5EP7A

Crystal structure of the bromodomain of human crebbp in complex with un32
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Binding Motifs in the CBP Bromodomain: An Analysis of 20 Crystal Structures of Complexes with Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ep7A00
4O7EA 4HBXA 5D3JA 2F6JA 5C87A 4TT4A 4ZC9A 2R0SA 5LUUA 1EQFA 4Z6IA 2DWWA 3G0JA 3AADA 5LKXA 4IR6A 5D3SA 3MB3A 2OUOA 4QY4A 5C85A 5HJCA 5E7DA 4PS5A 5FE0A 4YH3A 5F1HA 2R0YA 4NXJA 5HFQA 5DLZA 4UIZA 5F63A 5I1QA 5FE6A 3MQMA 5LKZA 2RS9B 4J0SA 4TU4A 2RI7A 5J0DA 4QC3A 5FFVA 5TCMA 3LQHA 3HMFA 5A5RA 3UVXA 4HXOA 2YEMA 4PKLA 4HXNA 5JI8A 2OSSA 5EPBA 4TTEA 4YYHA 4HXSA 4YYJA 5EWVA 5DYUA 5ENGA 4NQNA 5HQ6A 4ALGA 5DYAA 5HENA 5G4SA 4A9NA 4J3IA 5ACYA 3UVDA 3LQIA 4A9IA 4CL9A 3RCWA 3UV2A 4TU6A 5IGKA 2L84A 3UV5A 3JVKA 4UYFB 2R0VA 5E9KA 4O76A 4NUDA 3LQJA 4NR8A 4XY8A 4YC9A 5E0RA 4UIWA 4WHUA 4MR6A 5EISA 5CQ8A 3O36A 5H1TA 5FH7A 5I83A 4N4FA 4KCXA 4IOOA 3MUKA 4MR3A 4LDFA 5EICA 4LZ2A 4LRGA 5I86A 4UITA 5FE4A 4CUTA 4Z6HA 3HMHA 2YELA 5D3HA 4MEOA 5FE2A 2RNYA 5KO4A 4TT2A 5ENJA 1JSPB 2YEKA 4NUCA 4IR3A 5D3RA 4XUAA 4O7FA 4MENA 5A5SA 4NR9A 5EPRA 4J1PA 5ENIA 5EK9A 3UVWA 4A9LA 4DONA 2DVQA 4Z1QA 4O77A 5LJ0A 3TLPA 4LYSA 3D7CA 5EWWA 5EGUA 5CU8A 5D0CA 5DFDA 5F25A 5CUAA 3ZYUA 3JVJA 5FG4A 5A7CA 4N4GA 4QUUA 3AQAA 2R10A 1F68A 2DATA 4KV4A 4ZQLA 4CUUA 4LZRA 4HBVA 4YK0A 5DX4A 4YBMA 5DKDA 3K2JA 5D3TA 3U5JA 5A5OA 5C89A 4TQNA 2RNXA 4YYGA 4C67A 4HXMA 5F2PA 5IBNA 5CPEA 3I3JA 4YBSA 5E9MA 5IIDA 5HFRA 5IGMA 5ENBA 5FE1A 4QR3A 5I40A 4UYDA 5CQAA 5HELA 4PY6A 5CZGA 5EWHA 5L98A 5FG6A 5I29A 3G0LA 5EWDA 5CUCA 5A83A 4Z1SA 3UVYA 5DW2A 4UIXA 5CS8A 5IG6A 5CQ5A 5LJ1A 4QYDA 4A9JA 3IU5A 4UIVA 5BT3A 3S92A 5FH6A 5CUDA 5F62A 2YW5A 5EA1A 4QR5A 2YDWA 5AMFA 4WHWA 5CGPA 3MB4A 4YY4A 5LVRA 5H1VA 5KHMA 2NXBA 2LSPB 5L8TA 3U5MA 5JWMA 5EM3A 