5EOWA

Crystal structure of 6-hydroxynicotinic acid 3-monooxygenase from pseudomonas putida kt2440
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
372
structure length
353
Chain Sequence
QKIAIVGAGLGGAAAATLLQQAGFDVEVFEQAPAFTRLGAGIHIGPNVMKIFRRMGLEQKLELMGSHPDFWFSRDGNTGDYLSRIPLGEFARREYGAAYITIHRGDLHALQIEAIQPGTVHFGKRLEKIDQVRLDFADGTHTVADIVIGADGIHSKIREELLGAEAPYSGWVAHRALIRQHADVFEPCVKWWSEDRHMMVYYTTGKRDEYYFVTGVPHVDSSQEEMRAAFEGYHPTVQKLIDATESITKWPLRNRNPLPLWSRGRLVLLGDACHPMKPHMAQGACMAIEDAAMLTRCLQETGLSDHRTAFALYEANRKERASQVQSVSNANTWLYSQEDPAWVYGYDLYGQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxynicotinate 3-monooxygenase
publication title Structural and Biochemical Characterization of 6-Hydroxynicotinic Acid 3-Monooxygenase, A Novel Decarboxylative Hydroxylase Involved in Aerobic Nicotinate Degradation.
pubmed doi rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Oxidoreductase
total genus 108
structure length 353
sequence length 372
ec nomenclature ec 1.14.13.114: 6-hydroxynicotinate 3-monooxygenase.
pdb deposition date 2015-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5eowA00
2GMJA 5HXIA 2YR4A 4ADWA 4U8MA 1EL7A 4AT0A 1ZP0A 4LIIA 1PDHA 1N1PA 3UCLA 4D04A 1E7PA 1Q1RA 3V3OA 2AAQA 3CGEA 4H2RA 3CGCA 4H4QA 1XPQA 1GEUA 1B8SA 1OJDA 2Q0KA 5C2TA 3T37A 4O5QA 1COYA 3S61A 4CCRA 2TPRA 1JOAA 1TRBA 3DJGX 1F8SA 4H4TA 1E6EA 2H89A 4APNA 5KOWA 2XVEA 3DGZA 3I6DA 5LV9A 2WOVA 3SQPA 2YVJA 1DOBA 4CNJA 3C4NA 5GRTA 3DJDA 2YG3A 1JRZA 3LOVA 1CL0A 2E1MA 3SGLA 2C65A 4RSLA 3D1CA 5GSNA 1RSGA 2C70A 2B9XA 5C3JA 3NT6A 1ZK7A 3AE3A 3UKPA 4U2SA 2YLXA 4A7AA 3CN8A 1VG0A 4JDRA 1BZLA 2EQ9A 1YQ3A 3NRNA 1ZOYA 2GR2A 2C67A 2R9ZA 4OVIA 3ALMA 2ZBWA 1QJDA 4OPLA 2YG7A 2EQ7A 1FOHA 4GRTA 3UOZA 2YG6A 1BGJA 2OLNA 2R4EA 3AEEA 2JB1A 2OAMA 3GWDA 4FDCB 4K8DA 2GQWA 3AXBA 1DODA 2GB0A 4REKA 4YTMA 1GXFA 2YG4A 4H4PA 3GYIA 4Z2TA 3NN0X 3AE8A 3NYEA 3NIXA 4PABA 4C3YA 2YVFA 1H81A 2RGJA 3ICSA 1JU2A 4FK1C 2V6OA 3NYFA 1OJTA 1PXCA 1LPFA 3AD8B 3DK9A 2R46A 4B68A 4CY8A 4TM0A 3NGCX 1PJ7A 4DGKA 1ZKQA 1HYUA 4EM3A 3QVPA 4H4SA 2R4JA 2GEWA 2BXRA 5EBKA 5L46A 3UP4A 2BCPA 4JQ9A 3UTHA 1XANA 3VQRA 2BK4A 2YLSA 3RHAA 4LA1A 5KWFA 2F5ZA 3VRDB 1LQTA 3IC9A 2GR1A 3G5QA 1OJAA 4H4ZA 4H2PA 3H8IA 1H83A 1PXAA 4FX9A 4H4WA 3UTGA 3VR8A 4BURA 4NTCA 4CNKA 2XLTA 2WESA 4KPRA 1SEZA 1S2YA 5CKUA 4BJYA 1KFYA 1NG3A 3LJPA 4BK2A 4TLXA 3NK1X 3CNDA 3K7TA 4J33A 1GRHA 2YLWA 4OPGA 3UKHA 2BK5A 2E5VA 1GNDA 3NKSA 3GRTA 3ITJA 2BACA 2XLSA 1D4EA 2GMHA 5M0ZA 3QJ4A 5U25A 1CC2A 4H4XA 1KSUA 4U8KA 2WOWA 2ZZBA 3P4PA 4EQRA 1S3EA 4ZCCA 1VQWA 2FBWA 2GF3A 5IQ1A 2YWLA 1Q9IA 2WDQA 2WETA 4AOSA 3UTFA 4EM4A 1JNRA 1S3BA 4OCGA 2NPXA 1ZY8A 4GR1A 2B9YA 2FJAA 2XLPA 1ELIA 2EQ6A 4ECHA 4Y4LA 2CFYA 3NYCA 4Z44A 1F8RA 3FG2P 1EL5A 2X8HA 1K0JA 3AWIA 3UKFA 4YTPA 2C3DA 1BWCA 3C96A 2WQYA 2B7RA 1GRTA 1VRQB 3P4QA 3NN6X 4OPCA 2X50A 2AR8A 2XFUA 2JKCA 4B67A 4GUVA 1H6VA 4UDRA 4TM4A 1LVLA 2E4GA 1L9DA 2R45A 2WS3A 3P4SA 1LV0A 2APGA 1PN0A 2WP6A 4TM1A 3AE6A 2JK6A 3SM8A 3LB8A 2WPEA 1ONFA 3LZWA 1H86A 3KKJA 3VRAA 2YVGA 1GERA 2VRMA 1FECA 1NHQA 4HA6A 2GVCA 1LQUA 1XHCA 1GALA 5J60A 4GCMA 5HY5A 5IPYA 4XXGA 3RP6A 2C73A 2FJDA 3KPFA 2XFPA 3RP8A 1P2EA 5EB4A 2GR0A 4Y4NA 4B1BA 4UP3A 1D4DA 2ZZ0A 4NEVA 4XWZA 2YR5A 1L9EA 2BC1A 1CJ4A 1FEAA 2RABA 3JSKA 2VVLA 2XDOA 4FK1A 4OPUA 3ABVA 2GRTA 4RG3A 4Z26A 4B64A 2BA9A 1NPXA 1TYTA 3KLJA 2QCUA 2XLRA 3NNEA 4E0VA 4O5UA 1PXBA 3ICTA 4IV9A 5JCMA 1GRAA 2YR6A 3EPTA 3Q9TA 2XVIA 4EQXA 2Z5XA 2XVJA 2A8XA 2A87A 2WDVA 4X9MA 1N4WA 4AP3A 1PJ6A 1JRXA 1B4VA 2WEUA 3BI2A 3AE9A 4ZN0A 1REOA 2QA1A 4I59A 3QFAA 2X3NA 4YSHA 2V5ZA 3P4RA 2XCGA 2WOIA 4A5LA 2JBVA 3QFBA 1D4CA 3UOVA 1PBBA 5KVIA 3UTEA 4I58A 4CBQA 1NG4A 3CGBA 4H2QA 2GAHB 4Y4MA 1IUVA 4J34A 4U8JA 2YM1A 3HZLA 4WX1A 1DOCA 3AYLA 3NH3X 3M12A 5FS7A 1TDOA 1ZMCA 5FS8A 4U2TA 1EBDA 2GH5A 2WBAA 2C72A 3AD7B 2J3NA 4H4VA 4MJWA 1E1NA 2BC0A 3KVEA 4DNAA 2C76A 4EQSA 1H7XA 1E1KA 2O9ZA 5KVHA 4AOXA 5J7XA 2WP9A 4Z2RA 1RP0A 2CVJA 2VQ7A 3IHMA 3EF6A 3NTAA 3QSEA 1L0VA 4A6NA 1P2HA 4PAAA 4B66A 3LZXA 4USQA 4YKGA 3G5RA 2H88A 3VR9A 1YQZA 4YTNA 1TDNA 3DK4A 1F3PA 1OJCA 2R0GA 2XYOA 1KSSA 1Q1WA 4BV6A 2XFQA 2DKIA 3REDA 4C77A 1GTHA 2ZZCA 3AE5A 3NK2X 4CY6A 1OJ9A 1H7WA 2A89A 2YQUA 3AEAA 3QSSA 2V3BA 4GDPA 1YQ4A 3UOYA 4N9XA 1ZOVA 4EMIA 1NAAA 3CPHG 2WPCA 2C7GA 1PBEA 4X4JA 4YSZA 5HYMA 1PBDA 3GYJA 1GRFA 5U63A 4J2WA 3UOXA 3OZ2A 4CRTA 4DSGA 3UP5A 1PHHA 2Y6QA 2BS2A 4WCTA 5FMHA 5HHFA 2C75A 1D7LA 1CHUA 1D7YA 4C74A 2DKHA 1O94A 1W4XA 1JEHA 1GPEA 1IJHA 2X8CA 2VRLA 3GSIA 3ZYXA 2CULA 2B76A 3AB1A 3K30A 4JY3A 3UKAA 1X31B 3NHOX 1TDFA 4B65A 4GF7A 4YT0A 1Y56A 3GMBA 4RG4A 2OA1A 1TDEA 3NLCA 1GREA 3C4AA 1KNPA 4UDQA 3KA7A 1IUSA 2EQ8A 1M6IA 3BHFA 2WU2A 2ACZA 1MXTA 2Y6RA 2PHHA 1BGNA 3AE2A 1D5TA 2QAEA 3AE4A 4K5SA 4H50A 2QA2A 5BUKA 1AOGA 3CGDA 4A9WA 3AEFA 2XFNA 1QO8A 1DOEA 3CNTA 5ER0A 4JN9A 3AYIA 4K22A 4YSXA 5DBJA 5BULA 5BVAA 2YG5A 1K0LA 4USRA 1E39A 1FL2A 2YLRA 4EQWA 1F8WA 1MOKA 1M64A 4A65A 3H4KA 4YXDA 4U8IA 2TMDA 3K7MX 2C66A 4EIPA 4X9NA 1DNCA 1TYPA 5JCLA 4HB9A 3DK8A 3ZDNA 4Z24A 2FJEA 2VQBA 4EMWA 3P1WA 2AQJA 3K7QX 5FS6A 4TM3A 2WHDA 4A6NB 2B9WA 4U2LA 4JNQA 2V3AA 3LADA 3VRBA 1ZMDA 1S2QA 2GV8A 3BI4A 2JAEA 2Z5YA 4U8NA 2X8GA 1CC6A 1NDAA 3AEGA 4J36A 2BCGG 2CDUA 3EANA 3ICRA 4Z2UA 2IVDA 1ZDLA 1IUTA 1H82A 2GR3A 2RGOA 2WU5A 3D8XA 4NZHA 3CNJA 2C3CA 2RGHA 3CNSA 1VG9A 3FMWA 3R9UA 1Y0PA 2VOUA 5FS9A 3S5WA 2BK3A 3ATRA 3COXA 1E1MA 3KD9A 5JCKA 1VDCA 3CIRA 4J57A 2HQMA 1FCDA 3H8LA 4EIQA 4IA5A 4UDPA 4BK3A 2I0ZA 3GD3A 3DA1A 4IVMB 4J56A 4LU6A 3G5SA 4P9SA 1LJ1A 2R0PA 4K2XA 1FEBA 4IA6A 1N4VA 1NHRA 1EL8A 3UKKA 1GOSA 3ALLA 1EL9A 1ZX9A 2C64A 4OPDA 4BJZA 1NHPA 3BNMA 3DMEA 3M13A 3BHKA 1PS9A 4M52A 4A99A 5KOXA 4YKFA 2WPFA 1XDIA 1K4QA 1H84A 1Y56B 4AT2A 2VZ2A 1YKJA 4U8OA 2OALA 3AYJA 3PS9A 3GMCA 5JCNA 3BI5A 3CTYA 3ISHA 3L1RA 4TLZA 1GRGA 5EOWA 1L9CA 1PJ5A 3F8RA 3IHGA 5BRTA 2JB3A 2WDRA 3AE7A 1CF3A 