDA 1F8WA 2YM2A 4YSXA 2BA9A 4C5OA 2C65A 3H4KA 5IQ1A 3VR9A 1JEHA 1GERA 1ZDLA 4H4VA 5FS7A 1BGJA 1GT8A 2GAGB 1F8SA 2XVFA 2YG7A 3BI4A 3CPJG 1CL0A 1GSNA 2ZZBA 2UZZA 2YQUA 3AEEA 1REOA 3FMWA 3GDPA 4OCGA 3VRBA 1ZX9A 4U2SA 2C64A 3ICSA 3CNDA 4LA1A 2BK3A 4RG4A 3D1CA 3HYVA 1H7WA 2XLTA 1EL7A 1H83A 1H84A 3M0OA 3OC4A 2JKCA 1LQTA 4U2TA 3T31A 4A79A 3SQPA 2WDRA 4APNA 1Q1WA 1K4QA 3AE3A 3CPHG 2GB0A 4U2LA 1EBDA 3AEBA 2V3AA 2C70A 2GQFA 3QSSA 3T2KA 1CJ3A 1N4UA 2BCGG 1GEUA 3NT6A 4H4WA 5U1OA 3GD3A 3QFAA 4C77A 1FEBA 1B4VA 4B67A 2BK5A 3AYJA 3V76A 2XVEA 2Y6RA 1PXCA 2BC0A 1K0JA 2R0CA 3CMMA 3RHAA 4U8IA 1PBEA 4X9NA 4YSYA 2B7RA 4TLXA 4FK1C 4OPTA 1YKJA 4CNJA 1JRZA 5KOWA 2B7SA 3NHOX 4GR1A 2XFUA 4G73A 1EL5A 5U63A 4G9KA 2X8HA 5KMRA 3NG7X 4Z44A 5CQFA 1S3EA 1JOAA 2FJBA 3DK4A 4NWZA 4A65A 1YQ4A 3NYCA 2WS3A 4JN9A 5KOXA 4YT0A 1NDAA 3T2YA 2EQ6A 3CNSA 1PJ7A 4C74A 5M0ZA 4YSZA 3JSKA 4CY6A 3DK8A 2WHDA 4B1BA 4J31A 4A6NA 5JCIA 4REKA 3O0HA 4J57A 1D4DA 2C76A 4DSHA 2X8CA 3GSIA 2EQ7A 2YM1A 4EM4A 1EL9A 4O5QA 3IHGA 1JRYA 1JNZA 3SX6A 4H4PA 2FBWA 2DKHA 4U8PA 2B9YA 1CJCA 2QAEA 3ZDNA 1MOKA 4FK1A 2E1MA 2E5VA 2BXRA 2WQYA 2YLSA 3AYIA 3I3LA 1X31B 3ICTA 4IVMB 3AE8A 1H82A 4K8DA 3BI5A 1IUSA 4NNJA 4U8KA 3UTGA 1GRGA 4IVOB 1FEAA 1PHHA 1ZMCA 2XLPA 2YR4A 3BHFA 3C4NA 3CGEA 3M13A 4FX9A 4K2XA 2IVEA 4K5SA 5KMQA 2XFQA 3P4SA 4II3A 2BC1A 4WX1A 3VQRA 4GDPA 4B66A 1DJNA 4H2RA 5KRQA 2YLTA 1ZKQA 1YQ3A 3NK0X 4H7UA 1FOHA 3AEDA 1CC2A 4USQA 1F3PA 4N9XA 5U25A 4H4SA 2R46A 3NYEA 3Q6JA 2C67A 3GD4A 4MJWA 3SZWA 2V6OA 1NHQA 2R45A 4YTMA 1L9EA 2Q0LA 2EQ8A 2ARDA 1BGNA 3GWDA 3UTEA 4GAPA 1BF3A 3AD8B 2AQJA 3SZCA 4YTNA 1XHCA 2XCGA 2VQBA 1FCDA 3ALMA 4CY8A 3PO7A 3DJDA 2H89A 2VRLA 3QSEA 3CIRA 3UKLA 1P2EA 3EANA 1HYUA 2FJDA 2GEWA 1CC6A 1KNPA 1V59A 4BK2A 3UOXA 4B64A 2QA1A 2YG6A 2R0PA 3AECA 4AP3A 3GWFA 3FIMB 4Y4MA 1NHRA 3UKHA 2BS4A 2BABA 3BNMA 3T14A 1NPXA 1VRQB 4UDPA 4DSGA 5FS9A 2A8XA 1GRBA 3PS9A 4FDCB 1N4WA 2VVMA 3NLCA 3SGLA 3UKQA 1D7LA 5HXIA 2VQ7A 1L9DA 2C7GA 2C66A 2XVIA 4AP1A 3NRNA 3UP5A 1D4EA 3AWIA 4Y4LA 4JNQA 4II2A 3IC9A 1PN0A 4H4TA 3DMEA 3C96A 3GYXA 3KLJA 2YVGA 3CN8A 4ZCCA 4Z26A 1NHPA 5BUKA 4EQRA 3RP8A 4JY2A 1W4XA 5BULA 4NEWA 1CBOA 1NENA 2VZ2A 1ZMDA 4E0VA 2I0ZA 4A9WA 2RGOA 3Q9TA 3BI2A 3H8IA 1PJ5A 2C4CA 1COYA 2TMDA 2XLRA 3GDNA 1MO9A 5HY5A 2C3DA 2WEUA 4LIIA 3NYFA 1KFYA 1LJ1A 2JB3A 4Z2RA 3DJGX 2WDVA 3UTHA 2Y6QA 4I58A 4OPUA 1GRFA 2YG3A 3UKPA 3QVPA 3QJ4A 2GAHB 3DH9A 4EM3A 4EIPA 3ICRA 3HZLA 1L0VA 3T0KA 3LZXA 3RNMA 1GOSA 1Q1RA 4U8NA 2V3BA 3IF9A 3LOVA 4A5LA 2WU5A 2WPFA 4CBQA 4YSHA 5HYMA 5IPYA 1N1PA 2WPEA 1BKWA 4EMWA 1NEKA 3SFEA 3KD9A 2A89A 1DOEA 5ER0A 2BK4A 1PXBA 2JB1A 2GQWA 4P9SA 5KWFA 3QFBA 4DNAA 2GMJA 3NIXA 2VVLG 3SY4A 3AE7A 1TDFA 4BK3A 2B9XA 1GXFA 1CJ2A 2X50A 1K0LA 3COXA 3HYXA 1H6VA 2GMHA 3I6DA 4HB9A 5JCKA 1H86A 1M6IA 4KX6A 4U8LA 1L9CA 4YTPA 1DOCA 1N4VA 3EF6A 1LVLA 2NVKX 4TLZA 1ZP0A 2O9ZA 3NKSA 4RG3A 1KNRA 4BJZA 3T2ZA 4LU6A 3P1WA 3KPKA 3UKKA 2JAEA 3KKJA 3P4PA 4YKFA 4AT2A 3NK1X 3QVRA 3K7QX 2QA2A 3NTDA 3NTAA 4G74A 5KVIA 3V3OA 3FBSA 1DODA 2BRAA 5J60A 3ATRA 4TM4A 3EPTA 5EOWA 2BACA 5JCMA 2R4EA 1SEZA 3SM8A 1Q9IA 2Z5XA 1DOBA 4A6NB 2IIDA 3S5WA 4A7AA 3LJPA 4DGKA 2HQMA 3AE4A 5EBKA 2YWLA 3S61A 2YVFA 1O94A 1KDGA 3DJJA 3F8DA 1M64A 1Y56A 2BS3A 4GCMA 2RABA 1E6EA 1GALA 2WP5A 3ADAB 4PAAA 3V3NA 1LQUA 4G6GA 3H8LA 3CPIG 1GRTA 3AB1A 3DA1A 3SYIA 2CFYA 1O95A 2GR1A 2YG5A 4RSLA 2AAQA 4H2NA 1YQZA 4OPDA 3G5QA 4EQXA 4K5RA 4O5UA 4H4XA 2FJEA 3K30A 3NN6X 3NGCX 3GYJA 2WDQA 1DNCA 2AR8A 2YLXA 5C2TA 4CCQA 2X3NA 1E7PA 2Q7VA 3HYWA 3CGBA 3T37A 3IWAA 2R0GA 2YG4A 3ABVA 3SZ0A 3CNTA 2PYXA 3WE0A 3P4QA 3UOZA 4BURA 1ZK7A 2OALA 1GTEA 1GETA 3UKFA 4I59A 2V61A 3KPFA 2OLNA 1Y0PA 4K22A 1TDOA 4KPRA 1PS9A 4OVIA 4NTEA 2CDUA 1TDNA 4TM3A 3AE2A 2WOIA 1CC4A 4ECHA 4GDEA 2CVJA 1GRAA 3AD9B 4CRTA 4U8OA 2ACZA 1BWCA 1B37A 3DGHA 4HA6A 1TYTA 1ZOYA 2C75A 2JBVA 4JNAA 2C3CA 1AOGA 3UTFA 4ICYA 2XLSA 3G5SA 2WPCA 2XFOA 3QSMA 1D4CA 4AOXA 5FS6A 5BVAA 2RGHA 2TPRA 1NG3A 1VG0A 4IV9A 4BJYA 1E39A 2B9WA 1OJCA 3UOVA 4H4ZA 4H50A 3NNEA 1ONFA 2OAMA 1JU2A 3GYIA 