5KTXA 2GRCA 5A5PA 3Q2EA 4QSTA 4QR4A 4XUBA 5CFWA 1ZS5A 5IGNA 4N3WA 4X2IA 3P5OA 5DY7A 2E7NA 3DWYA 5AD3A 4MEPA 4QSRA 5IGLA 3LJWA 4J0RA 4UIUA 4Y03A 5D3PA 4TT6A 4O72A 4F3IA 2E7OA 5E3GA 4FLPA 5D24A 4IR4A 4QC1A 5EVAA 4TS8A 3MULA 4YATA 4QZSA 5L96A 5A5QA 4BW2A 4TZ2A 4QSUA 5CY9A 5I7YA 5CQ7A 5F1LA 4PTBA 4Q0OA 2RO1A 5EP7A 5LJ2A 4NYWA 3QZTA 5I89A 5EU1A 5ETBA 5EV9A 3O33A 4ZW1A 5FB0A 4RVRA 5ENFA 4LR6A 4YBTA 3SVFA 4CURA 3FKMX 5I7XA 4LZSA 5DKHA 3U5PA 2DVVA 3QZSA 4C66A 4QSVA 5A5NA 4NYXA 5CQ6A 4GPJA 2I7KA 3O34A 4LYIA 4TZ8A 3UV4A 5D25A 2WP1A 5F60A 4CLBA 4CUSA 5DW1A 4NRBA 4O7BA 5ENHA 4MEQA 5HQ5A 5FDZA 4O74A 5ENEA 1E6IA 5E73A 4E96A 4A9OA 5ENCA 4A9FA 4PCIA 3LXJA 4O7CA 5BT5A 4NR7A 2RNWA 5H85A 5E3DA 5CUGA 3MXFA 5FE8A 5A82A 4UYFA 4OUFA 4N4HA 5G4RA 5HCLA 5CTLA 5K29A 5LKTA 2G4AA 4O78A 4CUPA 4YYKA 2RFJA 3Q2FA 5KTUA 3QZVA 4YADA 1WUMA 5L97A 4IORA 5FG5A 4NYVA 3ONIA 5D3LA 4QEUA 3JVMA 4O70A 4OGJA 4Q0NA 5CQTA 2DVSA 3DAIA 4LYWA 3U5LA 4QSSA 4NS5A 4Z93A 5DYXA 4O75A 2L85A 5FFWA 4QUTA 4NUEA 5CP5A 1JM4B 5FE3A 5D3NA 4YY6A 5AD2A 5HRXA 1N72A 5CUEA 4YYNA 5COIA 5HRWA 5I80A 2D82A 2WP2A 4XY9A 5DLXA 3P1FA 2E3KA 4XYAA 3SVGA 5C4QA 4NQMA 3P1DA 5CQ3A 4MR5A 4NRAA 5CRMA 2OO1A 5CUBA 5HLSA 4BHWA 5DFBA 4OGIA 4N4IA 3U5KA 2DKWA 4A9EA 3SVHA 4CUQA 4HXLA 5DBMA 4WIVA 5D26A 2N9GA 5F61A 4QSQA 4QSWA 5E9VA 5KTWA 4O71A 5FFYA 5C8GA 3IU6A 5H1UA 2KTBB 5E9YA 3U5NA 3JVLA 2YYNA 5ETDA 3U5OA 2YQDA 5AMEA 4CFKA 4YYIA 5D7XA 4QSPA 4YH4A 4IR5A 5FE9A 5I88A 4HBWA 4KV1A 5F36A 3NXBA 1X0JA 4QNSA 2F6NA 5FE7A 2DVRA 3UW9A 2I8NA 4QB3A 4YAXA 3O35A 4UYEA 4HBYA 5F3AA 4YYDA 5F5ZA 5FB1A 5LKUA 5E9LA 5FH8A 5EWCA 4A9MA 2L5EA 4AKNA 4TYLA 2D9EA 5LVQA 5E74A 4UIYA 5HEMA 5DYCA 5TB6A 5DKCA 4CFLA 4PCEA 2H60A 2MJVB 4HXPA 4NRCA 5EQ1A 5A85A 4YYMA 3O37A 4BW1A 3P1CA 5HQ7A 4UYGA 5FE5A 3P1EA 4QEVA 4O7AA 4LC2A 2FSAA 4QSXA 5C7NA 5KU3A 4QBMA 4ALHA 4NR5A 5II1A 3HMEA 5CRZA 4NR4A 5BT4A 5EI4A 4QYLA 1WUGA 4HXKA 4HXRA 4NR6A 4A9HA 5HRVA 5E9IA 3S91A 3GG3A 4BW3A 5FBXA 5EPSA 5L99A 5HM0A 5CQ4A 4UYHA 4MR4A 4QEWA 4BW4A 5DFCA 4A9KA 5II2A 4IOQA 5L8UA 4BJXA 4YABA 5A81A