1TDKA 3URHA 1E1LA 4OPTA 4ICYA 3GDPA 4BK1A 1UKVG 4H4RA 5CQFA 3GD4A 1PBCA 1F6MA 3DH9A 2Q0LA 4NTEA 4C5OA 2IVEA 3WE0A 3UKLA 2XFOA 4OPIA 4B69A 2GAGB 4K7ZA 3AE1A 3GWFA 3ATQA 2UZZA 3B3RA 2YAUA 2FJBA 4U8PA 4ZCDA 1IUWA 2GQFA 2B7SA 3FBSA 4JNAA 1GT8A 3RP7A 3SFEA 2PYXA 3KU9A 4D03A 2VVMA 3Q6JA 5EB5A 1KNRA 3M0OA 4KX6A 4XWRA 1DJQA 1CJCA 4AP1A 2YLZA 3CPJG 3F8PA 3NTDA 3QSMA 3CNPA 4GDEA 4J31A 2NVKX 3DGHA 4NEWA 5KRQA 1BKWA 3I3LA 3DJJA 2R0CA 4NTDA 4U8LA 5M10A 3DJEA 2BYBA 3E1TA 3AEDA 1NENA 4H7UA 3F8DA 1JNZA 4K5RA 1CBOA 1GTEA 3AECA 3AEBA 3P9UA 4Z43A 1GSNA 3V76A 1LTXR 2V61A 3FPZA 4H4UA 3BNUA 2VVLG 3PO7A 1CJ3A 2Q7VA 2W0HA 3IWAA 3IF9A 2BABA 2BS4A 4IVOB 4DSHA 1B5QA 1B37A 3AD9B 1BF3A 5U1OA 3EAOA 3SFDA 4CCQA 3II4A 2YM2A 4C3XA 2BS3A 1KDGA 1MO9A 3RNMA 1RYIA 1GESA 1V59A 3GDNA 2XVHA 4Z25A 3FIMB 1PBFA 1KF6A 3OC4A 1JRYA 1QLBA 2IIDA 3NK0X 4YSYA 5IQ4A 2BXSA 1GETA 2XLUA 3GRSA 1Z6LA 1NEKA 4A79A 3CPIG 2OLOA 1GRBA 1GV4A 1O5WA 2V60A 2X99A 3ADAB 5JCIA 2JB2A 3ALJA 3B6DA 2WP5A 5TR3A 1IUXA 3PVCA 3LXDA 4EMJA 3UKQA 2XVFA 3V3NA 1DJNA 1DXLA 1NHSA 1IUUA 4H4YA 1O95A 1CJ2A 3O0HA 4H2NA 4YWOA 2Q6UA 4JY2A 1K0IA 5KXJA 3QVRA 4B63A 3L8KA 2ARDA 1N4UA 3NG7X 2YLTA 1CC4A 1YY5A
chains in the Genus database with same CATH superfamily
2GMJA 5HXIA 2YR4A 4ADWA 4U8MA 1EL7A 4AT0A 1ZP0A 4LIIA 1PDHA 1N1PA 3UCLA 4D04A 1E7PA 1Q1RA 3V3OA 2AAQA 3CGEA 4H2RA 3CGCA 4H4QA 1XPQA 1GEUA 1B8SA 1OJDA 2Q0KA 5C2TA 3T37A 4O5QA 1COYA 3S61A 4CCRA 2TPRA 3T14A 1JOAA 1TRBA 3DJGX 1F8SA 4H4TA 1E6EA 2H89A 4APNA 4GAPA 5KOWA 2XVEA 3DGZA 3I6DA 5LV9A 2WOVA 3SQPA 2YVJA 1DOBA 4CNJA 3C4NA 5GRTA 3DJDA 2YG3A 1JRZA 3LOVA 1CL0A 2E1MA 3SGLA 2C65A 4RSLA 3D1CA 5GSNA 1RSGA 2C70A 2B9XA 5C3JA 3NT6A 1ZK7A 4G9KA 3AE3A 3UKPA 4U2SA 2YLXA 4A7AA 3CN8A 1VG0A 4JDRA 1BZLA 2EQ9A 1YQ3A 3NRNA 1ZOYA 2GR2A 2C67A 2R9ZA 3SZWA 4OVIA 3ALMA 2ZBWA 1QJDA 4OPLA 2YG7A 4II2A 2EQ7A 1FOHA 4GRTA 3UOZA 2YG6A 1BGJA 2OLNA 2R4EA 3AEEA 2JB1A 2OAMA 3GWDA 4FDCB 4K8DA 2GQWA 3AXBA 1DODA 2GB0A 4REKA 4YTMA 1GXFA 2YG4A 4H4PA 3GYIA 4Z2TA 3NN0X 3AE8A 3NYEA 3NIXA 4PABA 4C3YA 2YVFA 1H81A 2RGJA 3ICSA 1JU2A 4FK1C 2V6OA 3NYFA 1OJTA 1PXCA 1LPFA 3AD8B 3DK9A 2R46A 4B68A 4CY8A 4TM0A 3NGCX 1PJ7A 4DGKA 4G73A 1ZKQA 4II3A 1HYUA 4EM3A 3QVPA 4H4SA 2R4JA 2GEWA 2BXRA 5EBKA 5L46A 3UP4A 2BCPA 4JQ9A 3UTHA 1XANA 3VQRA 2BK4A 2YLSA 3RHAA 4LA1A 5KWFA 2F5ZA 3VRDB 1LQTA 3IC9A 2GR1A 3G5QA 1OJAA 4H4ZA 4H2PA 3H8IA 1H83A 1PXAA 4FX9A 4H4WA 3UTGA 3VR8A 4BURA 4NTCA 5KMPA 4CNKA 2XLTA 2WESA 4KPRA 1SEZA 1S2YA 5CKUA 4BJYA 1KFYA 1NG3A 3LJPA 4BK2A 4TLXA 3NK1X 3CNDA 3K7TA 4J33A 1GRHA 2YLWA 4OPGA 3UKHA 2BK5A 2E5VA 1GNDA 3NKSA 4NNJA 3GRTA 3ITJA 2BACA 2XLSA 1D4EA 2GMHA 5M0ZA 3QJ4A 5U25A 1CC2A 4H4XA 1KSUA 4U8KA 2WOWA 2ZZBA 3P4PA 4EQRA 1S3EA 4ZCCA 1VQWA 2FBWA 2GF3A 5IQ1A 2YWLA 1Q9IA 2WDQA 2WETA 4AOSA 3UTFA 4EM4A 1JNRA 1S3BA 4OCGA 2NPXA 1ZY8A 4GR1A 2B9YA 2FJAA 2XLPA 1ELIA 2EQ6A 4ECHA 4Y4LA 2CFYA 3NYCA 4Z44A 1F8RA 3FG2P 1EL5A 2X8HA 1K0JA 3AWIA 3UKFA 4YTPA 2C3DA 1BWCA 3C96A 2WQYA 2B7RA 1GRTA 1VRQB 3P4QA 3NN6X 4OPCA 2X50A 2AR8A 2XFUA 2JKCA 4B67A 4GUVA 1H6VA 4UDRA 4TM4A 1LVLA 2E4GA 1L9DA 2R45A 2WS3A 3P4SA 1LV0A 2APGA 1PN0A 2WP6A 4TM1A 3AE6A 2JK6A 3SM8A 3LB8A 2WPEA 1ONFA 3LZWA 1H86A 3KKJA 3VRAA 2YVGA 1GERA 2VRMA 1FECA 1NHQA 3HYVA 4HA6A 4NWZA 2GVCA 1LQUA 1XHCA 1GALA 5J60A 4GCMA 5HY5A 3SXIA 5IPYA 4XXGA 3RP6A 3T2ZA 2C73A 2FJDA 3KPFA 2XFPA 3RP8A 1P2EA 5EB4A 2GR0A 4Y4NA 4B1BA 4UP3A 1D4DA 2ZZ0A 4NEVA 4XWZA 2YR5A 1L9EA 2BC1A 1CJ4A 1FEAA 2RABA 3GYXA 2VVLA 2XDOA 3JSKA 4FK1A 4OPUA 3ABVA 2GRTA 3HYWA 4RG3A 4Z26A 4B64A 2BA9A 1NPXA 1TYTA 3KLJA 2QCUA 2XLRA 3NNEA 4E0VA 4O5UA 1PXBA 3ICTA 4IV9A 5JCMA 1GRAA 2YR6A 3EPTA 3Q9TA 2XVIA 4EQXA 2Z5XA 2XVJA 2A8XA 2A87A 2WDVA 4X9MA 1N4WA 4AP3A 1PJ6A 1JRXA 1B4VA 2WEUA 3BI2A 3AE9A 4ZN0A 1REOA 2QA1A 4I59A 3QFAA 4G74A 2X3NA 4YSHA 2V5ZA 3P4RA 2XCGA 2WOIA 4A5LA 2JBVA 3QFBA 1D4CA 3UOVA 1PBBA 5KVIA 3UTEA 4I58A 4CBQA 1NG4A 3CGBA 4G6GA 4H2QA 2GAHB 4Y4MA 1IUVA 4J34A 4U8JA 2YM1A 3HZLA 4WX1A 1DOCA 3AYLA 3NH3X 3T0KA 3M12A 5FS7A 3SX6A 1TDOA 1ZMCA 5FS8A 4U2TA 1EBDA 2GH5A 2WBAA 2C72A 3AD7B 2J3NA 4H4VA 4MJWA 1E1NA 2BC0A 3KVEA 4DNAA 2C76A 4EQSA 1H7XA 1E1KA 2O9ZA 5KVHA 4AOXA 5J7XA 2WP9A 4Z2RA 1RP0A 2CVJA 2VQ7A 3IHMA 3EF6A 3NTAA 3QSEA 1L0VA 4A6NA 1P2HA 4PAAA 4B66A 3LZXA 4USQA 4YKGA 3G5RA 2H88A 3VR9A 1YQZA 4YTNA 1TDNA 3DK4A 1F3PA 1OJCA 2R0GA 2XYOA 3T2YA 1KSSA 1Q1WA 4BV6A 2XFQA 2DKIA 3REDA 4C77A 1GTHA 2ZZCA 3AE5A 3NK2X 4CY6A 1OJ9A 1H7WA 2A89A 2YQUA 3AEAA 3QSSA 2V3BA 4GDPA 1YQ4A 3UOYA 4N9XA 1ZOVA 4EMIA 1NAAA 3CPHG 2WPCA 2C7GA 1PBEA 4X4JA 4YSZA 5HYMA 1PBDA 3GYJA 1GRFA 5U63A 4J2WA 3UOXA 3OZ2A 4CRTA 4DSGA 3UP5A 1PHHA 2Y6QA 2BS2A 4WCTA 5FMHA 5HHFA 2C75A 1D7LA 1CHUA 1D7YA 4C74A 2DKHA 5KMSA 1O94A 1W4XA 1JEHA 1GPEA 1IJHA 2X8CA 2VRLA 3GSIA 3ZYXA 2CULA 2B76A 3AB1A 3K30A 4JY3A 3UKAA 5KMRA 1X31B 3NHOX 1TDFA 4B65A 4GF7A 4YT0A 3SZCA 1Y56A 3GMBA 4RG4A 2OA1A 1TDEA 3NLCA 1GREA 3C4AA 1KNPA 4UDQA 3KA7A 1IUSA 2EQ8A 1M6IA 3BHFA 2WU2A 2ACZA 1MXTA 2Y6RA 2PHHA 1BGNA 3AE2A 1D5TA 2QAEA 3AE4A 4K5SA 4H50A 2QA2A 5BUKA 1AOGA 3CGDA 3CMMA 3AEFA 2XFNA 4A9WA 1QO8A 1DOEA 3CNTA 5ER0A 4JN9A 3AYIA 4K22A 4YSXA 5DBJA 5BULA 5BVAA 2YG5A 1K0LA 4USRA 1E39A 1FL2A 2YLRA 4EQWA 1F8WA 1MOKA 1M64A 4A65A 3H4KA 4YXDA 4U8IA 2TMDA 3K7MX 2C66A 4EIPA 4X9NA 1DNCA 1TYPA 5JCLA 4HB9A 3DK8A 3ZDNA 4Z24A 2FJEA 2VQBA 4EMWA 3P1WA 2AQJA 3K7QX 5FS6A 4TM3A 2WHDA 3T2KA 3HYXA 4A6NB 2B9WA 4U2LA 4JNQA 2V3AA 3LADA 3VRBA 1ZMDA 1S2QA 2GV8A 3BI4A 2JAEA 2Z5YA 4U8NA 2X8GA 1CC6A 1NDAA 3AEGA 3SYIA 4J36A 2BCGG 2CDUA 3EANA 3ICRA 4Z2UA 2IVDA 1ZDLA 1IUTA 1H82A 2BRAA 2GR3A 2RGOA 2WU5A 3D8XA 4NZHA 3CNJA 2C3CA 2RGHA 3CNSA 1VG9A 3FMWA 3R9UA 1Y0PA 2VOUA 5FS9A 3S5WA 2BK3A 3ATRA 3COXA 1E1MA 3KD9A 5JCKA 1VDCA 3CIRA 4J57A 2HQMA 3SZFA 1FCDA 3H8LA 3SY4A 4EIQA 4IA5A 4UDPA 4BK3A 2I0ZA 3GD3A 3DA1A 4IVMB 4J56A 4LU6A 3G5SA 4P9SA 1LJ1A 2R0PA 4K2XA 5KMQA 1FEBA 4IA6A 1N4VA 1NHRA 1EL8A 3UKKA 1GOSA 3ALLA 