2YLRA 2WU2A 3R9UA 2E4GA 1ZOVA 1PBBA 2OA1A 4H4QA 4OPGA 4Z24A 3AXBA 3G5RA 5GRTA 4A99A 4OPIA 4Z25A 1B8SA 3IHMA 1QJDA 1DJQA 4J56A 4TM1A 2DKIA 4J34A 2H88A 4H4YA 4YXDA 3OZ2A 4G6HA 3NK2X 3ALJA 3ATQA 2YR6A 2PHHA 2IVDA 1CJ4A 1IJHA 4U8MA 5C3JA 3CGCA 3B6DA 3UOYA 3C4AA 1OJDA 1IUXA 2YR5A 5CKUA 5J7XA 4EIQA 2GR2A 3AYLA 3E1TA 2GF3A 4IA6A 3UCLA 2C73A 4YKGA 1PBCA 2XDOA 1KSSA 4H2PA 1ELIA 1O5WA 4IA5A 1TDKA 2BCPA 2Z5YA 3CTYA 2GRTA 1XPQA 3D8XA 4C3YA 4CNKA 3FPZA 1QO8A 3CNPA 4X9MA 3AD7B 5TR3A 1GPEA 1VQWA 3ITJA 1KSUA 4ZCDA 1DXLA 1F8RA 2VRMA 1E1KA 4OPCA 1RYIA 3F8RA 1FECA 1CHUA 3DJEA 2OLOA 2ZZ0A 4ZN0A 1S2QA 1LPFA 2WBAA 1GTHA 4J33A 2GR0A 4YWOA 3ISHA 4H4UA 1TYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D03 A;  3L8K A;  4Z2T A;  3NH3 X;  2FJA A;  4H2Q A;  3UP4 A;  2ZBW A;  1NHS A;  2X8G A;  2VOU A;  2X99 A;  4NZH A;  3BNU A;  1B5Q A;  4EQW A;  2QCU A;  2Q0K A;  3P4R A;  3AE9 A;  1Z6L A;  4H4R A;  1D7Y A;  3ALL A;  2EQ9 A;  1IUV A;  2J3N A;  2BYB A;  5KXJ A;  1CF3 A;  4D04 A;  1JNR A;  2APG A;  3LZW A;  2C72 A;  4Y4N A;  4BK1 A;  2ZZC A;  3UKA A;  1TDE A;  5EB5 A;  1K0I A;  1VDC A;  3AEA A;  3L1R A;  4ADW A;  3AE5 A;  2F5Z A;  1GRH A;  3FG2 P;  1OJA A;  4XWR A;  2GVC A;  3B3R A;  5L46 A;  5LV9 A;  1RSG A;  2XFN A;  1E1M A;  4B69 A;  4GRT A;  2WES A;  2YLZ A;  3GRT A;  4EMJ A;  2W0H A;  2XYO A;  4JDR A;  3CNJ A;  1H81 A;  4EMI A;  4CCR A;  4PAB A;  3M12 A;  3EAO A;  1S3B A;  4NTC A;  3SFD A;  3VRD B;  2JB2 A;  4AOS A;  1E1N A;  1BZL A;  1LTX R;  3AE1 A;  1TRB A;  3II4 A;  4TM0 A;  4XXG A;  3KA7 A;  4C3X A;  1GND A;  2XLU A;  1OJ9 A;  1GRE A;  1Y56 B;  3CGD A;  5FS8 A;  3AE6 A;  2JK6 A;  2WOW A;  2CUL A;  3BHK A;  4K7Z A;  3AEF A;  1F6M A;  3URH A;  3ZYX A;  3GMC A;  4B68 A;  1XDI A;  1GV4 A;  4UP3 A;  4UDQ A;  5DBJ A;  5FMH A;  4EQS A;  2VVL A;  3DGZ A;  1XAN A;  4B65 A;  1VG9 A;  2R4J A;  3KVE A;  1QLB A;  2V5Z A;  5EB4 A;  1PBD A;  1EL8 A;  5IQ4 A;  3VR8 A;  2YAU A;  1GES A;  2BS2 A;  1JRX A;  2XFP A;  3RED A;  2BXS A;  1YY5 A;  3KU9 A;  4B63 A;  4USR A;  1RP0 A;  4WCT A;  4J2W A;  2Q6U A;  4U8J A;  3LXD A;  4UDR A;  3LAD A;  1OJT A;  3DK9 A;  5M10 A;  4X4J A;  1UKV G;  1S2Y A;  3F8P A;  3GRS A;  1PJ6 A;  3PVC A;  1FL2 A;  3P9U A;  2GH5 A;  3AEG A;  1NAA A;  3K7M X;  1LV0 A;  2XVH A;  2YVJ A;  4Z2U A;  2NPX A;  4AT0 A;  1ZY8 A;  3LB8 A;  3NN0 X;  1PBF A;  4GUV A;  4NEV A;  3RP7 A;  1KF6 A;  3K7T A;  1E1L A;  1PDH A;  4XWZ A;  5JCL A;  2WP9 A;  1P2H A;  4BV6 A;  2XVJ A;  2WET A;  1IUW A;  5HHF A;  1PXA A;  2WP6 A;  4M52 A;  2WOV A;  2A87 A;  4JY3 A;  1NG4 A;  5GSN A;  4Z43 A;  1IUT A;  4OPL A;  5BRT A;  1D5T A;  2RGJ A;  4JQ9 A;  2GR3 A;  2V60 A;  2R9Z A;  4J36 A;  3VRA A;  4GF7 A;  5KVH A;  2B76 A;  3RP6 A;  2GV8 A;  1IUU A;  2YLW A;  3GMB A;  1MXT A;  5JCN A;  1H7X A;  4NTD A;  1F8W A;  2YM2 A;  4YSX A;  2BA9 A;  4C5O A;  2C65 A;  3H4K A;  5IQ1 A;  3VR9 A;  1JEH A;  1GER A;  1ZDL A;  4H4V A;  5FS7 A;  1BGJ A;  1GT8 A;  2GAG B;  1F8S A;  2XVF A;  2YG7 A;  3BI4 A;  3CPJ G;  1CL0 A;  1GSN A;  2ZZB A;  2UZZ A;  2YQU A;  3AEE A;  1REO A;  3FMW A;  3GDP A;  4OCG A;  3VRB A;  1ZX9 A;  4U2S A;  2C64 A;  3ICS A;  3CND A;  4LA1 A;  2BK3 A;  4RG4 A;  3D1C A;  3OC4 A;  1H7W A;  2XLT A;  1EL7 A;  1H83 A;  1H84 A;  3M0O A;  4A79 A;  2JKC A;  1LQT A;  4U2T A;  3SQP A;  2WDR A;  4APN A;  1Q1W A;  1K4Q A;  3AE3 A;  3CPH G;  2GB0 A;  4U2L A;  1EBD A;  3AEB A;  2V3A A;  2C70 A;  2GQF A;  3QSS A;  1CJ3 A;  1N4U A;  2BCG G;  1GEU A;  3NT6 A;  4H4W A;  5U1O A;  3GD3 A;  3QFA A;  4C77 A;  1FEB A;  1B4V A;  4B67 A;  2BK5 A;  3AYJ A;  3V76 A;  2XVE A;  2Y6R A;  1PXC A;  2BC0 A;  1K0J A;  2R0C A;  3RHA A;  4U8I A;  1PBE A;  4X9N A;  4YSY A;  2B7R A;  4TLX A;  4FK1 C;  4OPT A;  1YKJ A;  4CNJ A;  1JRZ A;  5KOW A;  2B7S A;  3NHO X;  4GR1 A;  2XFU A;  1EL5 A;  5U63 A;  2X8H A;  3NG7 X;  4Z44 A;  5CQF A;  1S3E A;  1JOA A;  2FJB A;  3DK4 A;  4A65 A;  1YQ4 A;  3NYC A;  2WS3 A;  4JN9 A;  5KOX A;  4YT0 A;  1NDA A;  2EQ6 A;  3CNS