chains in the Genus database with same CATH superfamily
4O7EA 4HBXA 5D3JA 2F6JA 5C87A 4TT4A 4ZC9A 2R0SA 5LUUA 1EQFA 4Z6IA 2DWWA 3G0JA 3AADA 5LKXA 4IR6A 5D3SA 3MB3A 2OUOA 4QY4A 3ERRA 5C85A 5HJCA 5E7DA 4PS5A 5FE0A 4YH3A 5F1HA 2R0YA 4NXJA 5HFQA 1ZKRA 5DLZA 4UIZA 5F63A 5I1QA 5FE6A 3MQMA 5LKZA 2RS9B 4J0SA 4TU4A 2RI7A 5J0DA 4QC3A 5FFVA 5TCMA 3LQHA 3HMFA 5A5RA 3UVXA 4HXOA 2YEMA 4PKLA 4HXNA 5JI8A 2OSSA 5EPBA 4TTEA 4YYHA 4HXSA 4YYJA 5EWVA 5DYUA 5ENGA 4NQNA 5HQ6A 4ALGA 5DYAA 5HENA 5G4SA 4A9NA 4J3IA 5ACYA 3UVDA 3LQIA 4A9IA 4CL9A 3RCWA 3UV2A 4TU6A 5IGKA 2L84A 3UV5A 3JVKA 4UYFB 2R0VA 5E9KA 4O76A 4NUDA 3LQJA 4NR8A 4XY8A 4YC9A 5E0RA 4UIWA 4WHUA 4MR6A 5EISA 5CQ8A 3O36A 5H1TA 5FH7A 5I83A 4N4FA 4KCXA 4IOOA 3MUKA 4MR3A 4LDFA 5EICA 4LZ2A 4LRGA 5I86A 4UITA 5FE4A 4CUTA 4Z6HA 3HMHA 2YELA 5D3HA 4MEOA 5FE2A 2RNYA 5KO4A 4TT2A 5ENJA 1JSPB 2YEKA 4NUCA 4IR3A 5D3RA 4XUAA 4O7FA 4MENA 5A5SA 4NR9A 5EPRA 4J1PA 5ENIA 5EK9A 3UVWA 4A9LA 4DONA 2DVQA 4Z1QA 4O77A 5LJ0A 3TLPA 4LYSA 3D7CA 5EWWA 5EGUA 5CU8A 5D0CA 5DFDA 5F25A 5CUAA 3ZYUA 3JVJA 5FG4A 5A7CA 4N4GA 4QUUA 3D1BA 3AQAA 2R10A 1F68A 2DATA 4KV4A 4ZQLA 4CUUA 4LZRA 4HBVA 4YK0A 5DX4A 4YBMA 5DKDA 3K2JA 5D3TA 3U5JA 5A5OA 5C89A 4TQNA 2RNXA 4YYGA 4C67A 4HXMA 5F2PA 5IBNA 4AKIA 5CPEA 3I3JA 4YBSA 5E9MA 5IIDA 5HFRA 5IGMA 5ENBA 5FE1A 4QR3A 5I40A 4UYDA 5CQAA 5HELA 4PY6A 5CZGA 5EWHA 5L98A 5FG6A 5I29A 3G0LA 5EWDA 5CUCA 5A83A 4Z1SA 3UVYA 5DW2A 4UIXA 5CS8A 5IG6A 5CQ5A 5LJ1A 4QYDA 4A9JA 3IU5A 4UIVA 1PUOA 5BT3A 3S92A 5FH6A 5CUDA 5F62A 2YW5A 5EA1A 4QR5A 2YDWA 5AMFA 4WHWA 5CGPA 3MB4A 4YY4A 5LVRA 5H1VA 5KHMA 2NXBA 2LSPB 5L8TA 3U5MA 