1EL9A 1ZX9A 2C64A 4OPDA 4BJZA 1NHPA 3BNMA 3DMEA 3M13A 3BHKA 1PS9A 4M52A 4A99A 5KOXA 4YKFA 2WPFA 1XDIA 1K4QA 1H84A 1Y56B 4AT2A 2VZ2A 1YKJA 4U8OA 2OALA 3AYJA 3PS9A 3GMCA 5JCNA 3BI5A 3CTYA 3ISHA 3L1RA 2C4CA 1GRGA 4GAVA 1L9CA 1PJ5A 3F8RA 3IHGA 4TLZA 5BRTA 2JB3A 2WDRA 3AE7A 3T31A 1CF3A 1TDKA 3URHA 4G6HA 1E1LA 4OPTA 4ICYA 3GDPA 4BK1A 1UKVG 4H4RA 5CQFA 3GD4A 1PBCA 1F6MA 3DH9A 2Q0LA 4NTEA 4C5OA 2IVEA 3WE0A 3UKLA 2XFOA 4OPIA 4B69A 2GAGB 4K7ZA 3AE1A 3GWFA 3ATQA 2UZZA 3B3RA 2YAUA 3SZ0A 2FJBA 4U8PA 4ZCDA 1IUWA 2GQFA 2B7SA 3FBSA 4JNAA 1GT8A 3RP7A 3SFEA 2PYXA 3KU9A 4D03A 2VVMA 3Q6JA 5EB5A 1KNRA 3M0OA 4KX6A 4XWRA 1DJQA 1CJCA 4AP1A 2YLZA 3CPJG 3F8PA 3NTDA 3QSMA 3CNPA 4GDEA 4J31A 2NVKX 3DGHA 4NEWA 5KRQA 1BKWA 3I3LA 3DJJA 2R0CA 4NTDA 4U8LA 5M10A 3DJEA 2BYBA 3E1TA 3AEDA 1NENA 4H7UA 3F8DA 1JNZA 4K5RA 1CBOA 1GTEA 3AECA 3AEBA 3P9UA 4Z43A 1GSNA 3V76A 1LTXR 2V61A 3FPZA 5KNLA 4H4UA 3BNUA 2VVLG 3PO7A 1CJ3A 2Q7VA 2W0HA 3IWAA 3IF9A 2BABA 2BS4A 4IVOB 4DSHA 1B5QA 1B37A 3AD9B 1BF3A 5U1OA 3EAOA 3SFDA 4CCQA 3II4A 2YM2A 4C3XA 2BS3A 1KDGA 3KPKA 1MO9A 3RNMA 1RYIA 1GESA 1V59A 3GDNA 2XVHA 4Z25A 3FIMB 1PBFA 1KF6A 3OC4A 1JRYA 1QLBA 2IIDA 3NK0X 4YSYA 5IQ4A 2BRYA 2BXSA 1GETA 2XLUA 3GRSA 1Z6LA 1NEKA 4A79A 3CPIG 2OLOA 1GRBA 1GV4A 1O5WA 2V60A 2X99A 3ADAB 5JCIA 2JB2A 3ALJA 3B6DA 2WP5A 5TR3A 1IUXA 3PVCA 3LXDA 4EMJA 3UKQA 2XVFA 3V3NA 1DJNA 1DXLA 1NHSA 1IUUA 4H4YA 1O95A 1CJ2A 3O0HA 4H2NA 4YWOA 2Q6UA 4JY2A 1K0IA 5KXJA 3QVRA 4B63A 3L8KA 2ARDA 1N4UA 5EOWA 3NG7X 2YLTA 1CC4A 1YY5A
chains in the Genus database with same CATH topology
2GMJA 5HXIA 2YR4A 4ADWA 4U8MA 1EL7A 4AT0A 1ZP0A 4LIIA 1PDHA 1N1PA 3UCLA 4D04A 1E7PA 1Q1RA 3V3OA 2AAQA 3CGEA 4H2RA 3CGCA 4H4QA 1XPQA 1GEUA 1B8SA 1OJDA 2Q0KA 5C2TA 3T37A 4O5QA 1COYA 3S61A 4CCRA 2TPRA 3T14A 1JOAA 1TRBA 3DJGX 1F8SA 4H4TA 1E6EA 2H89A 4APNA 4GAPA 5KOWA 2XVEA 3DGZA 3I6DA 5LV9A 2WOVA 3SQPA 2YVJA 1DOBA 4CNJA 3C4NA 5GRTA 3DJDA 2YG3A 1JRZA 3LOVA 1CL0A 2E1MA 3SGLA 2C65A 4RSLA 3D1CA 5GSNA 1RSGA 2C70A 2B9XA 5C3JA 3NT6A 1ZK7A 4G9KA 3AE3A 3UKPA 4U2SA 2YLXA 4A7AA 3CN8A 1VG0A 4JDRA 1BZLA 2EQ9A 1YQ3A 3NRNA 1ZOYA 2GR2A 2C67A 2R9ZA 3SZWA 4OVIA 3ALMA 2ZBWA 1QJDA 4OPLA 2YG7A 4II2A 2EQ7A 1FOHA 4GRTA 3UOZA 2YG6A 1BGJA 2OLNA 2R4EA 3AEEA 2JB1A 2OAMA 3GWDA 4FDCB 4K8DA 2GQWA 3AXBA 1DODA 2GB0A 4REKA 4YTMA 1GXFA 2YG4A 4H4PA 3GYIA 4Z2TA 3NN0X 3AE8A 3NYEA 3NIXA 4PABA 4C3YA 2YVFA 1H81A 2RGJA 3ICSA 1JU2A 4FK1C 2V6OA 3NYFA 1OJTA 1PXCA 1LPFA 3AD8B 3DK9A 2R46A 4B68A 4CY8A 4TM0A 3NGCX 1PJ7A 4DGKA 4G73A 1ZKQA 4II3A 1HYUA 4EM3A 3QVPA 4H4SA 2R4JA 2GEWA 2BXRA 5EBKA 5L46A 3UP4A 2BCPA 4JQ9A 3UTHA 1XANA 3VQRA 2BK4A 2YLSA 3RHAA 4LA1A 5KWFA 2F5ZA 3VRDB 1LQTA 3IC9A 2GR1A 3G5QA 1OJAA 4H4ZA 4H2PA 3H8IA 1H83A 1PXAA 4FX9A 4H4WA 3UTGA 3VR8A 4BURA 4NTCA 5KMPA 4CNKA 2XLTA 2WESA 4KPRA 1SEZA 1S2YA 5CKUA 4BJYA 1KFYA 1NG3A 3LJPA 4BK2A 4TLXA 3NK1X 3CNDA 3K7TA 4J33A 1GRHA 2YLWA 4OPGA 3UKHA 2BK5A 2E5VA 1GNDA 3NKSA 4NNJA 3GRTA 3ITJA 2BACA 2XLSA 1D4EA 2GMHA 5M0ZA 3QJ4A 5U25A 1CC2A 4H4XA 1KSUA 4U8KA 2WOWA 2ZZBA 3P4PA 4EQRA 1S3EA 4ZCCA 1VQWA 2FBWA 2GF3A 5IQ1A 2YWLA 1Q9IA 2WDQA 2WETA 4AOSA 3UTFA 4EM4A 1JNRA 1S3BA 4OCGA 2NPXA 1ZY8A 4GR1A 2B9YA 2FJAA 2XLPA 1ELIA 2EQ6A 4ECHA 4Y4LA 2CFYA 3NYCA 4Z44A 1F8RA 3FG2P 1EL5A 2X8HA 1K0JA 3AWIA 3UKFA 4YTPA 2C3DA 1BWCA 3C96A 2WQYA 2B7RA 1GRTA 1VRQB 3P4QA 3NN6X 4OPCA 2X50A 2AR8A 2XFUA 2JKCA 4B67A 4GUVA 1H6VA 4UDRA 4TM4A 1LVLA 2E4GA 1L9DA 2R45A 2WS3A 3P4SA 1LV0A 2APGA 1PN0A 2WP6A 4TM1A 3AE6A 2JK6A 3SM8A 3LB8A 2WPEA 1ONFA 3LZWA 1H86A 3KKJA 3VRAA 2YVGA 1GERA 2VRMA 1FECA 1NHQA 3HYVA 4HA6A 4NWZA 2GVCA 1LQUA 1XHCA 1GALA 5J60A 4GCMA 5HY5A 3SXIA 5IPYA 4XXGA 3RP6A 3T2ZA 2C73A 2FJDA 3KPFA 2XFPA 3RP8A 1P2EA 5EB4A 2GR0A 4Y4NA 4B1BA 4UP3A 1D4DA 2ZZ0A 4NEVA 4XWZA 2YR5A 1L9EA 2BC1A 1CJ4A 1FEAA 2RABA 3GYXA 2VVLA 2XDOA 3JSKA 4FK1A 4OPUA 3ABVA 2GRTA 3HYWA 4RG3A 4Z26A 4B64A 2BA9A 1NPXA 1TYTA 3KLJA 2QCUA 2XLRA 3NNEA 4E0VA 4O5UA 1PXBA 3ICTA 4IV9A 5JCMA 1GRAA 2YR6A 3EPTA 3Q9TA 2XVIA 4EQXA 2Z5XA 2XVJA 2A8XA 2A87A 2WDVA 4X9MA 1N4WA 4AP3A 1PJ6A 1JRXA 1B4VA 2WEUA 3BI2A 3AE9A 4ZN0A 1REOA 2QA1A 4I59A 3QFAA 4G74A 2X3NA 4YSHA 2V5ZA 3P4RA 2XCGA 2WOIA 4A5LA 2JBVA 3QFBA 1D4CA 3UOVA 1PBBA 5KVIA 3UTEA 4I58A 4CBQA 1NG4A 3CGBA 4G6GA 4H2QA 2GAHB 4Y4MA 1IUVA 4J34A 4U8JA 2YM1A 3HZLA 4WX1A 1DOCA 3AYLA 3NH3X 3T0KA 3M12A 5FS7A 3SX6A 1TDOA 1ZMCA 5FS8A 4U2TA 1EBDA 2GH5A 2WBAA 2C72A 3AD7B 2J3NA 4H4VA 4MJWA 1E1NA 2BC0A 3KVEA 4DNAA 2C76A 4EQSA 1H7XA 1E1KA 2O9ZA 5KVHA 4AOXA 5J7XA 2WP9A 4Z2RA 1RP0A 2CVJA 2VQ7A 3IHMA 3EF6A 3NTAA 3QSEA 1L0VA 4A6NA 1P2HA 4PAAA 4B66A 3LZXA 4USQA 4YKGA 3G5RA 2H88A 3VR9A 1YQZA 4YTNA 1TDNA 3DK4A 1F3PA 1OJCA 2R0GA 2XYOA 3T2YA 1KSSA 1Q1WA 4BV6A 2XFQA 2DKIA 3REDA 4C77A 1GTHA 2ZZCA 3AE5A 3NK2X 4CY6A 1OJ9A 1H7WA 2A89A 2YQUA 3AEAA 3QSSA 2V3BA 4GDPA 1YQ4A 3UOYA 4N9XA 1ZOVA 4EMIA 1NAAA 3CPHG 2WPCA 2C7GA 1PBEA 4X4JA 4YSZA 5HYMA 1PBDA 3GYJA 1GRFA 5U63A 4J2WA 3UOXA 3OZ2A 4CRTA 4DSGA 3UP5A 1PHHA 2Y6QA 2BS2A 4WCTA 5FMHA 5HHFA 2C75A 1D7LA 1CHUA 1D7YA 4C74A 2DKHA 5KMSA 1O94A 1W4XA 1JEHA 1GPEA 1IJHA 2X8CA 2VRLA 3GSIA 3ZYXA 2CULA 2B76A 3AB1A 3K30A 4JY3A 3UKAA 5KMRA 1X31B 3NHOX 1TDFA 4B65A 4GF7A 4YT0A 3SZCA 1Y56A 3GMBA 4RG4A 2OA1A 1TDEA 3NLCA 1GREA 3C4AA 1KNPA 4UDQA 3KA7A 1IUSA 2EQ8A 1M6IA 3BHFA 2WU2A 2ACZA 1MXTA 2Y6RA 2PHHA 1BGNA 3AE2A 1D5TA 2QAEA 3AE4A 4K5SA 4H50A 2QA2A 5BUKA 1AOGA 3CGDA 3CMMA 3AEFA 2XFNA 4A9WA 1QO8A 1DOEA 3CNTA 5ER0A 4JN9A 3AYIA 4K22A 4YSXA 5DBJA 5BULA 5BVAA 2YG5A 1K0LA 4USRA 1E39A 1FL2A 2YLRA 4EQWA 1F8WA 1MOKA 1M64A 4A65A 3H4KA 4YXDA 4U8IA 2TMDA 3K7MX 2C66A 4EIPA 4X9NA 1DNCA 1TYPA 5JCLA 4HB9A 3DK8A 3ZDNA 4Z24A 2FJEA 2VQBA 4EMWA 3P1WA 2AQJA 3K7QX 5FS6A 4TM3A 2WHDA 3T2KA 3HYXA 4A6NB 2B9WA 4U2LA 4JNQA 2V3AA 3LADA 3VRBA 1ZMDA 1S2QA 2GV8A 3BI4A 2JAEA 2Z5YA 4U8NA 2X8GA 1CC6A 1NDAA 3AEGA 3SYIA 4J36A 2BCGG 2CDUA 3EANA 3ICRA 4Z2UA 2IVDA 1ZDLA 1IUTA 1H82A 2BRAA 2GR3A 2RGOA 