A;  1PJ7 A;  4C74 A;  5M0Z A;  4YSZ A;  3JSK A;  4CY6 A;  3DK8 A;  2WHD A;  4B1B A;  4J31 A;  4A6N A;  5JCI A;  4REK A;  3O0H A;  4J57 A;  1D4D A;  2C76 A;  4DSH A;  2X8C A;  3GSI A;  2EQ7 A;  2YM1 A;  4EM4 A;  1EL9 A;  4O5Q A;  3IHG A;  1JRY A;  1JNZ A;  4H4P A;  2FBW A;  2DKH A;  4U8P A;  2B9Y A;  1CJC A;  2QAE A;  3ZDN A;  1MOK A;  4FK1 A;  2E1M A;  2E5V A;  2BXR A;  2WQY A;  2YLS A;  3AYI A;  3I3L A;  1X31 B;  3ICT A;  4IVM B;  3AE8 A;  1H82 A;  4K8D A;  3BI5 A;  1IUS A;  4U8K A;  3UTG A;  1GRG A;  4IVO B;  1FEA A;  1PHH A;  1ZMC A;  2XLP A;  2YR4 A;  3BHF A;  3C4N A;  3CGE A;  3M13 A;  4FX9 A;  4K2X A;  2IVE A;  4K5S A;  2XFQ A;  3P4S A;  2BC1 A;  4WX1 A;  3VQR A;  4GDP A;  4B66 A;  1DJN A;  4H2R A;  5KRQ A;  2YLT A;  1ZKQ A;  1YQ3 A;  3NK0 X;  4H7U A;  1FOH A;  3AED A;  1CC2 A;  4USQ A;  1F3P A;  4N9X A;  5U25 A;  4H4S A;  2R46 A;  3NYE A;  3Q6J A;  2C67 A;  3GD4 A;  4MJW A;  2V6O A;  1NHQ A;  2R45 A;  4YTM A;  1L9E A;  2Q0L A;  2EQ8 A;  2ARD A;  1BGN A;  3GWD A;  3UTE A;  1BF3 A;  3AD8 B;  2AQJ A;  4YTN A;  1XHC A;  2XCG A;  2VQB A;  1FCD A;  3ALM A;  4CY8 A;  3PO7 A;  3DJD A;  2H89 A;  2VRL A;  3QSE A;  3CIR A;  3UKL A;  1P2E A;  3EAN A;  1HYU A;  2FJD A;  2GEW A;  1CC6 A;  1KNP A;  1V59 A;  4BK2 A;  3UOX A;  4B64 A;  2QA1 A;  2YG6 A;  2R0P A;  3AEC A;  4AP3 A;  3GWF A;  3FIM B;  4Y4M A;  1NHR A;  3UKH A;  2BS4 A;  2BAB A;  3BNM A;  1NPX A;  1VRQ B;  4UDP A;  4DSG A;  5FS9 A;  2A8X A;  1GRB A;  3PS9 A;  4FDC B;  1N4W A;  2VVM A;  3NLC A;  3SGL A;  3UKQ A;  1D7L A;  5HXI A;  2VQ7 A;  1L9D A;  2C7G A;  2C66 A;  2XVI A;  4AP1 A;  3NRN A;  3UP5 A;  1D4E A;  3AWI A;  4Y4L A;  4JNQ A;  3IC9 A;  1PN0 A;  4H4T A;  3DME A;  3C96 A;  3KLJ A;  2YVG A;  3CN8 A;  4ZCC A;  4Z26 A;  1NHP A;  5BUK A;  4EQR A;  3RP8 A;  4JY2 A;  1W4X A;  5BUL A;  4NEW A;  1CBO A;  1NEN A;  2VZ2 A;  1ZMD A;  4E0V A;  2I0Z A;  4A9W A;  2RGO A;  3Q9T A;  3BI2 A;  3H8I A;  1PJ5 A;  2XLR A;  1COY A;  2TMD A;  3GDN A;  1MO9 A;  5HY5 A;  2C3D A;  2WEU A;  4LII A;  3NYF A;  1KFY A;  1LJ1 A;  2JB3 A;  4Z2R A;  3DJG X;  2WDV A;  3UTH A;  2Y6Q A;  4I58 A;  4OPU A;  1GRF A;  2YG3 A;  3UKP A;  3QVP A;  3QJ4 A;  2GAH B;  3DH9 A;  4EM3 A;  4EIP A;  3ICR A;  3HZL A;  1L0V A;  3LZX A;  3RNM A;  1GOS A;  1Q1R A;  4U8N A;  2V3B A;  3IF9 A;  3LOV A;  4A5L A;  2WU5 A;  2WPF A;  4CBQ A;  4YSH A;  5HYM A;  5IPY A;  1N1P A;  2WPE A;  1BKW A;  4EMW A;  1NEK A;  3SFE A;  3KD9 A;  2A89 A;  1DOE A;  5ER0 A;  2BK4 A;  1PXB A;  2JB1 A;  2GQW A;  4P9S A;  5KWF A;  3QFB A;  4DNA A;  2GMJ A;  3NIX A;  2VVL G;  3AE7 A;  1TDF A;  4BK3 A;  2B9X A;  1GXF A;  1CJ2 A;  2X50 A;  1K0L A;  3COX A;  5JCK A;  1H6V A;  2GMH A;  3I6D A;  4HB9 A;  1H86 A;  1M6I A;  4KX6 A;  4U8L A;  1L9C A;  4YTP A;  1DOC A;  1N4V A;  3EF6 A;  1LVL A;  2NVK X;  4TLZ A;  1ZP0 A;  2O9Z A;  3NKS A;  4RG3 A;  1KNR A;  4BJZ A;  4LU6 A;  3P1W A;  3UKK A;  2JAE A;  3KKJ A;  3P4P A;  4YKF A;  4AT2 A;  3NK1 X;  3QVR A;  3K7Q X;  2QA2 A;  3NTD A;  3NTA A;  5KVI A;  3V3O A;  3FBS A;  1DOD A;  5J60 A;  3ATR A;  4TM4 A;  3EPT A;  5EOW A;  2BAC A;  5JCM A;  2R4E A;  1SEZ A;  3SM8 A;  1Q9I A;  2Z5X A;  1DOB A;  4A6N B;  2IID A;  3S5W A;  4A7A A;  3LJP A;  4DGK A;  2HQM A;  3AE4 A;  5EBK A;  2YWL A;  3S61 A;  2YVF A;  1O94 A;  1KDG A;  3DJJ A;  3F8D A;  1M64 A;  1Y56 A;  2BS3 A;  4GCM A;  2RAB A;  1E6E A;  1GAL A;  2WP5 A;  3ADA B;  4PAA A;  3V3N A;  1LQU A;  3H8L A;  3CPI G;  1GRT A;  3AB1 A;  3DA1 A;  2CFY A;  1O95 A;  2GR1 A;  2YG5 A;  4RSL A;  2AAQ A;  4H2N A;  1YQZ A;  4OPD A;  3G5Q A;  4EQX A;  4K5R A;  4O5U A;  4H4X A;  2FJE A;  3K30 A;  3NN6 X;  3NGC X;  3GYJ A;  2WDQ A;  1DNC A;  2AR8 A;  2YLX A;  5C2T A;  4CCQ A;  2X3N A;  1E7P A;  2Q7V A;  3CGB A;  3T37 A;  3IWA A;  2R0G A;  2YG4 A;  3ABV A;  3CNT A;  2PYX A;  3WE0 A;  3P4Q A;  3UOZ A;  4BUR A;  1ZK7 A;  2OAL A;  1GTE A;  1GET A;  3UKF A;  4I59 A;  2V61 A;  3KPF A;  2OLN A;  1Y0P A;  4K22 A;  1TDO A;  4KPR A;  1PS9 