5JWMA 5EM3A 5KTXA 2GRCA 5A5PA 3Q2EA 4QSTA 4QR4A 4XUBA 5CFWA 1ZS5A 5IGNA 4N3WA 4X2IA 3P5OA 5DY7A 2E7NA 3DWYA 5AD3A 4MEPA 4QSRA 5IGLA 3LJWA 4J0RA 4UIUA 4Y03A 5D3PA 4TT6A 4O72A 4F3IA 2E7OA 5E3GA 4FLPA 5D24A 4IR4A 4QC1A 5EVAA 4TS8A 3MULA 4YATA 4QZSA 5L96A 5A5QA 4BW2A 4TZ2A 4QSUA 5CY9A 5I7YA 5CQ7A 5F1LA 4PTBA 4Q0OA 4AI6A 2RO1A 5EP7A 5LJ2A 4NYWA 3QZTA 5I89A 5EU1A 5ETBA 5EV9A 3O33A 4ZW1A 5FB0A 4RVRA 5ENFA 4LR6A 4YBTA 3SVFA 4CURA 3FKMX 5I7XA 4LZSA 5DKHA 3U5PA 3VKHA 2DVVA 3QZSA 4C66A 4QSVA 5A5NA 4NYXA 5CQ6A 4GPJA 2I7KA 3O34A 4LYIA 4TZ8A 3UV4A 5D25A 2WP1A 5F60A 4CLBA 4CUSA 5DW1A 4NRBA 4O7BA 5ENHA 4MEQA 5HQ5A 5FDZA 4O74A 5ENEA 4AKHA 1E6IA 3VKGA 5E73A 4E96A 4A9OA 5ENCA 4A9FA 4PCIA 3LXJA 4O7CA 5BT5A 4NR7A 2RNWA 5H85A 5E3DA 5CUGA 3MXFA 5FE8A 5A82A 4UYFA 4OUFA 4N4HA 5G4RA 5HCLA 5CTLA 5K29A 5LKTA 2G4AA 4O78A 4CUPA 4YYKA 2RFJA 3Q2FA 5KTUA 3QZVA 4YADA 1WUMA 5L97A 4IORA 5FG5A 4NYVA 3ONIA 5D3LA 4QEUA 3JVMA 4O70A 4OGJA 4Q0NA 5CQTA 2DVSA 3DAIA 4LYWA 3U5LA 4QSSA 4NS5A 4Z93A 5DYXA 4O75A 2L85A 5FFWA 4QUTA 4NUEA 5CP5A 1JM4B 5FE3A 5D3NA 4YY6A 5AD2A 5HRXA 2EJNA 1N72A 5CUEA 4YYNA 5COIA 5HRWA 5I80A 2D82A 2WP2A 4XY9A 5DLXA 3P1FA 2E3KA 4XYAA 3SVGA 5C4QA 4NQMA 3P1DA 5CQ3A 4MR5A 4NRAA 5CRMA 2OO1A 5CUBA 5HLSA 4BHWA 5DFBA 4OGIA 4N4IA 3U5KA 2DKWA 4A9EA 3SVHA 4CUQA 4HXLA 5DBMA 4WIVA 5D26A 2N9GA 5F61A 4QSQA 4QSWA 5E9VA 5KTWA 4O71A 5FFYA 5C8GA 3IU6A 5H1UA 2KTBB 5E9YA 3U5NA 3JVLA 4AKGA 2YYNA 5ETDA 3U5OA 2YQDA 5AMEA 4CFKA 4YYIA 5D7XA 4QSPA 4YH4A 4IR5A 5FE9A 5I88A 4HBWA 4KV1A 5F36A 3NXBA 1X0JA 4QNSA 2F6NA 5FE7A 2DVRA 3UW9A 2I8NA 4QB3A 4YAXA 3O35A 4UYEA 4HBYA 5F3AA 4YYDA 5F5ZA 5FB1A 5LKUA 5E9LA 5FH8A 5EWCA 4A9MA 2L5EA 4AKNA 4TYLA 2D9EA 5LVQA 5E74A 4UIYA 5HEMA 5DYCA 5TB6A 5DKCA 3D1DA 4CFLA 4PCEA 2H60A 2MJVB 4HXPA 4NRCA 5EQ1A 5A85A 4YYMA 3O37A 4BW1A 3P1CA 5HQ7A 4UYGA 5FE5A 3P1EA 4QEVA 4O7AA 4LC2A 2FSAA 4QSXA 5C7NA 5KU3A 4QBMA 4ALHA 4NR5A 5II1A 3HMEA 5CRZA 4NR4A 5BT4A 5EI4A 4QYLA 1WUGA 4HXKA 4HXRA 4NR6A 4A9HA 5HRVA 5E9IA 3S91A 3GG3A 4BW3A 5FBXA 5EPSA 5L99A 5HM0A 5CQ4A 4UYHA 4MR4A 4QEWA 4BW4A 5DFCA 4A9KA 5II2A 4IOQA 5L8UA 4BJXA 4YABA 5A81A