2WU5A 3D8XA 4NZHA 3CNJA 2C3CA 2RGHA 3CNSA 1VG9A 3FMWA 3R9UA 1Y0PA 2VOUA 5FS9A 3S5WA 2BK3A 3ATRA 3COXA 1E1MA 3KD9A 5JCKA 1VDCA 3CIRA 4J57A 2HQMA 3SZFA 1FCDA 3H8LA 3SY4A 4EIQA 4IA5A 4UDPA 4BK3A 2I0ZA 3GD3A 3DA1A 4IVMB 4J56A 4LU6A 3G5SA 4P9SA 1LJ1A 2R0PA 4K2XA 5KMQA 1FEBA 4IA6A 1N4VA 1NHRA 1EL8A 3UKKA 1GOSA 3ALLA 1EL9A 1ZX9A 2C64A 4OPDA 4BJZA 1NHPA 3BNMA 3DMEA 3M13A 3BHKA 1PS9A 4M52A 4A99A 5KOXA 4YKFA 2WPFA 1XDIA 1K4QA 1H84A 1Y56B 4AT2A 2VZ2A 1YKJA 4U8OA 2OALA 3AYJA 3PS9A 3GMCA 5JCNA 3BI5A 3CTYA 3ISHA 3L1RA 2C4CA 1GRGA 4GAVA 1L9CA 1PJ5A 3F8RA 3IHGA 4TLZA 5BRTA 2JB3A 2WDRA 3AE7A 3T31A 1CF3A 1TDKA 3URHA 4G6HA 1E1LA 4OPTA 4ICYA 3GDPA 4BK1A 1UKVG 4H4RA 5CQFA 3GD4A 1PBCA 1F6MA 3DH9A 2Q0LA 4NTEA 4C5OA 2IVEA 3WE0A 3UKLA 2XFOA 4OPIA 4B69A 2GAGB 4K7ZA 3AE1A 3GWFA 3ATQA 2UZZA 3B3RA 2YAUA 3SZ0A 2FJBA 4U8PA 4ZCDA 1IUWA 2GQFA 2B7SA 3FBSA 4JNAA 1GT8A 3RP7A 3SFEA 2PYXA 3KU9A 4D03A 2VVMA 3Q6JA 5EB5A 1KNRA 3M0OA 4KX6A 4XWRA 1DJQA 1CJCA 4AP1A 2YLZA 3CPJG 3F8PA 3NTDA 3QSMA 3CNPA 4GDEA 4J31A 2NVKX 3DGHA 4NEWA 5KRQA 1BKWA 3I3LA 3DJJA 2R0CA 4NTDA 4U8LA 5M10A 3DJEA 2BYBA 3E1TA 3AEDA 1NENA 4H7UA 3F8DA 1JNZA 4K5RA 1CBOA 1GTEA 3AECA 3AEBA 3P9UA 4Z43A 1GSNA 3V76A 1LTXR 2V61A 3FPZA 5KNLA 4H4UA 3BNUA 2VVLG 3PO7A 1CJ3A 2Q7VA 2W0HA 3IWAA 3IF9A 2BABA 2BS4A 4IVOB 4DSHA 1B5QA 1B37A 3AD9B 1BF3A 5U1OA 3EAOA 3SFDA 4CCQA 3II4A 2YM2A 4C3XA 2BS3A 1KDGA 3KPKA 1MO9A 3RNMA 1RYIA 1GESA 1V59A 3GDNA 2XVHA 4Z25A 3FIMB 1PBFA 1KF6A 3OC4A 1JRYA 1QLBA 2IIDA 3NK0X 4YSYA 5IQ4A 2BRYA 2BXSA 1GETA 2XLUA 3GRSA 1Z6LA 1NEKA 4A79A 3CPIG 2OLOA 1GRBA 1GV4A 1O5WA 2V60A 2X99A 3ADAB 5JCIA 2JB2A 3ALJA 3B6DA 2WP5A 5TR3A 1IUXA 3PVCA 3LXDA 4EMJA 3UKQA 2XVFA 3V3NA 1DJNA 1DXLA 1NHSA 1IUUA 4H4YA 1O95A 1CJ2A 3O0HA 4H2NA 4YWOA 2Q6UA 4JY2A 1K0IA 5KXJA 3QVRA 4B63A 3L8KA 2ARDA 1N4UA 5EOWA 3NG7X 2YLTA 1CC4A 1YY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMJ A;  5HXI A;  2YR4 A;  4ADW A;  4U8M A;  1EL7 A;  4AT0 A;  1ZP0 A;  4LII A;  1PDH A;  1N1P A;  3UCL A;  4D04 A;  1E7P A;  1Q1R A;  3V3O A;  2AAQ A;  3CGE A;  4H2R A;  3CGC A;  4H4Q A;  1XPQ A;  1GEU A;  1B8S A;  1OJD A;  2Q0K A;  5C2T A;  3T37 A;  4O5Q A;  1COY A;  3S61 A;  4CCR A;  2TPR A;  1JOA A;  1TRB A;  3DJG X;  1F8S A;  4H4T A;  1E6E A;  2H89 A;  4APN A;  5KOW A;  2XVE A;  3DGZ A;  3I6D A;  5LV9 A;  2WOV A;  3SQP A;  2YVJ A;  1DOB A;  4CNJ A;  3C4N A;  5GRT A;  3DJD A;  2YG3 A;  1JRZ A;  3LOV A;  1CL0 A;  2E1M A;  3SGL A;  2C65 A;  4RSL A;  3D1C A;  5GSN A;  1RSG A;  2C70 A;  2B9X A;  5C3J A;  3NT6 A;  1ZK7 A;  3AE3 A;  3UKP A;  4U2S A;  2YLX A;  4A7A A;  3CN8 A;  1VG0 A;  4JDR A;  1BZL A;  2EQ9 A;  1YQ3 A;  3NRN A;  1ZOY A;  2GR2 A;  2C67 A;  2R9Z A;  4OVI A;  3ALM A;  2ZBW A;  1QJD A;  4OPL A;  2YG7 A;  2EQ7 A;  1FOH A;  4GRT A;  3UOZ A;  2YG6 A;  1BGJ A;  2OLN A;  2R4E A;  3AEE A;  2JB1 A;  2OAM A;  3GWD A;  4FDC B;  4K8D A;  2GQW A;  3AXB A;  1DOD A;  2GB0 A;  4REK A;  4YTM A;  1GXF A;  2YG4 A;  4H4P A;  3GYI A;  4Z2T A;  3NN0 X;  3AE8 A;  3NYE A;  3NIX A;  4PAB A;  4C3Y A;  2YVF A;  1H81 A;  2RGJ A;  3ICS A;  1JU2 A;  4FK1 C;  2V6O A;  3NYF A;  1OJT A;  1PXC A;  1LPF A;  3AD8 B;  3DK9 A;  2R46 A;  4B68 A;  4CY8 A;  4TM0 A;  3NGC X;  1PJ7 A;  4DGK A;  1ZKQ A;  1HYU A;  4EM3 A;  3QVP A;  4H4S A;  2R4J A;  2GEW A;  2BXR A;  5EBK A;  5L46 A;  3UP4 A;  2BCP A;  4JQ9 A;  3UTH A;  1XAN A;  3VQR A;  2BK4 A;  2YLS A;  3RHA A;  4LA1 A;  5KWF A;  2F5Z A;  3VRD B;  1LQT A;  3IC9 A;  2GR1 A;  3G5Q A;  1OJA A;  4H4Z A;  4H2P A;  3H8I A;  1H83 A;  1PXA A;  4FX9 A;  4H4W A;  3UTG A;  3VR8 A;  4BUR A;  4NTC A;  4CNK A;  2XLT A;  2WES A;  4KPR A;  1SEZ A;  1S2Y A;  5CKU A;  4BJY A;  1KFY A;  1NG3 A;  3LJP A;  4BK2 A;  4TLX A;  3NK1 X;  3CND A;  3K7T A;  4J33 A;  1GRH A;  2YLW A;  4OPG A;  3UKH A;  2BK5 A;  2E5V A;  1GND A;  3NKS A;  3GRT A;  3ITJ A;  2BAC A;  2XLS A;  1D4E A;  2GMH A;  5M0Z A;  3QJ4 A;  5U25 A;  1CC2 A;  4H4X A;  1KSU A;  4U8K A;  2WOW A;  2ZZB A;  3P4P A;  4EQR A;  1S3E A;  4ZCC A;  1VQW A;  2FBW A;  2GF3 A;  5IQ1 A;  2YWL A;  1Q9I A;  2WDQ A;  2WET A;  4AOS A;  3UTF A;  4EM4 A;  1JNR A;  1S3B A;  4OCG A;  2NPX A;  1ZY8 A;  4GR1 A;  2B9Y A;  2FJA A;  2XLP A;  1ELI A;  2EQ6 A;  4ECH A;  4Y4L A;  2CFY A;  3NYC A;  4Z44 A;  1F8R A;  3FG2 P;  1EL5 A;  2X8H A;  1K0J A;  3AWI A;  3UKF A;  4YTP A;  2C3D A;  1BWC A;  3C96 A;  2WQY A;  2B7R A;  1GRT A;  1VRQ B;  3P4Q A;  3NN6 X;  4OPC A;  2X50 A;  2AR8 A;  2XFU A;  2JKC A;  4B67 A;  4GUV A;  1H6V A;  4UDR A;  4TM4 A;  1LVL A;  2E4G A;  1L9D A;  2R45 A;  2WS3 A;  3P4S A;  1LV0 A;  2APG A;  1PN0 A;  2WP6 A;  4TM1 A;  3AE6 A;  2JK6 A;  3SM8 A;  3LB8 A;  2WPE A;  1ONF A;  3LZW A;  1H86 A;  3KKJ A;  3VRA A;  2YVG A;  1GER A;  2VRM A;  1FEC A;  1NHQ A;  4HA6 A;  2GVC A;  1LQU A;  1XHC A;  1GAL A;  5J60 A;  4GCM A;  5HY5 A;  5IPY A;  4XXG A;  3RP6 A;  2C73 A;  2FJD A;  3KPF A;  2XFP A;  3RP8 A;  1P2E A;  5EB4 A;  2GR0 A;  4Y4N A;  4B1B A;  4UP3 A;  1D4D A;  2ZZ0 A;  4NEV A;  4XWZ A;  2YR5 A;  1L9E A;  2BC1 A;  1CJ4 A;  1FEA A;  2RAB A;  3JSK A;  2VVL A;  2XDO A;  4FK1 A;  4OPU A;  3ABV A;  2GRT A;  4RG3 A;  4Z26 A;  4B64 A;  2BA9 A;  1NPX A;  1TYT A;  3KLJ A;  2QCU A;  2XLR A;  3NNE A;  4E0V A;  4O5U A;  1PXB A;  3ICT A;  4IV9 A;  5JCM A;  1GRA A;  2YR6 A;  3EPT A;  3Q9T A;  2XVI A;  4EQX A;  2Z5X A;  2XVJ A;  2A8X A;  2A87 A;  2WDV A;  4X9M A;  1N4W A;  4AP3 A;  1PJ6 A;  1JRX A;  1B4V A;  2WEU A;  3BI2 A;  3AE9 A;  4ZN0 A;  1REO A;  2QA1 A;  4I59 A;  3QFA A;  2X3N A;  4YSH A;  2V5Z A;  3P4R A;  2XCG A;  2WOI A;  4A5L A;  2JBV A;  3QFB A;  1D4C A;  3UOV A;  1PBB A;  5KVI A;  3UTE A;  4I58 A;  4CBQ A;  1NG4 A;  3CGB A;  4H2Q A;  2GAH B;  4Y4M A;  1IUV A;  4J34 A;  4U8J A;  2YM1 A;  3HZL A;  4WX1 A;  1DOC A;  3AYL A;  3NH3 X;  3M12 A;  5FS7 A;  1TDO A;  1ZMC A;  5FS8 A;  4U2T