A;  4OVI A;  4NTE A;  2CDU A;  1TDN A;  4TM3 A;  3AE2 A;  2WOI A;  1CC4 A;  4ECH A;  4GDE A;  2CVJ A;  1GRA A;  3AD9 B;  4CRT A;  4U8O A;  2ACZ A;  1BWC A;  1B37 A;  3DGH A;  4HA6 A;  1TYT A;  1ZOY A;  2C75 A;  2JBV A;  4JNA A;  2C3C A;  1AOG A;  3UTF A;  4ICY A;  2XLS A;  3G5S A;  2WPC A;  2XFO A;  3QSM A;  1D4C A;  4AOX A;  5FS6 A;  5BVA A;  2RGH A;  2TPR A;  1NG3 A;  1VG0 A;  4IV9 A;  4BJY A;  1E39 A;  2B9W A;  1OJC A;  3UOV A;  4H4Z A;  4H50 A;  3NNE A;  1ONF A;  2OAM A;  1JU2 A;  3GYI A;  2YLR A;  2WU2 A;  3R9U A;  2E4G A;  1ZOV A;  1PBB A;  2OA1 A;  4H4Q A;  4OPG A;  4Z24 A;  3AXB A;  3G5R A;  5GRT A;  4A99 A;  4OPI A;  4Z25 A;  1B8S A;  3IHM A;  1QJD A;  1DJQ A;  4J56 A;  4TM1 A;  2DKI A;  4J34 A;  2H88 A;  4H4Y A;  4YXD A;  3OZ2 A;  3NK2 X;  3ALJ A;  3ATQ A;  2YR6 A;  2PHH A;  2IVD A;  1CJ4 A;  1IJH A;  4U8M A;  5C3J A;  3CGC A;  3B6D A;  3UOY A;  3C4A A;  1OJD A;  1IUX A;  2YR5 A;  5CKU A;  5J7X A;  4EIQ A;  2GR2 A;  3AYL A;  3E1T A;  2GF3 A;  4IA6 A;  3UCL A;  2C73 A;  4YKG A;  1PBC A;  2XDO A;  1KSS A;  4H2P A;  1ELI A;  1O5W A;  4IA5 A;  1TDK A;  2BCP A;  2Z5Y A;  3CTY A;  2GRT A;  1XPQ A;  3D8X A;  4C3Y A;  4CNK A;  3FPZ A;  1QO8 A;  3CNP A;  4X9M A;  3AD7 B;  5TR3 A;  1GPE A;  1VQW A;  3ITJ A;  1KSU A;  4ZCD A;  1DXL A;  1F8R A;  2VRM A;  1E1K A;  4OPC A;  1RYI A;  3F8R A;  1FEC A;  1CHU A;  3DJE A;  2OLO A;  2ZZ0 A;  4ZN0 A;  1S2Q A;  1LPF A;  2WBA A;  1GTH A;  4J33 A;  2GR0 A;  4YWO A;  3ISH A;  4H4U A;  1TYP A; 
#chains in the Genus database with same CATH topology
 4D03 A;  3L8K A;  4Z2T A;  2BRY A;  3NH3 X;  2FJA A;  4H2Q A;  4GAV A;  3UP4 A;  2ZBW A;  1NHS A;  5KMP A;  2X8G A;  2VOU A;  2X99 A;  4NZH A;  3BNU A;  1B5Q A;  4EQW A;  2QCU A;  2Q0K A;  3P4R A;  3AE9 A;  1Z6L A;  4H4R A;  1D7Y A;  3ALL A;  2EQ9 A;  1IUV A;  2J3N A;  2BYB A;  5KXJ A;  1CF3 A;  4D04 A;  1JNR A;  2APG A;  3LZW A;  2C72 A;  4Y4N A;  4BK1 A;  2ZZC A;  3UKA A;  1TDE A;  5EB5 A;  1K0I A;  1VDC A;  3AEA A;  3L1R A;  4ADW A;  3AE5 A;  2F5Z A;  1GRH A;  3FG2 P;  3SZF A;  1OJA A;  4XWR A;  2GVC A;  3B3R A;  5L46 A;  5LV9 A;  1RSG A;  2XFN A;  1E1M A;  4B69 A;  4GRT A;  2WES A;  2YLZ A;  3GRT A;  4EMJ A;  2W0H A;  2XYO A;  4JDR A;  3CNJ A;  1H81 A;  4EMI A;  4CCR A;  4PAB A;  3M12 A;  3SXI A;  3EAO A;  1S3B A;  4NTC A;  3SFD A;  3VRD B;  2JB2 A;  4AOS A;  1E1N A;  1BZL A;  1LTX R;  3AE1 A;  1TRB A;  3II4 A;  4TM0 A;  4XXG A;  3KA7 A;  4C3X A;  1GND A;  2XLU A;  1OJ9 A;  1GRE A;  1Y56 B;  3CGD A;  5FS8 A;  3AE6 A;  2JK6 A;  2WOW A;  2CUL A;  3BHK A;  4K7Z A;  3AEF A;  1F6M A;  3URH A;  3ZYX A;  3GMC A;  4B68 A;  1XDI A;  1GV4 A;  4UP3 A;  4UDQ A;  5DBJ A;  5FMH A;  4EQS A;  2VVL A;  3DGZ A;  1XAN A;  4B65 A;  1VG9 A;  2R4J A;  3KVE A;  1QLB A;  2V5Z A;  5EB4 A;  1PBD A;  1EL8 A;  5IQ4 A;  3VR8 A;  2YAU A;  1GES A;  2BS2 A;  1JRX A;  2XFP A;  3RED A;  2BXS A;  1YY5 A;  3KU9 A;  4B63 A;  4USR A;  1RP0 A;  4WCT A;  4J2W A;  2Q6U A;  4U8J A;  3LXD A;  4UDR A;  3LAD A;  1OJT A;  3DK9 A;  5M10 A;  4X4J A;  1UKV G;  1S2Y A;  3F8P A;  3GRS A;  1PJ6 A;  3PVC A;  1FL2 A;  3P9U A;  2GH5 A;  3AEG A;  1NAA A;  3K7M X;  1LV0 A;  2XVH A;  2YVJ A;  4Z2U A;  2NPX A;  4AT0 A;  1ZY8 A;  3LB8 A;  3NN0 X;  1PBF A;  4GUV A;  4NEV A;  3RP7 A;  1KF6 A;  3K7T A;  1E1L A;  1PDH A;  4XWZ A;  5JCL A;  2WP9 A;  1P2H A;  4BV6 A;  2XVJ A;  2WET A;  1IUW A;  5HHF A;  1PXA A;  2WP6 A;  4M52 A;  2WOV A;  2A87 A;  4JY3 A;  1NG4 A;  5GSN A;  4Z43 A;  1IUT A;  4OPL A;  5BRT A;  1D5T A;  2RGJ A;  4JQ9 A;  2GR3 A;  2V60 A;  2R9Z A;  4J36 A;  3VRA A;  4GF7 A;  5KVH A;  2B76 A;  3RP6 A;  2GV8 A;  1IUU A;  2YLW A;  3GMB A;  5KMS A;  1MXT A;  5JCN A;  5KNL A;  1H7X A;  4NTD A;  1F8W A;  2YM2 A;  4YSX A;  2BA9 A;  4C5O A;  2C65 A;  3H4K A;  5IQ1 A;  3VR9 A;  1JEH A;  1GER A;  1ZDL A;  4H4V A;  5FS7 A;  1BGJ A;  1GT8 A;  2GAG B;  1F8S A;  2XVF A;  2YG7 A;  3BI4 A;  3CPJ G;  1CL0 A;  1GSN A;  2ZZB A;  2UZZ A;  2YQU A;  3AEE A;  1REO