chains in the Genus database with same CATH topology
4O7EA 4HBXA 5D3JA 2F6JA 5C87A 4TT4A 4ZC9A 2R0SA 5LUUA 1EQFA 4Z6IA 2DWWA 3G0JA 3AADA 5LKXA 4IR6A 5D3SA 3MB3A 2OUOA 4QY4A 5C85A 5HJCA 5E7DA 4PS5A 5FE0A 4YH3A 5F1HA 2R0YA 4NXJA 5HFQA 5DLZA 4UIZA 5F63A 5I1QA 5FE6A 3MQMA 5LKZA 2RS9B 4J0SA 4TU4A 2RI7A 5J0DA 4QC3A 5FFVA 5TCMA 3LQHA 3HMFA 5A5RA 3UVXA 4HXOA 2YEMA 4PKLA 4HXNA 5JI8A 2OSSA 5EPBA 4TTEA 4YYHA 4HXSA 4YYJA 5EWVA 5DYUA 5ENGA 4NQNA 5HQ6A 4ALGA 5DYAA 5HENA 5G4SA 4A9NA 4J3IA 5ACYA 3UVDA 3LQIA 4A9IA 4CL9A 3RCWA 3UV2A 4TU6A 5IGKA 2L84A 3UV5A 3JVKA 4UYFB 2R0VA 5E9KA 4O76A 4NUDA 3LQJA 4NR8A 4XY8A 4YC9A 5E0RA 4UIWA 4WHUA 4MR6A 5EISA 5CQ8A 3O36A 5H1TA 5FH7A 5I83A 4N4FA 4KCXA 4IOOA 3MUKA 4MR3A 4LDFA 5EICA 4LZ2A 4LRGA 5I86A 4UITA 5FE4A 4CUTA 4Z6HA 3HMHA 2YELA 5D3HA 4MEOA 5FE2A 2RNYA 5KO4A 4TT2A 5ENJA 1JSPB 2YEKA 4NUCA 4IR3A 5D3RA 4XUAA 4O7FA 4MENA 5A5SA 4NR9A 5EPRA 4J1PA 5ENIA 5EK9A 3UVWA 4A9LA 4DONA 2DVQA 4Z1QA 4O77A 5LJ0A 3TLPA 4LYSA 3D7CA 5EWWA 5EGUA 5CU8A 5D0CA 5DFDA 5F25A 5CUAA 3ZYUA 3JVJA 5FG4A 5A7CA 4N4GA 4QUUA 3AQAA 2R10A 1F68A 2DATA 4KV4A 4ZQLA 4CUUA 4LZRA 4HBVA 4YK0A 5DX4A 4YBMA 5DKDA 3K2JA 5D3TA 3U5JA 5A5OA 5C89A 4TQNA 2RNXA 4YYGA 4C67A 4HXMA 5F2PA 5IBNA 5CPEA 3I3JA 4YBSA 5E9MA 5IIDA 5HFRA 5IGMA 5ENBA 5FE1A 4QR3A 5I40A 4UYDA 5CQAA 5HELA 4PY6A 5CZGA 5EWHA 5L98A 5FG6A 5I29A 3G0LA 5EWDA 5CUCA 5A83A 4Z1SA 3UVYA 5DW2A 4UIXA 5CS8A 5IG6A 5CQ5A 5LJ1A 4QYDA 4A9JA 3IU5A 4UIVA 5BT3A 3S92A 5FH6A 5CUDA 5F62A 2YW5A 5EA1A 4QR5A 2YDWA 5AMFA 4WHWA 5CGPA 3MB4A 4YY4A 5LVRA 5H1VA 5KHMA 2NXBA 