A;  1EBD A;  2GH5 A;  2WBA A;  2C72 A;  3AD7 B;  2J3N A;  4H4V A;  4MJW A;  1E1N A;  2BC0 A;  3KVE A;  4DNA A;  2C76 A;  4EQS A;  1H7X A;  1E1K A;  2O9Z A;  5KVH A;  4AOX A;  5J7X A;  2WP9 A;  4Z2R A;  1RP0 A;  2CVJ A;  2VQ7 A;  3IHM A;  3EF6 A;  3NTA A;  3QSE A;  1L0V A;  4A6N A;  1P2H A;  4PAA A;  4B66 A;  3LZX A;  4USQ A;  4YKG A;  3G5R A;  2H88 A;  3VR9 A;  1YQZ A;  4YTN A;  1TDN A;  3DK4 A;  1F3P A;  1OJC A;  2R0G A;  2XYO A;  1KSS A;  1Q1W A;  4BV6 A;  2XFQ A;  2DKI A;  3RED A;  4C77 A;  1GTH A;  2ZZC A;  3AE5 A;  3NK2 X;  4CY6 A;  1OJ9 A;  1H7W A;  2A89 A;  2YQU A;  3AEA A;  3QSS A;  2V3B A;  4GDP A;  1YQ4 A;  3UOY A;  4N9X A;  1ZOV A;  4EMI A;  1NAA A;  3CPH G;  2WPC A;  2C7G A;  1PBE A;  4X4J A;  4YSZ A;  5HYM A;  1PBD A;  3GYJ A;  1GRF A;  5U63 A;  4J2W A;  3UOX A;  3OZ2 A;  4CRT A;  4DSG A;  3UP5 A;  1PHH A;  2Y6Q A;  2BS2 A;  4WCT A;  5FMH A;  5HHF A;  2C75 A;  1D7L A;  1CHU A;  1D7Y A;  4C74 A;  2DKH A;  1O94 A;  1W4X A;  1JEH A;  1GPE A;  1IJH A;  2X8C A;  2VRL A;  3GSI A;  3ZYX A;  2CUL A;  2B76 A;  3AB1 A;  3K30 A;  4JY3 A;  3UKA A;  1X31 B;  3NHO X;  1TDF A;  4B65 A;  4GF7 A;  4YT0 A;  1Y56 A;  3GMB A;  4RG4 A;  2OA1 A;  1TDE A;  3NLC A;  1GRE A;  3C4A A;  1KNP A;  4UDQ A;  3KA7 A;  1IUS A;  2EQ8 A;  1M6I A;  3BHF A;  2WU2 A;  2ACZ A;  1MXT A;  2Y6R A;  2PHH A;  1BGN A;  3AE2 A;  1D5T A;  2QAE A;  3AE4 A;  4K5S A;  4H50 A;  2QA2 A;  5BUK A;  1AOG A;  3CGD A;  4A9W A;  3AEF A;  2XFN A;  1QO8 A;  1DOE A;  3CNT A;  5ER0 A;  4JN9 A;  3AYI A;  4K22 A;  4YSX A;  5DBJ A;  5BUL A;  5BVA A;  2YG5 A;  1K0L A;  4USR A;  1E39 A;  1FL2 A;  2YLR A;  4EQW A;  1F8W A;  1MOK A;  1M64 A;  4A65 A;  3H4K A;  4YXD A;  4U8I A;  2TMD A;  3K7M X;  2C66 A;  4EIP A;  4X9N A;  1DNC A;  1TYP A;  5JCL A;  4HB9 A;  3DK8 A;  3ZDN A;  4Z24 A;  2FJE A;  2VQB A;  4EMW A;  3P1W A;  2AQJ A;  3K7Q X;  5FS6 A;  4TM3 A;  2WHD A;  4A6N B;  2B9W A;  4U2L A;  4JNQ A;  2V3A A;  3LAD A;  3VRB A;  1ZMD A;  1S2Q A;  2GV8 A;  3BI4 A;  2JAE A;  2Z5Y A;  4U8N A;  2X8G A;  1CC6 A;  1NDA A;  3AEG A;  4J36 A;  2BCG G;  2CDU A;  3EAN A;  3ICR A;  4Z2U A;  2IVD A;  1ZDL A;  1IUT A;  1H82 A;  2GR3 A;  2RGO A;  2WU5 A;  3D8X A;  4NZH A;  3CNJ A;  2C3C A;  2RGH A;  3CNS A;  1VG9 A;  3FMW A;  3R9U A;  1Y0P A;  2VOU A;  5FS9 A;  3S5W A;  2BK3 A;  3ATR A;  3COX A;  1E1M A;  3KD9 A;  5JCK A;  1VDC A;  3CIR A;  4J57 A;  2HQM A;  1FCD A;  3H8L A;  4EIQ A;  4IA5 A;  4UDP A;  4BK3 A;  2I0Z A;  3GD3 A;  3DA1 A;  4IVM B;  4J56 A;  4LU6 A;  3G5S A;  4P9S A;  1LJ1 A;  2R0P A;  4K2X A;  1FEB A;  4IA6 A;  1N4V A;  1NHR A;  1EL8 A;  3UKK A;  1GOS A;  3ALL A;  1EL9 A;  1ZX9 A;  2C64 A;  4OPD A;  4BJZ A;  1NHP A;  3BNM A;  3DME A;  3M13 A;  3BHK A;  1PS9 A;  4M52 A;  4A99 A;  5KOX A;  4YKF A;  2WPF A;  1XDI A;  1K4Q A;  1H84 A;  1Y56 B;  4AT2 A;  2VZ2 A;  1YKJ A;  4U8O A;  2OAL A;  3AYJ A;  3PS9 A;  3GMC A;  5JCN A;  3BI5 A;  3CTY A;  3ISH A;  3L1R A;  4TLZ A;  1GRG A;  5EOW A;  1L9C A;  1PJ5 A;  3F8R A;  3IHG A;  5BRT A;  2JB3 A;  2WDR A;  3AE7 A;  1CF3 A;  1TDK A;  3URH A;  1E1L A;  4OPT A;  4ICY A;  3GDP A;  4BK1 A;  1UKV G;  4H4R A;  5CQF A;  3GD4 A;  1PBC A;  1F6M A;  3DH9 A;  2Q0L A;  4NTE A;  4C5O A;  2IVE A;  3WE0 A;  3UKL A;  2XFO A;  4OPI A;  4B69 A;  2GAG B;  4K7Z A;  3AE1 A;  3GWF A;  3ATQ A;  2UZZ A;  3B3R A;  2YAU A;  2FJB A;  4U8P A;  4ZCD A;  1IUW A;  2GQF A;  2B7S A;  3FBS A;  4JNA A;  1GT8 A;  3RP7 A;  3SFE A;  2PYX A;  3KU9 A;  4D03 A;  2VVM A;  3Q6J A;  5EB5 A;  1KNR A;  3M0O A;  4KX6 A;  4XWR A;  1DJQ A;  1CJC A;  4AP1 A;  2YLZ A;  3CPJ G;  3F8P A;  3NTD A;  3QSM A;  3CNP A;  4GDE A;  4J31 A;  2NVK X;  3DGH A;  4NEW A;  5KRQ A;  1BKW A;  3I3L A;  3DJJ A;  2R0C A;  4NTD A;  4U8L A;  5M10 A;  3DJE A;  2BYB A;  3E1T A;  3AED A;  1NEN A;  4H7U A;  3F8D A;  1JNZ A;  4K5R A;  1CBO A;  1GTE A;  3AEC A;  3AEB A;  3P9U A;  4Z43 A;  1GSN A;  3V76 A;  1LTX R;  2V61 A;  3FPZ A;  4H4U A;  3BNU A;  2VVL G;  3PO7 A;  1CJ3 A;  2Q7V A;  2W0H A;  3IWA A;  3IF9 A;  2BAB A;  2BS4 A;  4IVO B;  4DSH A;  1B5Q A;  1B37 A;  3AD9 B;  1BF3 A;  5U1O A;  3EAO A;  3SFD A;  4CCQ A;  3II4 A;  2YM2 A;  4C3X A;  2BS3 A;  1KDG A;  1MO9 A;  3RNM A;  1RYI A;  1GES A;  1V59 A;  3GDN A;  2XVH A;  4Z25 A;  3FIM B;  1PBF A;  1KF6 A;  3OC4 A;  1JRY A;  1QLB A;  2IID A;  3NK0 X;  4YSY A;  5IQ4 A;  2BXS A;  1GET A;  2XLU A;  3GRS A;  1Z6L A;  1NEK A;  4A79 A;  3CPI G;  2OLO A;  1GRB A;  1GV4 A;  1O5W A;  2V60 A;  2X99 A;  3ADA B;  5JCI A;  2JB2 A;  3ALJ A;  3B6D A;  2WP5 A;  5TR3 A;  1IUX A;  3PVC A;  3LXD A;  4EMJ A;  3UKQ A;  2XVF A;  3V3N A;  1DJN A;  1DXL A;  1NHS A;  1IUU A;  4H4Y A;  1O95 A;  1CJ2 A;  3O0H A;  4H2N A;  4YWO A;  2Q6U A;  4JY2 A;  1K0I A;  5KXJ A;  3QVR A;  4B63 A;  3L8K A;  2ARD A;  1N4U A;  3NG7 X;  2YLT A;  1CC4 A;  1YY5 A; 
#chains in the Genus database with same CATH topology
 2GMJ A;  5HXI A;  2YR4 A;  4ADW A;  4U8M A;  1EL7 A;  4AT0 A;  1ZP0 A;  4LII A;  1PDH A;  1N1P A;  3UCL A;  4D04 A;  1E7P A;  1Q1R A;  3V3O A;  2AAQ A;  3CGE A;  4H2R A;  3CGC A;  4H4Q A;  1XPQ A;  1GEU A;  1B8S A;  1OJD A;  2Q0K A;  5C2T A;  3T37 A;  4O5Q A;  1COY A;  3S61 A;  4CCR A;  2TPR A;  3T14 A;  1JOA A;  1TRB A;  3DJG X;  1F8S A;  4H4T A;  1E6E A;  2H89 A;  4APN A;  4GAP A;  5KOW A;  2XVE A;  3DGZ A;  3I6D A;  5LV9 A;  2WOV A;  3SQP A;  2YVJ A;  1DOB A;  4CNJ A;  3C4N A;  5GRT A;  3DJD A;  2YG3 A;  1JRZ A;  3LOV A;  1CL0 A;  2E1M A;  3SGL A;  2C65 A;  4RSL A;  3D1C A;  5GSN A;  1RSG A;  2C70 A;  2B9X A;  5C3J A;  3NT6 A;  1ZK7 A;  4G9K A;  3AE3 A;  3UKP A;  4U2S A;  2YLX A;  4A7A A;  3CN8 A;  1VG0 A;  4JDR A;  1BZL A;  2EQ9 A;  1YQ3 A;  3NRN A;  1ZOY A;  2GR2 A;  2C67 A;  2R9Z A;  3SZW A;  4OVI A;  3ALM A;  2ZBW A;  1QJD A;  4OPL A;  2YG7 A;  4II2 A;  2EQ7 A;  1FOH A;  