A;  3FMW A;  3GDP A;  4OCG A;  3VRB A;  1ZX9 A;  4U2S A;  2C64 A;  3ICS A;  3CND A;  4LA1 A;  2BK3 A;  4RG4 A;  3D1C A;  3HYV A;  1H7W A;  2XLT A;  1EL7 A;  1H83 A;  1H84 A;  3M0O A;  3OC4 A;  2JKC A;  1LQT A;  4U2T A;  3T31 A;  4A79 A;  3SQP A;  2WDR A;  4APN A;  1Q1W A;  1K4Q A;  3AE3 A;  3CPH G;  2GB0 A;  4U2L A;  1EBD A;  3AEB A;  2V3A A;  2C70 A;  2GQF A;  3QSS A;  3T2K A;  1CJ3 A;  1N4U A;  2BCG G;  1GEU A;  3NT6 A;  4H4W A;  5U1O A;  3GD3 A;  3QFA A;  4C77 A;  1FEB A;  1B4V A;  4B67 A;  2BK5 A;  3AYJ A;  3V76 A;  2XVE A;  2Y6R A;  1PXC A;  2BC0 A;  1K0J A;  2R0C A;  3CMM A;  3RHA A;  4U8I A;  1PBE A;  4X9N A;  4YSY A;  2B7R A;  4TLX A;  4FK1 C;  4OPT A;  1YKJ A;  4CNJ A;  1JRZ A;  5KOW A;  2B7S A;  3NHO X;  4GR1 A;  2XFU A;  4G73 A;  1EL5 A;  5U63 A;  4G9K A;  2X8H A;  5KMR A;  3NG7 X;  4Z44 A;  5CQF A;  1S3E A;  1JOA A;  2FJB A;  3DK4 A;  4NWZ A;  4A65 A;  1YQ4 A;  3NYC A;  2WS3 A;  4JN9 A;  5KOX A;  4YT0 A;  1NDA A;  3T2Y A;  2EQ6 A;  3CNS A;  1PJ7 A;  4C74 A;  5M0Z A;  4YSZ A;  3JSK A;  4CY6 A;  3DK8 A;  2WHD A;  4B1B A;  4J31 A;  4A6N A;  5JCI A;  4REK A;  3O0H A;  4J57 A;  1D4D A;  2C76 A;  4DSH A;  2X8C A;  3GSI A;  2EQ7 A;  2YM1 A;  4EM4 A;  1EL9 A;  4O5Q A;  3IHG A;  1JRY A;  1JNZ A;  3SX6 A;  4H4P A;  2FBW A;  2DKH A;  4U8P A;  2B9Y A;  1CJC A;  2QAE A;  3ZDN A;  1MOK A;  4FK1 A;  2E1M A;  2E5V A;  2BXR A;  2WQY A;  2YLS A;  3AYI A;  3I3L A;  1X31 B;  3ICT A;  4IVM B;  3AE8 A;  1H82 A;  4K8D A;  3BI5 A;  1IUS A;  4NNJ A;  4U8K A;  3UTG A;  1GRG A;  4IVO B;  1FEA A;  1PHH A;  1ZMC A;  2XLP A;  2YR4 A;  3BHF A;  3C4N A;  3CGE A;  3M13 A;  4FX9 A;  4K2X A;  2IVE A;  4K5S A;  5KMQ A;  2XFQ A;  3P4S A;  4II3 A;  2BC1 A;  4WX1 A;  3VQR A;  4GDP A;  4B66 A;  1DJN A;  4H2R A;  5KRQ A;  2YLT A;  1ZKQ A;  1YQ3 A;  3NK0 X;  4H7U A;  1FOH A;  3AED A;  1CC2 A;  4USQ A;  1F3P A;  4N9X A;  5U25 A;  4H4S A;  2R46 A;  3NYE A;  3Q6J A;  2C67 A;  3GD4 A;  4MJW A;  3SZW A;  2V6O A;  1NHQ A;  2R45 A;  4YTM A;  1L9E A;  2Q0L A;  2EQ8 A;  2ARD A;  1BGN A;  3GWD A;  3UTE A;  4GAP A;  1BF3 A;  3AD8 B;  2AQJ A;  3SZC A;  4YTN A;  1XHC A;  2XCG A;  2VQB A;  1FCD A;  3ALM A;  4CY8 A;  3PO7 A;  3DJD A;  2H89 A;  2VRL A;  3QSE A;  3CIR A;  3UKL A;  1P2E A;  3EAN A;  1HYU A;  2FJD A;  2GEW A;  1CC6 A;  1KNP A;  1V59 A;  4BK2 A;  3UOX A;  4B64 A;  2QA1 A;  2YG6 A;  2R0P A;  3AEC A;  4AP3 A;  3GWF A;  3FIM B;  4Y4M A;  1NHR A;  3UKH A;  2BS4 A;  2BAB A;  3BNM A;  3T14 A;  1NPX A;  1VRQ B;  4UDP A;  4DSG A;  5FS9 A;  2A8X A;  1GRB A;  3PS9 A;  4FDC B;  1N4W A;  2VVM A;  3NLC A;  3SGL A;  3UKQ A;  1D7L A;  5HXI A;  2VQ7 A;  1L9D A;  2C7G A;  2C66 A;  2XVI A;  4AP1 A;  3NRN A;  3UP5 A;  1D4E A;  3AWI A;  4Y4L A;  4JNQ A;  4II2 A;  3IC9 A;  1PN0 A;  4H4T A;  3DME A;  3C96 A;  3GYX A;  3KLJ A;  2YVG A;  3CN8 A;  4ZCC A;  4Z26 A;  1NHP A;  5BUK A;  4EQR A;  3RP8 A;  4JY2 A;  1W4X A;  5BUL A;  4NEW A;  1CBO A;  1NEN A;  2VZ2 A;  1ZMD A;  4E0V A;  2I0Z A;  4A9W A;  2RGO A;  3Q9T A;  3BI2 A;  3H8I A;  1PJ5 A;  2C4C A;  1COY A;  2TMD A;  2XLR A;  3GDN A;  1MO9 A;  5HY5 A;  2C3D A;  2WEU A;  4LII A;  3NYF A;  1KFY A;  1LJ1 A;  2JB3 A;  4Z2R A;  3DJG X;  2WDV A;  3UTH A;  2Y6Q A;  4I58 A;  4OPU A;  1GRF A;  2YG3 A;  3UKP A;  3QVP A;  3QJ4 A;  2GAH B;  3DH9 A;  4EM3 A;  4EIP A;  3ICR A;  3HZL A;  1L0V A;  3T0K A;  3LZX A;  3RNM A;  1GOS A;  1Q1R A;  4U8N A;  2V3B A;  3IF9 A;  3LOV A;  4A5L A;  2WU5 A;  2WPF A;  4CBQ A;  4YSH A;  5HYM A;  5IPY A;  1N1P A;  2WPE A;  1BKW A;  4EMW A;  1NEK A;  3SFE A;  3KD9 A;  2A89 A;  1DOE A;  5ER0 A;  2BK4 A;  1PXB A;  2JB1 A;  2GQW A;  4P9S A;  5KWF A;  3QFB A;  4DNA A;  2GMJ A;  3NIX A;  2VVL G;  3SY4 A;  3AE7 A;  1TDF A;  4BK3 A;  2B9X A;  1GXF A;  1CJ2 A;  2X50 A;  1K0L A;  3COX A;  3HYX A;  1H6V A;  2GMH A;  3I6D A;  4HB9 A;  5JCK A;  1H86 A;  1M6I A;  4KX6 A;  4U8L A;  1L9C A;  4YTP A;  1DOC A;  1N4V A;  3EF6 A;  1LVL A;  2NVK X;  4TLZ A;  1ZP0 A;  2O9Z A;  3NKS A;  4RG3 A;  1KNR A;  4BJZ A;  3T2Z A;  4LU6 A;  3P1W A;  3KPK A;  3UKK A;  2JAE A;  3KKJ A;  3P4P A;  4YKF A;  4AT2 A;  3NK1 X;  3QVR A;  3K7Q X;  2QA2 A;  3NTD A;  3NTA A;  4G74 A;  5KVI A;  3V3O A;  3FBS A;  1DOD A;  2BRA A;  5J60 A;  3ATR A;  4TM4 A;  3EPT A;  5EOW A;  2BAC A;  5JCM A;  2R4E A;  1SEZ A;  3SM8 A;  1Q9I A;  2Z5X A;  1DOB A;  4A6N B;  2IID A;  3S5W A;  4A7A A;  3LJP A;  4DGK A;  2HQM A;  3AE4 A;  5EBK A;  2YWL A;  3S61 A;  2YVF A;  1O94 A;  1KDG A;  3DJJ A;  3F8D A;  1M64 A;  1Y56 A;  2BS3 A;  4GCM A;  2RAB A;  1E6E A;  1GAL A;  2WP5 A;  3ADA B;  4PAA A;  3V3N A;  1LQU A;  4G6G A;  3H8L A;  3CPI G;  1GRT A;  3AB1 A;  3DA1 A;  3SYI A;  2CFY A;  1O95 A;  2GR1 A;  2YG5 A;  4RSL A;  2AAQ A;  4H2N A;  1YQZ A;  4OPD A;  3G5Q A;  4EQX A;  4K5R A;  4O5U A;  4H4X A;  2FJE A;  3K30 A;  3NN6 X;  3NGC X;  3GYJ A;  2WDQ A;  1DNC A;  2AR8 A;  2YLX A;  5C2T A;  4CCQ A;  2X3N A;  1E7P A;  2Q7V A;  3HYW A;  3CGB A;  3T37 A;  3IWA A;  2R0G A;  2YG4 A;  3ABV A;  3SZ0 A;  3CNT A;  2PYX A;  3WE0 A;  3P4Q A;  3UOZ A;  4BUR A;  1ZK7 A;  2OAL A;  1GTE A;  1GET A;  3UKF A;  4I59 A;  2V61 A;  3KPF A;  2OLN A;  1Y0P A;  4K22 A;  1TDO A;  4KPR A;  1PS9 A;  4OVI A;  4NTE A;  2CDU A;  1TDN A;  4TM3 A;  3AE2 A;  2WOI A;  1CC4 A;  4ECH A;  4GDE A;  2CVJ A;  1GRA A;  3AD9 B;  4CRT A;  4U8O A;  2ACZ A;  1BWC A;  1B37 A;  3DGH A;  4HA6 A;  1TYT A;  1ZOY A;  2C75 A;  2JBV A;  4JNA A;  2C3C A;  1AOG A;  3UTF A;  4ICY A;  2XLS A;  3G5S A;  2WPC A;  2XFO A;  3QSM A;  1D4C A;  4AOX A;  5FS6 A;  5BVA A;  2RGH A;  2TPR A;  1NG3 A;  1VG0 A;  4IV9 A;  4BJY A;  1E39 A;  2B9W A;  1OJC A;  3UOV A;  4H4Z A;  4H50 A;  3NNE A;  1ONF A;  2OAM A;  1JU2 A;  3GYI A;  2YLR A;  2WU2 A;  3R9U A;  2E4G A;  1ZOV A;  1PBB A;  2OA1 A;  4H4Q A;  4OPG A;  4Z24 A;  3AXB A;  3G5R A;  5GRT A;  4A99 A;  4OPI A;  4Z25 A;  1B8S A;  3IHM A;  1QJD A;  1DJQ A;  4J56 A;  4TM1 A;  2DKI A;  4J34 A;  2H88 A;  4H4Y A;  4YXD A;  3OZ2 A;  4G6H A;  3NK2 X;  3ALJ A;  3ATQ A;  2YR6 A;  2PHH A;  2IVD A;  1CJ4 A;  1IJH A;  4U8M A;  5C3J A;  3CGC A;  3B6D A;  3UOY A;  3C4A A;  1OJD A;  1IUX A;  2YR5 A;  5CKU A;  5J7X A;  4EIQ A;  2GR2 A;  3AYL A;  3E1T A;  2GF3 A;  4IA6 A;  3UCL A;  2C73 A;  4YKG A;  1PBC A;  2XDO A;  1KSS A;  4H2P A;  1ELI A;  1O5W A;  4IA5 A;  1TDK A;  2BCP A;  2Z5Y A;  3CTY A;  2GRT A;  1XPQ A;  3D8X A;  4C3Y A;  4CNK A;  3FPZ A;  1QO8 A;  3CNP A;  4X9M A;  3AD7 B;  5TR3 A;  1GPE A;  1VQW A;  3ITJ A;  1KSU A;  4ZCD A;  1DXL A;  1F8R A;  2VRM A;  1E1K A;  4OPC A;  1RYI A;  3F8R A;  1FEC A;  1CHU A;  3DJE A;  2OLO A;  2ZZ0 A;  4ZN0 A;  1S2Q A;  1LPF A;  2WBA A;  1GTH A;  4J33 A;  2GR0 A;  4YWO A;  3ISH A;  4H4U A;  1TYP A; 
#chains in the Genus database with same CATH homology
 4D03 A;  3L8K A;  4Z2T A;  2BRY A;  3NH3 X;  2FJA A;  4H2Q A;  4GAV A;  3UP4 A;  2ZBW A;  1NHS A;  5KMP A;  2X8G A;  2VOU A;  2X99 A;  4NZH A;  3BNU A;  1B5Q A;  4EQW A;  2QCU A;  2Q0K A;  3P4R A;  3AE9 A;  1Z6L A;  4H4R A;  1D7Y A;  3ALL A;  2EQ9 A;  1IUV A;  2J3N A;  2BYB A;  5KXJ A;  1CF3 A;  4D04 A;  1JNR A;  2APG A;  3LZW A;  2C72 A;  4Y4N A;  4BK1 A;  2ZZC A;  3UKA A;  1TDE A;  5EB5 A;  1K0I A;  1VDC A;  3AEA A;  3L1R A;  4ADW A;  3AE5 A;  2F5Z A;  1GRH A;  3FG2 P;  3SZF A;  1OJA A;  4XWR A;  2GVC A;  3B3R A;  5L46 A;  5LV9 A;  1RSG A;  2XFN A;  1E1M A;  4B69 A;  4GRT A;  2WES A;  2YLZ A;  3GRT A;  4EMJ A;  2W0H A;  2XYO A;  4JDR A;  3CNJ A;  1H81 A;  4EMI A;  4CCR A;  4PAB A;  3M12 A;  3SXI A;  3EAO A;  1S3B A;  4NTC A;  3SFD A;  3VRD B;  2JB2 A;  4AOS A;  1E1N A;  1BZL A;  1LTX R;  3AE1 A;  1TRB A;  3II4 A;  4TM0 A;  4XXG A;  3KA7 A;  4C3X A;  1GND A;  2XLU A;  1OJ9 A;  1GRE A;  1Y56 B;  3CGD A;  5FS8 A;  3AE6 A;  2JK6 A;  2WOW A;  2CUL A;  3BHK A;  4K7Z A;  3AEF A;  1F6M A;  3URH A;  3ZYX A;  3GMC A;  4B68 A;  1XDI A;  1GV4 A;  4UP3 A;  4UDQ A;  5DBJ A;  5FMH A;  4EQS A;  2VVL A;  3DGZ A;  1XAN A;  4B65 A;  1VG9 A;  2R4J A;  3KVE A;  1QLB