4GRT A;  3UOZ A;  2YG6 A;  1BGJ A;  2OLN A;  2R4E A;  3AEE A;  2JB1 A;  2OAM A;  3GWD A;  4FDC B;  4K8D A;  2GQW A;  3AXB A;  1DOD A;  2GB0 A;  4REK A;  4YTM A;  1GXF A;  2YG4 A;  4H4P A;  3GYI A;  4Z2T A;  3NN0 X;  3AE8 A;  3NYE A;  3NIX A;  4PAB A;  4C3Y A;  2YVF A;  1H81 A;  2RGJ A;  3ICS A;  1JU2 A;  4FK1 C;  2V6O A;  3NYF A;  1OJT A;  1PXC A;  1LPF A;  3AD8 B;  3DK9 A;  2R46 A;  4B68 A;  4CY8 A;  4TM0 A;  3NGC X;  1PJ7 A;  4DGK A;  4G73 A;  1ZKQ A;  4II3 A;  1HYU A;  4EM3 A;  3QVP A;  4H4S A;  2R4J A;  2GEW A;  2BXR A;  5EBK A;  5L46 A;  3UP4 A;  2BCP A;  4JQ9 A;  3UTH A;  1XAN A;  3VQR A;  2BK4 A;  2YLS A;  3RHA A;  4LA1 A;  5KWF A;  2F5Z A;  3VRD B;  1LQT A;  3IC9 A;  2GR1 A;  3G5Q A;  1OJA A;  4H4Z A;  4H2P A;  3H8I A;  1H83 A;  1PXA A;  4FX9 A;  4H4W A;  3UTG A;  3VR8 A;  4BUR A;  4NTC A;  5KMP A;  4CNK A;  2XLT A;  2WES A;  4KPR A;  1SEZ A;  1S2Y A;  5CKU A;  4BJY A;  1KFY A;  1NG3 A;  3LJP A;  4BK2 A;  4TLX A;  3NK1 X;  3CND A;  3K7T A;  4J33 A;  1GRH A;  2YLW A;  4OPG A;  3UKH A;  2BK5 A;  2E5V A;  1GND A;  3NKS A;  4NNJ A;  3GRT A;  3ITJ A;  2BAC A;  2XLS A;  1D4E A;  2GMH A;  5M0Z A;  3QJ4 A;  5U25 A;  1CC2 A;  4H4X A;  1KSU A;  4U8K A;  2WOW A;  2ZZB A;  3P4P A;  4EQR A;  1S3E A;  4ZCC A;  1VQW A;  2FBW A;  2GF3 A;  5IQ1 A;  2YWL A;  1Q9I A;  2WDQ A;  2WET A;  4AOS A;  3UTF A;  4EM4 A;  1JNR A;  1S3B A;  4OCG A;  2NPX A;  1ZY8 A;  4GR1 A;  2B9Y A;  2FJA A;  2XLP A;  1ELI A;  2EQ6 A;  4ECH A;  4Y4L A;  2CFY A;  3NYC A;  4Z44 A;  1F8R A;  3FG2 P;  1EL5 A;  2X8H A;  1K0J A;  3AWI A;  3UKF A;  4YTP A;  2C3D A;  1BWC A;  3C96 A;  2WQY A;  2B7R A;  1GRT A;  1VRQ B;  3P4Q A;  3NN6 X;  4OPC A;  2X50 A;  2AR8 A;  2XFU A;  2JKC A;  4B67 A;  4GUV A;  1H6V A;  4UDR A;  4TM4 A;  1LVL A;  2E4G A;  1L9D A;  2R45 A;  2WS3 A;  3P4S A;  1LV0 A;  2APG A;  1PN0 A;  2WP6 A;  4TM1 A;  3AE6 A;  2JK6 A;  3SM8 A;  3LB8 A;  2WPE A;  1ONF A;  3LZW A;  1H86 A;  3KKJ A;  3VRA A;  2YVG A;  1GER A;  2VRM A;  1FEC A;  1NHQ A;  3HYV A;  4HA6 A;  4NWZ A;  2GVC A;  1LQU A;  1XHC A;  1GAL A;  5J60 A;  4GCM A;  5HY5 A;  3SXI A;  5IPY A;  4XXG A;  3RP6 A;  3T2Z A;  2C73 A;  2FJD A;  3KPF A;  2XFP A;  3RP8 A;  1P2E A;  5EB4 A;  2GR0 A;  4Y4N A;  4B1B A;  4UP3 A;  1D4D A;  2ZZ0 A;  4NEV A;  4XWZ A;  2YR5 A;  1L9E A;  2BC1 A;  1CJ4 A;  1FEA A;  2RAB A;  3GYX A;  2VVL A;  2XDO A;  3JSK A;  4FK1 A;  4OPU A;  3ABV A;  2GRT A;  3HYW A;  4RG3 A;  4Z26 A;  4B64 A;  2BA9 A;  1NPX A;  1TYT A;  3KLJ A;  2QCU A;  2XLR A;  3NNE A;  4E0V A;  4O5U A;  1PXB A;  3ICT A;  4IV9 A;  5JCM A;  1GRA A;  2YR6 A;  3EPT A;  3Q9T A;  2XVI A;  4EQX A;  2Z5X A;  2XVJ A;  2A8X A;  2A87 A;  2WDV A;  4X9M A;  1N4W A;  4AP3 A;  1PJ6 A;  1JRX A;  1B4V A;  2WEU A;  3BI2 A;  3AE9 A;  4ZN0 A;  1REO A;  2QA1 A;  4I59 A;  3QFA A;  4G74 A;  2X3N A;  4YSH A;  2V5Z A;  3P4R A;  2XCG A;  2WOI A;  4A5L A;  2JBV A;  3QFB A;  1D4C A;  3UOV A;  1PBB A;  5KVI A;  3UTE A;  4I58 A;  4CBQ A;  1NG4 A;  3CGB A;  4G6G A;  4H2Q A;  2GAH B;  4Y4M A;  1IUV A;  4J34 A;  4U8J A;  2YM1 A;  3HZL A;  4WX1 A;  1DOC A;  3AYL A;  3NH3 X;  3T0K A;  3M12 A;  5FS7 A;  3SX6 A;  1TDO A;  1ZMC A;  5FS8 A;  4U2T A;  1EBD A;  2GH5 A;  2WBA A;  2C72 A;  3AD7 B;  2J3N A;  4H4V A;  4MJW A;  1E1N A;  2BC0 A;  3KVE A;  4DNA A;  2C76 A;  4EQS A;  1H7X A;  1E1K A;  2O9Z A;  5KVH A;  4AOX A;  5J7X A;  2WP9 A;  4Z2R A;  1RP0 A;  2CVJ A;  2VQ7 A;  3IHM A;  3EF6 A;  3NTA A;  3QSE A;  1L0V A;  4A6N A;  1P2H A;  4PAA A;  4B66 A;  3LZX A;  4USQ A;  4YKG A;  3G5R A;  2H88 A;  3VR9 A;  1YQZ A;  4YTN A;  1TDN A;  3DK4 A;  1F3P A;  1OJC A;  2R0G A;  2XYO A;  3T2Y A;  1KSS A;  1Q1W A;  4BV6 A;  2XFQ A;  2DKI A;  3RED A;  4C77 A;  1GTH A;  2ZZC A;  3AE5 A;  3NK2 X;  4CY6 A;  1OJ9 A;  1H7W A;  2A89 A;  2YQU A;  3AEA A;  3QSS A;  2V3B A;  4GDP A;  1YQ4 A;  3UOY A;  4N9X A;  1ZOV A;  4EMI A;  1NAA A;  3CPH G;  2WPC A;  2C7G A;  1PBE A;  4X4J A;  4YSZ A;  5HYM A;  1PBD A;  3GYJ A;  1GRF A;  5U63 A;  4J2W A;  3UOX A;  3OZ2 A;  4CRT A;  4DSG A;  3UP5 A;  1PHH A;  2Y6Q A;  2BS2 A;  4WCT A;  5FMH A;  5HHF A;  2C75 A;  1D7L A;  1CHU A;  1D7Y A;  4C74 A;  2DKH A;  5KMS A;  1O94 A;  1W4X A;  1JEH A;  1GPE A;  1IJH A;  2X8C A;  2VRL A;  3GSI A;  3ZYX A;  2CUL A;  2B76 A;  3AB1 A;  3K30 A;  4JY3 A;  3UKA A;  5KMR A;  1X31 B;  3NHO X;  1TDF A;  4B65 A;  4GF7 A;  4YT0 A;  3SZC A;  1Y56 A;  3GMB A;  4RG4 A;  2OA1 A;  1TDE A;  3NLC A;  1GRE A;  3C4A A;  1KNP A;  4UDQ A;  3KA7 A;  1IUS A;  2EQ8 A;  1M6I A;  3BHF A;  2WU2 A;  2ACZ A;  1MXT A;  2Y6R A;  2PHH A;  1BGN A;  3AE2 A;  1D5T A;  2QAE A;  3AE4 A;  4K5S A;  4H50 A;  2QA2 A;  5BUK A;  1AOG A;  3CGD A;  3CMM A;  3AEF A;  2XFN A;  4A9W A;  1QO8 A;  1DOE A;  3CNT A;  5ER0 A;  4JN9 A;  3AYI A;  4K22 A;  4YSX A;  5DBJ A;  5BUL A;  5BVA A;  2YG5 A;  1K0L A;  4USR A;  1E39 A;  1FL2 A;  2YLR A;  4EQW A;  1F8W A;  1MOK A;  1M64 A;  4A65 A;  3H4K A;  4YXD A;  4U8I A;  2TMD A;  3K7M X;  2C66 A;  4EIP A;  4X9N A;  1DNC A;  1TYP A;  5JCL A;  4HB9 A;  3DK8 A;  3ZDN A;  4Z24 A;  2FJE A;  2VQB A;  4EMW A;  3P1W A;  2AQJ A;  3K7Q X;  5FS6 A;  4TM3 A;  2WHD A;  3T2K A;  3HYX A;  4A6N B;  2B9W A;  4U2L A;  4JNQ A;  2V3A A;  3LAD A;  3VRB A;  1ZMD A;  1S2Q A;  2GV8 A;  3BI4 A;  2JAE A;  2Z5Y A;  4U8N A;  2X8G A;  1CC6 A;  1NDA A;  3AEG A;  3SYI A;  4J36 A;  2BCG G;  2CDU A;  3EAN A;  3ICR A;  4Z2U A;  2IVD A;  1ZDL A;  1IUT A;  1H82 A;  2BRA A;  2GR3 A;  2RGO A;  2WU5 A;  3D8X A;  4NZH A;  3CNJ A;  2C3C A;  2RGH A;  3CNS A;  1VG9 A;  3FMW A;  3R9U A;  1Y0P A;  2VOU A;  5FS9 A;  3S5W A;  2BK3 A;  3ATR A;  3COX A;  1E1M A;  3KD9 A;  5JCK A;  1VDC A;  3CIR A;  4J57 A;  2HQM A;  3SZF A;  1FCD A;  3H8L A;  3SY4 A;  4EIQ A;  4IA5 A;  4UDP A;  4BK3 A;  2I0Z A;  3GD3 A;  3DA1 A;  4IVM B;  4J56 A;  4LU6 A;  