A;  2V5Z A;  5EB4 A;  1PBD A;  1EL8 A;  5IQ4 A;  3VR8 A;  2YAU A;  1GES A;  2BS2 A;  1JRX A;  2XFP A;  3RED A;  2BXS A;  1YY5 A;  3KU9 A;  4B63 A;  4USR A;  1RP0 A;  4WCT A;  4J2W A;  2Q6U A;  4U8J A;  3LXD A;  4UDR A;  3LAD A;  1OJT A;  3DK9 A;  5M10 A;  4X4J A;  1UKV G;  1S2Y A;  3F8P A;  3GRS A;  1PJ6 A;  3PVC A;  1FL2 A;  3P9U A;  2GH5 A;  3AEG A;  1NAA A;  3K7M X;  1LV0 A;  2XVH A;  2YVJ A;  4Z2U A;  2NPX A;  4AT0 A;  1ZY8 A;  3LB8 A;  3NN0 X;  1PBF A;  4GUV A;  4NEV A;  3RP7 A;  1KF6 A;  3K7T A;  1E1L A;  1PDH A;  4XWZ A;  5JCL A;  2WP9 A;  1P2H A;  4BV6 A;  2XVJ A;  2WET A;  1IUW A;  5HHF A;  1PXA A;  2WP6 A;  4M52 A;  2WOV A;  2A87 A;  4JY3 A;  1NG4 A;  5GSN A;  4Z43 A;  1IUT A;  4OPL A;  5BRT A;  1D5T A;  2RGJ A;  4JQ9 A;  2GR3 A;  2V60 A;  2R9Z A;  4J36 A;  3VRA A;  4GF7 A;  5KVH A;  2B76 A;  3RP6 A;  2GV8 A;  1IUU A;  2YLW A;  3GMB A;  5KMS A;  1MXT A;  5JCN A;  5KNL A;  1H7X A;  4NTD A;  1F8W A;  2YM2 A;  4YSX A;  2BA9 A;  4C5O A;  2C65 A;  3H4K A;  5IQ1 A;  3VR9 A;  1JEH A;  1GER A;  1ZDL A;  4H4V A;  5FS7 A;  1BGJ A;  1GT8 A;  2GAG B;  1F8S A;  2XVF A;  2YG7 A;  3BI4 A;  3CPJ G;  1CL0 A;  1GSN A;  2ZZB A;  2UZZ A;  2YQU A;  3AEE A;  1REO A;  3FMW A;  3GDP A;  4OCG A;  3VRB A;  1ZX9 A;  4U2S A;  2C64 A;  3ICS A;  3CND A;  4LA1 A;  2BK3 A;  4RG4 A;  3D1C A;  3HYV A;  1H7W A;  2XLT A;  1EL7 A;  1H83 A;  1H84 A;  3M0O A;  3OC4 A;  2JKC A;  1LQT A;  4U2T A;  3T31 A;  4A79 A;  3SQP A;  2WDR A;  4APN A;  1Q1W A;  1K4Q A;  3AE3 A;  3CPH G;  2GB0 A;  4U2L A;  1EBD A;  3AEB A;  2V3A A;  2C70 A;  2GQF A;  3QSS A;  3T2K A;  1CJ3 A;  1N4U A;  2BCG G;  1GEU A;  3NT6 A;  4H4W A;  5U1O A;  3GD3 A;  3QFA A;  4C77 A;  1FEB A;  1B4V A;  4B67 A;  2BK5 A;  3AYJ A;  3V76 A;  2XVE A;  2Y6R A;  1PXC A;  2BC0 A;  1K0J A;  2R0C A;  3CMM A;  3RHA A;  4U8I A;  1PBE A;  4X9N A;  4YSY A;  2B7R A;  4TLX A;  4FK1 C;  4OPT A;  1YKJ A;  4CNJ A;  1JRZ A;  5KOW A;  2B7S A;  3NHO X;  4GR1 A;  2XFU A;  4G73 A;  1EL5 A;  5U63 A;  4G9K A;  2X8H A;  5KMR A;  3NG7 X;  4Z44 A;  5CQF A;  1S3E A;  1JOA A;  2FJB A;  3DK4 A;  4NWZ A;  4A65 A;  1YQ4 A;  3NYC A;  2WS3 A;  4JN9 A;  5KOX A;  4YT0 A;  1NDA A;  3T2Y A;  2EQ6 A;  3CNS A;  1PJ7 A;  4C74 A;  5M0Z A;  4YSZ A;  3JSK A;  4CY6 A;  3DK8 A;  2WHD A;  4B1B A;  4J31 A;  4A6N A;  5JCI A;  4REK A;  3O0H A;  4J57 A;  1D4D A;  2C76 A;  4DSH A;  2X8C A;  3GSI A;  2EQ7 A;  2YM1 A;  4EM4 A;  1EL9 A;  4O5Q A;  3IHG A;  1JRY A;  1JNZ A;  3SX6 A;  4H4P A;  2FBW A;  2DKH A;  4U8P A;  2B9Y A;  1CJC A;  2QAE A;  3ZDN A;  1MOK A;  4FK1 A;  2E1M A;  2E5V A;  2BXR A;  2WQY A;  2YLS A;  3AYI A;  3I3L A;  1X31 B;  3ICT A;  4IVM B;  3AE8 A;  1H82 A;  4K8D A;  3BI5 A;  1IUS A;  4NNJ A;  4U8K A;  3UTG A;  1GRG A;  4IVO B;  1FEA A;  1PHH A;  1ZMC A;  2XLP A;  2YR4 A;  3BHF A;  3C4N A;  3CGE A;  3M13 A;  4FX9 A;  4K2X A;  2IVE A;  4K5S A;  5KMQ A;  2XFQ A;  3P4S A;  4II3 A;  2BC1 A;  4WX1 A;  3VQR A;  4GDP A;  4B66 A;  1DJN A;  4H2R A;  5KRQ A;  2YLT A;  1ZKQ A;  1YQ3 A;  3NK0 X;  4H7U A;  1FOH A;  3AED A;  1CC2 A;  4USQ A;  1F3P A;  4N9X A;  5U25 A;  4H4S A;  2R46 A;  3NYE A;  3Q6J A;  2C67 A;  3GD4 A;  4MJW A;  3SZW A;  2V6O A;  1NHQ A;  2R45 A;  4YTM A;  1L9E A;  2Q0L A;  2EQ8 A;  2ARD A;  1BGN A;  3GWD A;  3UTE A;  4GAP A;  1BF3 A;  3AD8 B;  2AQJ A;  3SZC A;  4YTN A;  1XHC A;  2XCG A;  2VQB A;  1FCD A;  3ALM A;  4CY8 A;  3PO7 A;  3DJD A;  2H89 A;  2VRL A;  3QSE A;  3CIR A;  3UKL A;  1P2E A;  3EAN A;  1HYU A;  2FJD A;  2GEW A;  1CC6 A;  1KNP A;  1V59 A;  4BK2 A;  3UOX A;  4B64 A;  2QA1 A;  2YG6 A;  2R0P A;  3AEC A;  4AP3 A;  3GWF A;  3FIM B;  4Y4M A;  1NHR A;  3UKH A;  2BS4 A;  2BAB A;  3BNM A;  3T14 A;  1NPX A;  1VRQ B;  4UDP A;  4DSG A;  5FS9 A;  2A8X A;  1GRB A;  3PS9 A;  4FDC B;  1N4W A;  2VVM A;  3NLC A;  3SGL A;  3UKQ A;  1D7L A;  5HXI A;  2VQ7 A;  1L9D A;  2C7G A;  2C66 A;  2XVI A;  4AP1 A;  3NRN A;  3UP5 A;  1D4E A;  3AWI A;  4Y4L A;  4JNQ A;  4II2 A;  3IC9 A;  1PN0 A;  4H4T A;  3DME A;  3C96 A;  3GYX A;  3KLJ A;  2YVG A;  3CN8 A;  4ZCC A;  4Z26 A;  1NHP A;  5BUK A;  4EQR A;  3RP8 A;  4JY2 A;  1W4X A;  5BUL A;  4NEW A;  1CBO A;  1NEN A;  2VZ2 A;  1ZMD A;  4E0V A;  2I0Z A;  4A9W A;  2RGO A;  3Q9T A;  3BI2 A;  3H8I A;  1PJ5 A;  2C4C A;  1COY A;  2TMD A;  2XLR A;  3GDN A;  1MO9 A;  5HY5 A;  2C3D A;  2WEU A;  4LII A;  3NYF A;  1KFY A;  1LJ1 A;  2JB3 A;  4Z2R A;  3DJG X;  2WDV A;  3UTH A;  2Y6Q A;  4I58 A;  4OPU A;  1GRF A;  2YG3 A;  3UKP A;  3QVP A;  3QJ4 A;  2GAH B;  3DH9 A;  4EM3 A;  4EIP A;  3ICR A;  3HZL A;  1L0V A;  3T0K A;  3LZX A;  3RNM A;  1GOS A;  1Q1R A;  4U8N A;  2V3B A;  3IF9 A;  3LOV A;  4A5L A;  2WU5 A;  2WPF A;  4CBQ A;  4YSH A;  5HYM A;  5IPY A;  1N1P A;  2WPE A;  1BKW A;  4EMW A;  1NEK A;  3SFE A;  3KD9 A;  2A89 A;  1DOE A;  5ER0 A;  2BK4 A;  1PXB A;  2JB1 A;  2GQW A;  4P9S A;  5KWF A;  3QFB A;  4DNA A;  2GMJ A;  3NIX A;  2VVL G;  3SY4 A;  3AE7 A;  1TDF A;  4BK3 A;  2B9X A;  1GXF A;  1CJ2 A;  2X50 A;  1K0L A;  3COX A;  3HYX A;  1H6V A;  2GMH A;  3I6D A;  4HB9 A;  5JCK A;  1H86 A;  1M6I A;  4KX6 A;  4U8L A;  1L9C A;  4YTP A;  1DOC A;  1N4V A;  3EF6 A;  1LVL A;  2NVK X;  4TLZ A;  1ZP0 A;  2O9Z A;  3NKS A;  4RG3 A;  1KNR A;  4BJZ A;  3T2Z A;  4LU6 A;  3P1W A;  3KPK A;  3UKK A;  2JAE A;  3KKJ A;  3P4P A;  4YKF A;  4AT2 A;  3NK1 X;  3QVR A;  3K7Q X;  2QA2 A;  3NTD A;  3NTA A;  4G74 A;  5KVI A;  3V3O A;  3FBS A;  1DOD A;  2BRA A;  5J60 A;  3ATR A;  4TM4 A;  3EPT A;  5EOW A;  2BAC A;  5JCM A;  2R4E A;  1SEZ A;  3SM8 A;  1Q9I A;  2Z5X A;  1DOB A;  4A6N B;  2IID A;  3S5W A;  4A7A A;  3LJP A;  4DGK A;  2HQM A;  3AE4 A;  5EBK A;  2YWL A;  3S61 A;  2YVF A;  1O94 A;  1KDG A;  3DJJ A;  3F8D A;  1M64 A;  1Y56 A;  2BS3 A;  4GCM A;  2RAB A;  1E6E A;  1GAL A;  2WP5 A;  3ADA B;  4PAA A;  3V3N A;  1LQU A;  4G6G A;  3H8L A;  3CPI G;  1GRT A;  3AB1 A;  3DA1 A;  3SYI A;  2CFY A;  1O95 A;  2GR1 A;  2YG5 A;  4RSL A;  2AAQ A;  4H2N A;  1YQZ A;  4OPD A;  3G5Q A;  4EQX A;  4K5R A;  4O5U A;  4H4X A;  2FJE A;  3K30 A;  3NN6 X;  3NGC X;  3GYJ A;  2WDQ A;  1DNC A;  2AR8 A;  2YLX A;  5C2T A;  4CCQ A;  2X3N A;  1E7P A;  2Q7V A;  3HYW A;  3CGB A;  3T37 A;  3IWA A;  2R0G A;  2YG4 A;  3ABV A;  3SZ0 A;  3CNT A;  2PYX A;  3WE0 A;  3P4Q A;  3UOZ A;  4BUR A;  1ZK7 A;  2OAL A;  1GTE A;  1GET A;  3UKF A;  4I59 A;  2V61 A;  3KPF A;  2OLN A;  1Y0P A;  4K22 A;  1TDO A;  4KPR A;  1PS9 A;  4OVI A;  4NTE A;  2CDU A;  1TDN A;  4TM3 A;  3AE2 A;  2WOI A;  1CC4 A;  4ECH A;  4GDE A;  2CVJ A;  1GRA A;  3AD9 B;  4CRT A;  4U8O A;  2ACZ A;  1BWC A;  1B37 A;  3DGH A;  4HA6 A;  1TYT A;  1ZOY A;  2C75 A;  2JBV A;  4JNA A;  2C3C A;  1AOG A;  3UTF A;  4ICY A;  2XLS A;  3G5S A;  2WPC A;  2XFO A;  3QSM A;  1D4C A;  4AOX A;  5FS6 A;  5BVA A;  2RGH A;  2TPR A;  1NG3 A;  1VG0 A;  4IV9 A;  4BJY A;  1E39 A;  2B9W A;  1OJC A;  3UOV A;  4H4Z A;  4H50 A;  3NNE A;  1ONF A;  2OAM A;  1JU2 A;  3GYI A;  2YLR A;  2WU2 A;  3R9U A;  2E4G A;  1ZOV A;  1PBB A;  2OA1 A;  4H4Q A;  4OPG A;  4Z24 A;  3AXB A;  3G5R A;  5GRT A;  4A99 A;  4OPI A;  4Z25 A;  1B8S A;  3IHM A;  1QJD A;  1DJQ A;  4J56 A;  4TM1 A;  2DKI A;  4J34 A;  2H88 A;  4H4Y A;  4YXD A;  3OZ2 A;  4G6H A;  3NK2 X;  3ALJ A;  3ATQ A;  2YR6 A;  2PHH A;  2IVD A;  1CJ4 A;  1IJH A;  4U8M A;  5C3J A;  3CGC A;  3B6D A;  3UOY A;  3C4A A;  1OJD A;  1IUX A;  2YR5 A;  5CKU A;  5J7X A;  4EIQ A;  2GR2 A;  3AYL A;  3E1T A;  2GF3 A;  4IA6 A;  3UCL A;  2C73 A;  4YKG A;  1PBC A;  2XDO A;  1KSS A;  4H2P A;  1ELI A;  1O5W A;  4IA5 A;  1TDK A;  2BCP A;  2Z5Y A;  3CTY A;  2GRT A;  1XPQ A;  3D8X A;  4C3Y A;  4CNK A;  3FPZ A;  1QO8 A;  3CNP A;  4X9M A;  3AD7 B;  5TR3 A;  1GPE A;  1VQW A;  3ITJ A;  1KSU A;  4ZCD A;  1DXL A;  1F8R A;  2VRM A;  1E1K A;  4OPC A;  1RYI A;  3F8R A;  1FEC A;  1CHU A;  3DJE A;  2OLO A;  2ZZ0 A;  4ZN0 A;  1S2Q A;  1LPF A;  2WBA A;  1GTH A;  4J33 A;  2GR0 A;  4YWO A;  3ISH A;  4H4U A;  1TYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...