3G5S A;  4P9S A;  1LJ1 A;  2R0P A;  4K2X A;  5KMQ A;  1FEB A;  4IA6 A;  1N4V A;  1NHR A;  1EL8 A;  3UKK A;  1GOS A;  3ALL A;  1EL9 A;  1ZX9 A;  2C64 A;  4OPD A;  4BJZ A;  1NHP A;  3BNM A;  3DME A;  3M13 A;  3BHK A;  1PS9 A;  4M52 A;  4A99 A;  5KOX A;  4YKF A;  2WPF A;  1XDI A;  1K4Q A;  1H84 A;  1Y56 B;  4AT2 A;  2VZ2 A;  1YKJ A;  4U8O A;  2OAL A;  3AYJ A;  3PS9 A;  3GMC A;  5JCN A;  3BI5 A;  3CTY A;  3ISH A;  3L1R A;  2C4C A;  1GRG A;  4GAV A;  1L9C A;  1PJ5 A;  3F8R A;  3IHG A;  4TLZ A;  5BRT A;  2JB3 A;  2WDR A;  3AE7 A;  3T31 A;  1CF3 A;  1TDK A;  3URH A;  4G6H A;  1E1L A;  4OPT A;  4ICY A;  3GDP A;  4BK1 A;  1UKV G;  4H4R A;  5CQF A;  3GD4 A;  1PBC A;  1F6M A;  3DH9 A;  2Q0L A;  4NTE A;  4C5O A;  2IVE A;  3WE0 A;  3UKL A;  2XFO A;  4OPI A;  4B69 A;  2GAG B;  4K7Z A;  3AE1 A;  3GWF A;  3ATQ A;  2UZZ A;  3B3R A;  2YAU A;  3SZ0 A;  2FJB A;  4U8P A;  4ZCD A;  1IUW A;  2GQF A;  2B7S A;  3FBS A;  4JNA A;  1GT8 A;  3RP7 A;  3SFE A;  2PYX A;  3KU9 A;  4D03 A;  2VVM A;  3Q6J A;  5EB5 A;  1KNR A;  3M0O A;  4KX6 A;  4XWR A;  1DJQ A;  1CJC A;  4AP1 A;  2YLZ A;  3CPJ G;  3F8P A;  3NTD A;  3QSM A;  3CNP A;  4GDE A;  4J31 A;  2NVK X;  3DGH A;  4NEW A;  5KRQ A;  1BKW A;  3I3L A;  3DJJ A;  2R0C A;  4NTD A;  4U8L A;  5M10 A;  3DJE A;  2BYB A;  3E1T A;  3AED A;  1NEN A;  4H7U A;  3F8D A;  1JNZ A;  4K5R A;  1CBO A;  1GTE A;  3AEC A;  3AEB A;  3P9U A;  4Z43 A;  1GSN A;  3V76 A;  1LTX R;  2V61 A;  3FPZ A;  5KNL A;  4H4U A;  3BNU A;  2VVL G;  3PO7 A;  1CJ3 A;  2Q7V A;  2W0H A;  3IWA A;  3IF9 A;  2BAB A;  2BS4 A;  4IVO B;  4DSH A;  1B5Q A;  1B37 A;  3AD9 B;  1BF3 A;  5U1O A;  3EAO A;  3SFD A;  4CCQ A;  3II4 A;  2YM2 A;  4C3X A;  2BS3 A;  1KDG A;  3KPK A;  1MO9 A;  3RNM A;  1RYI A;  1GES A;  1V59 A;  3GDN A;  2XVH A;  4Z25 A;  3FIM B;  1PBF A;  1KF6 A;  3OC4 A;  1JRY A;  1QLB A;  2IID A;  3NK0 X;  4YSY A;  5IQ4 A;  2BRY A;  2BXS A;  1GET A;  2XLU A;  3GRS A;  1Z6L A;  1NEK A;  4A79 A;  3CPI G;  2OLO A;  1GRB A;  1GV4 A;  1O5W A;  2V60 A;  2X99 A;  3ADA B;  5JCI A;  2JB2 A;  3ALJ A;  3B6D A;  2WP5 A;  5TR3 A;  1IUX A;  3PVC A;  3LXD A;  4EMJ A;  3UKQ A;  2XVF A;  3V3N A;  1DJN A;  1DXL A;  1NHS A;  1IUU A;  4H4Y A;  1O95 A;  1CJ2 A;  3O0H A;  4H2N A;  4YWO A;  2Q6U A;  4JY2 A;  1K0I A;  5KXJ A;  3QVR A;  4B63 A;  3L8K A;  2ARD A;  1N4U A;  5EOW A;  3NG7 X;  2YLT A;  1CC4 A;  1YY5 A; 
#chains in the Genus database with same CATH homology
 2GMJ A;  5HXI A;  2YR4 A;  4ADW A;  4U8M A;  1EL7 A;  4AT0 A;  1ZP0 A;  4LII A;  1PDH A;  1N1P A;  3UCL A;  4D04 A;  1E7P A;  1Q1R A;  3V3O A;  2AAQ A;  3CGE A;  4H2R A;  3CGC A;  4H4Q A;  1XPQ A;  1GEU A;  1B8S A;  1OJD A;  2Q0K A;  5C2T A;  3T37 A;  4O5Q A;  1COY A;  3S61 A;  4CCR A;  2TPR A;  3T14 A;  1JOA A;  1TRB A;  3DJG X;  1F8S A;  4H4T A;  1E6E A;  2H89 A;  4APN A;  4GAP A;  5KOW A;  2XVE A;  3DGZ A;  3I6D A;  5LV9 A;  2WOV A;  3SQP A;  2YVJ A;  1DOB A;  4CNJ A;  3C4N A;  5GRT A;  3DJD A;  2YG3 A;  1JRZ A;  3LOV A;  1CL0 A;  2E1M A;  3SGL A;  2C65 A;  4RSL A;  3D1C A;  5GSN A;  1RSG A;  2C70 A;  2B9X A;  5C3J A;  3NT6 A;  1ZK7 A;  4G9K A;  3AE3 A;  3UKP A;  4U2S A;  2YLX A;  4A7A A;  3CN8 A;  1VG0 A;  4JDR A;  1BZL A;  2EQ9 A;  1YQ3 A;  3NRN A;  1ZOY A;  2GR2 A;  2C67 A;  2R9Z A;  3SZW A;  4OVI A;  3ALM A;  2ZBW A;  1QJD A;  4OPL A;  2YG7 A;  4II2 A;  2EQ7 A;  1FOH A;  4GRT A;  3UOZ A;  2YG6 A;  1BGJ A;  2OLN A;  2R4E A;  3AEE A;  2JB1 A;  2OAM A;  3GWD A;  4FDC B;  4K8D A;  2GQW A;  3AXB A;  1DOD A;  2GB0 A;  4REK A;  4YTM A;  1GXF A;  2YG4 A;  4H4P A;  3GYI A;  4Z2T A;  3NN0 X;  3AE8 A;  3NYE A;  3NIX A;  4PAB A;  4C3Y A;  2YVF A;  1H81 A;  2RGJ A;  3ICS A;  1JU2 A;  4FK1 C;  2V6O A;  3NYF A;  1OJT A;  1PXC A;  1LPF A;  3AD8 B;  3DK9 A;  2R46 A;  4B68 A;  4CY8 A;  4TM0 A;  3NGC X;  1PJ7 A;  4DGK A;  4G73 A;  1ZKQ A;  4II3 A;  1HYU A;  4EM3 A;  3QVP A;  4H4S A;  2R4J A;  2GEW A;  2BXR A;  5EBK A;  5L46 A;  3UP4 A;  2BCP A;  4JQ9 A;  3UTH A;  1XAN A;  3VQR A;  2BK4 A;  2YLS A;  3RHA A;  4LA1 A;  5KWF A;  2F5Z A;  3VRD B;  1LQT A;  3IC9 A;  2GR1 A;  3G5Q A;  1OJA A;  4H4Z A;  4H2P A;  3H8I A;  1H83 A;  1PXA A;  4FX9 A;  4H4W A;  3UTG A;  3VR8 A;  4BUR A;  4NTC A;  5KMP A;  4CNK A;  2XLT A;  2WES A;  4KPR A;  1SEZ A;  1S2Y A;  5CKU A;  4BJY A;  1KFY A;  1NG3 A;  3LJP A;  4BK2 A;  4TLX A;  3NK1 X;  3CND A;  3K7T A;  4J33 A;  1GRH A;  2YLW A;  4OPG A;  3UKH A;  2BK5 A;  2E5V A;  1GND A;  3NKS A;  4NNJ A;  3GRT A;  3ITJ A;  2BAC A;  2XLS A;  1D4E A;  2GMH A;  5M0Z A;  3QJ4 A;  5U25 A;  1CC2 A;  4H4X A;  1KSU A;  4U8K A;  2WOW A;  2ZZB A;  3P4P A;  4EQR A;  1S3E A;  4ZCC A;  1VQW A;  2FBW A;  2GF3 A;  5IQ1 A;  2YWL A;  1Q9I A;  2WDQ A;  2WET A;  4AOS A;  3UTF A;  4EM4 A;  1JNR A;  1S3B A;  4OCG A;  2NPX A;  1ZY8 A;  4GR1 A;  2B9Y A;  2FJA A;  2XLP A;  1ELI A;  2EQ6 A;  4ECH A;  4Y4L A;  2CFY A;  3NYC A;  4Z44 A;  1F8R A;  3FG2 P;  1EL5 A;  2X8H A;  1K0J A;  3AWI A;  3UKF A;  4YTP A;  2C3D A;  1BWC A;  3C96 A;  2WQY A;  2B7R A;  1GRT A;  1VRQ B;  3P4Q A;  3NN6 X;  4OPC A;  2X50 A;  2AR8 A;  2XFU A;  2JKC A;  4B67 A;  4GUV A;  1H6V A;  4UDR A;  4TM4 A;  1LVL A;  2E4G A;  1L9D A;  2R45 A;  2WS3 A;  3P4S A;  1LV0 A;  2APG A;  1PN0 A;  2WP6 A;  4TM1 A;  3AE6 A;  2JK6 A;  3SM8 A;  3LB8 A;  2WPE A;  1ONF A;  3LZW A;  1H86 A;  3KKJ A;  3VRA A;  2YVG A;  1GER A;  2VRM A;  1FEC A;  1NHQ A;  3HYV A;  4HA6 A;  4NWZ A;  2GVC A;  1LQU A;  1XHC A;  1GAL A;  5J60 A;  4GCM A;  5HY5 A;  3SXI A;  5IPY A;  4XXG A;  3RP6 A;  3T2Z A;  2C73 A;  2FJD A;  3KPF A;  2XFP A;  3RP8 A;  1P2E A;  5EB4 A;  2GR0 A;  4Y4N A;  4B1B A;  4UP3 A;  1D4D A;  2ZZ0 A;  4NEV A;  4XWZ A;  2YR5 A;  1L9E A;  2BC1 A;  1CJ4 A;  1FEA A;  2RAB A;  3GYX A;  2VVL A;  2XDO A;  3JSK A;  4FK1 A;  4OPU A;  3ABV A;  2GRT A;  3HYW A;  4RG3 A;  4Z26 A;  4B64 A;  2BA9 A;  1NPX A;  1TYT A;  3KLJ A;  2QCU A;  2XLR A;  3NNE A;  4E0V A;  4O5U A;  1PXB A;  3ICT A;  4IV9 A;  5JCM A;  1GRA A;  2YR6 A;  3EPT A;  3Q9T A;  2XVI A;  4EQX A;  2Z5X A;  2XVJ A;  2A8X A;  2A87 A;  2WDV A;  4X9M A;  1N4W A;  4AP3 A;  1PJ6 A;  1JRX A;  1B4V A;  2WEU A;  3BI2 A;  3AE9 A;  4ZN0 A;  1REO A;  2QA1 A;  4I59 A;  3QFA A;  4G74 A;  2X3N A;  4YSH A;  2V5Z A;  3P4R A;  2XCG A;  2WOI A;  4A5L A;  2JBV A;  3QFB A;  1D4C A;  3UOV A;  1PBB A;  5KVI A;  3UTE A;  4I58 A;  4CBQ A;  1NG4 A;  3CGB A;  4G6G A;  4H2Q A;  2GAH B;  4Y4M A;  1IUV A;  4J34 A;  4U8J A;  2YM1 A;  3HZL A;  4WX1 A;  1DOC A;  3AYL A;  3NH3 X;  3T0K A;  3M12 A;  5FS7 A;  3SX6 A;  1TDO A;  1ZMC A;  5FS8 A;  4U2T A;  1EBD A;  2GH5 A;  2WBA A;  2C72 A;  3AD7 B;  2J3N A;  4H4V A;  4MJW A;  1E1N A;  2BC0 A;  3KVE A;  4DNA A;  2C76 A;  4EQS A;  1H7X A;  1E1K A;  2O9Z A;  5KVH A;  4AOX A;  5J7X A;  2WP9 A;  4Z2R A;  1RP0 A;  2CVJ A;  2VQ7 A;  3IHM A;  3EF6 A;  3NTA A;  3QSE A;  1L0V A;  4A6N A;  1P2H A;  4PAA A;  4B66 A;  3LZX A;  4USQ A;  4YKG A;  3G5R A;  2H88 A;  3VR9 A;  1YQZ A;  4YTN A;  1TDN A;  3DK4 A;  1F3P A;  1OJC A;  2R0G A;  2XYO A;  3T2Y A;  1KSS A;  1Q1W A;  4BV6 A;  2XFQ A;  2DKI A;  3RED A;  4C77 A;  1GTH A;  2ZZC A;  3AE5 A;  3NK2 X;  4CY6 A;  1OJ9 A;  1H7W A;  2A89 A;  2YQU A;  3AEA A;  3QSS A;  2V3B A;  4GDP A;  1YQ4 A;  3UOY A;  4N9X A;  1ZOV A;  4EMI A;  1NAA A;  3CPH G;  2WPC A;  2C7G A;  1PBE A;  4X4J A;  4YSZ A;  5HYM A;  1PBD A;  3GYJ A;  1GRF A;  5U63 A;  4J2W A;  3UOX A;  3OZ2 A;  4CRT A;  4DSG A;  3UP5 A;  1PHH A;  2Y6Q A;  2BS2 A;  4WCT A;  5FMH A;  5HHF A;  2C75 A;  1D7L A;  1CHU A;  1D7Y A;  4C74 A;  2DKH A;  5KMS A;  1O94 A;  1W4X A;  1JEH A;  1GPE A;  1IJH A;  2X8C A;  2VRL A;  3GSI A;  3ZYX A;  2CUL A;  2B76 A;  3AB1 A;  3K30 A;  4JY3 A;  3UKA A;  5KMR A;  1X31 B;  3NHO X;  1TDF A;  4B65 A;  4GF7 A;  4YT0 A;  3SZC A;  1Y56 A;  3GMB A;  4RG4 A;  2OA1 A;  1TDE A;  3NLC A;  1GRE A;  3C4A A;  1KNP A;  4UDQ A;  3KA7 A;  1IUS A;  2EQ8 A;  1M6I A;  3BHF A;  2WU2 A;  2ACZ A;  1MXT A;  2Y6R A;  2PHH A;  1BGN A;  3AE2 A;  1D5T A;  2QAE A;  3AE4 A;  4K5S A;  4H50 A;  2QA2 A;  5BUK A;  1AOG A;  3CGD A;  3CMM A;  3AEF A;  2XFN A;  4A9W A;  1QO8 A;  1DOE A;  3CNT A;  5ER0 A;  4JN9 A;  3AYI A;  4K22 A;  4YSX A;  5DBJ A;  5BUL A;  5BVA A;  2YG5 A;  1K0L A;  4USR A;  1E39 A;  1FL2 A;  2YLR A;  4EQW A;  1F8W A;  1MOK A;  1M64 A;  4A65 A;  3H4K A;  4YXD A;  4U8I A;  2TMD A;  3K7M X;  2C66 A;  4EIP A;  4X9N A;  1DNC A;  1TYP A;  5JCL A;  4HB9 A;  3DK8 A;  3ZDN A;  4Z24 A;  2FJE A;  2VQB A;  4EMW A;  3P1W A;  2AQJ A;  3K7Q X;  5FS6 A;  4TM3 A;  2WHD A;  3T2K A;  3HYX A;  4A6N B;  2B9W A;  4U2L A;  4JNQ A;  2V3A A;  3LAD A;  3VRB A;  1ZMD A;  1S2Q A;  2GV8 A;  3BI4 A;  2JAE A;  2Z5Y A;  4U8N A;  2X8G A;  1CC6 A;  1NDA A;  3AEG A;  3SYI A;  4J36 A;  2BCG G;  2CDU A;  3EAN A;  3ICR A;  4Z2U A;  2IVD A;  1ZDL A;  1IUT A;  1H82 A;  2BRA A;  2GR3 A;  2RGO A;  2WU5 A;  3D8X A;  4NZH A;  3CNJ A;  2C3C A;  2RGH A;  3CNS A;  1VG9 A;  3FMW A;  3R9U A;  1Y0P A;  2VOU A;  5FS9 A;  3S5W A;  2BK3 A;  3ATR A;  3COX A;  1E1M A;  3KD9 A;  5JCK A;  1VDC A;  3CIR A;  4J57 A;  2HQM A;  3SZF A;  1FCD A;  3H8L A;  3SY4 A;  4EIQ A;  4IA5 A;  4UDP A;  4BK3 A;  2I0Z A;  3GD3 A;  3DA1 A;  4IVM B;  4J56 A;  4LU6 A;  3G5S A;  4P9S A;  1LJ1 A;  2R0P A;  4K2X A;  5KMQ A;  1FEB A;  4IA6 A;  1N4V A;  1NHR A;  1EL8 A;  3UKK A;  1GOS A;  3ALL A;  1EL9 A;  1ZX9 A;  2C64 A;  4OPD A;  4BJZ A;  1NHP A;  3BNM A;  3DME A;  3M13 A;  3BHK A;  1PS9 A;  4M52 A;  4A99 A;  5KOX A;  4YKF A;  2WPF A;  1XDI A;  1K4Q A;  1H84 A;  1Y56 B;  4AT2 A;  2VZ2 A;  1YKJ A;  4U8O A;  2OAL A;  3AYJ A;  3PS9 A;  3GMC A;  5JCN A;  3BI5 A;  3CTY A;  3ISH A;  3L1R A;  2C4C A;  1GRG A;  4GAV A;  1L9C A;  1PJ5 A;  3F8R A;  3IHG A;  4TLZ A;  5BRT A;  2JB3 A;  2WDR A;  3AE7 A;  3T31 A;  1CF3 A;  1TDK A;  3URH A;  4G6H A;  1E1L A;  4OPT A;  4ICY A;  3GDP A;  4BK1 A;  1UKV G;  4H4R A;  5CQF A;  3GD4 A;  1PBC A;  1F6M A;  3DH9 A;  2Q0L A;  4NTE A;  4C5O A;  2IVE A;  3WE0 A;  3UKL A;  2XFO A;  4OPI A;  4B69 A;  2GAG B;  4K7Z A;  3AE1 A;  3GWF A;  3ATQ A;  2UZZ A;  3B3R A;  2YAU A;  3SZ0 A;  2FJB A;  4U8P A;  4ZCD A;  1IUW A;  2GQF A;  2B7S A;  3FBS A;  4JNA A;  1GT8 A;  3RP7 A;  3SFE A;  2PYX A;  3KU9 A;  4D03 A;  2VVM A;  3Q6J A;  5EB5 A;  1KNR A;  3M0O A;  4KX6 A;  4XWR A;  1DJQ A;  1CJC A;  4AP1 A;  2YLZ A;  3CPJ G;  3F8P A;  3NTD A;  3QSM A;  3CNP A;  4GDE A;  4J31 A;  2NVK X;  3DGH A;  4NEW A;  5KRQ A;  1BKW A;  3I3L A;  3DJJ A;  2R0C A;  4NTD A;  4U8L A;  5M10 A;  3DJE A;  2BYB A;  3E1T A;  3AED A;  1NEN A;  4H7U A;  3F8D A;  1JNZ A;  4K5R A;  1CBO A;  1GTE A;  3AEC A;  3AEB A;  3P9U A;  4Z43 A;  1GSN A;  3V76 A;  1LTX R;  2V61 A;  3FPZ A;  5KNL A;  4H4U A;  3BNU A;  2VVL G;  3PO7 A;  1CJ3 A;  2Q7V A;  2W0H A;  3IWA A;  3IF9 A;  2BAB A;  2BS4 A;  4IVO B;  4DSH A;  1B5Q A;  1B37 A;  3AD9 B;  1BF3 A;  5U1O A;  3EAO A;  3SFD A;  4CCQ A;  3II4 A;  2YM2 A;  4C3X A;  2BS3 A;  1KDG A;  3KPK A;  1MO9 A;  3RNM A;  1RYI A;  1GES A;  1V59 A;  3GDN A;  2XVH A;  4Z25 A;  3FIM B;  1PBF A;  1KF6 A;  3OC4 A;  1JRY A;  1QLB A;  2IID A;  3NK0 X;  4YSY A;  5IQ4 A;  2BRY A;  2BXS A;  1GET A;  2XLU A;  3GRS A;  1Z6L A;  1NEK A;  4A79 A;  3CPI G;  2OLO A;  1GRB A;  1GV4 A;  1O5W A;  2V60 A;  2X99 A;  3ADA B;  5JCI A;  2JB2 A;  3ALJ A;  3B6D A;  2WP5 A;  5TR3 A;  1IUX A;  3PVC A;  3LXD A;  4EMJ A;  3UKQ A;  2XVF A;  3V3N A;  1DJN A;  1DXL A;  1NHS A;  1IUU A;  4H4Y A;  1O95 A;  1CJ2 A;  3O0H A;  4H2N A;  4YWO A;  2Q6U A;  4JY2 A;  1K0I A;  5KXJ A;  3QVR A;  4B63 A;  3L8K A;  2ARD A;  1N4U A;  5EOW A;  3NG7 X;  2YLT A;  1CC4 A;  1YY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...