2LSPB 5L8TA 3U5MA 5JWMA 5EM3A 5KTXA 2GRCA 5A5PA 3Q2EA 4QSTA 4QR4A 4XUBA 5CFWA 1ZS5A 5IGNA 4N3WA 4X2IA 3P5OA 5DY7A 2E7NA 3DWYA 5AD3A 4MEPA 4QSRA 5IGLA 3LJWA 4J0RA 4UIUA 4Y03A 5D3PA 4TT6A 4O72A 4F3IA 2E7OA 5E3GA 4FLPA 5D24A 4IR4A 4QC1A 5EVAA 4TS8A 3MULA 4YATA 4QZSA 5L96A 5A5QA 4BW2A 4TZ2A 4QSUA 5CY9A 5I7YA 5CQ7A 5F1LA 4PTBA 4Q0OA 2RO1A 5EP7A 5LJ2A 4NYWA 3QZTA 5I89A 5EU1A 5ETBA 5EV9A 3O33A 4ZW1A 5FB0A 4RVRA 5ENFA 4LR6A 4YBTA 3SVFA 4CURA 3FKMX 5I7XA 4LZSA 5DKHA 3U5PA 2DVVA 3QZSA 4C66A 4QSVA 5A5NA 4NYXA 5CQ6A 4GPJA 2I7KA 3O34A 4LYIA 4TZ8A 3UV4A 5D25A 2WP1A 5F60A 4CLBA 4CUSA 5DW1A 4NRBA 4O7BA 5ENHA 4MEQA 5HQ5A 5FDZA 4O74A 5ENEA 1E6IA 5E73A 4E96A 4A9OA 5ENCA 4A9FA 4PCIA 3LXJA 4O7CA 5BT5A 4NR7A 2RNWA 5H85A 5E3DA 5CUGA 3MXFA 5FE8A 5A82A 4UYFA 4OUFA 4N4HA 5G4RA 5HCLA 5CTLA 5K29A 5LKTA 2G4AA 4O78A 4CUPA 4YYKA 2RFJA 3Q2FA 5KTUA 3QZVA 4YADA 1WUMA 5L97A 4IORA 5FG5A 4NYVA 3ONIA 5D3LA 4QEUA 3JVMA 4O70A 4OGJA 4Q0NA 5CQTA 2DVSA 3DAIA 4LYWA 3U5LA 4QSSA 4NS5A 4Z93A 5DYXA 4O75A 2L85A 5FFWA 4QUTA 4NUEA 5CP5A 1JM4B 5FE3A 5D3NA 4YY6A 5AD2A 5HRXA 1N72A 5CUEA 4YYNA 5COIA 5HRWA 5I80A 2D82A 2WP2A 4XY9A 5DLXA 3P1FA 2E3KA 4XYAA 3SVGA 5C4QA 4NQMA 3P1DA 5CQ3A 4MR5A 4NRAA 5CRMA 2OO1A 5CUBA 5HLSA 4BHWA 5DFBA 4OGIA 4N4IA 3U5KA 2DKWA 4A9EA 3SVHA 4CUQA 4HXLA 5DBMA 4WIVA 5D26A 2N9GA 5F61A 4QSQA 4QSWA 5E9VA 5KTWA 4O71A 5FFYA 5C8GA 3IU6A 5H1UA 2KTBB 5E9YA 3U5NA 3JVLA 2YYNA 5ETDA 3U5OA 2YQDA 5AMEA 4CFKA 4YYIA 5D7XA 4QSPA 4YH4A 4IR5A 5FE9A 5I88A 4HBWA 4KV1A 5F36A 3NXBA 1X0JA 4QNSA 2F6NA 5FE7A 2DVRA 3UW9A 2I8NA 4QB3A 4YAXA 3O35A 4UYEA 4HBYA 5F3AA 4YYDA 5F5ZA 5FB1A 5LKUA 5E9LA 5FH8A 5EWCA 4A9MA 2L5EA 4AKNA 4TYLA 2D9EA 5LVQA 5E74A 4UIYA 5HEMA 5DYCA 5TB6A 5DKCA 4CFLA 4PCEA 2H60A 2MJVB 4HXPA 4NRCA 5EQ1A 5A85A 4YYMA 3O37A 4BW1A 3P1CA 5HQ7A 4UYGA 5FE5A 3P1EA 4QEVA 4O7AA 4LC2A 2FSAA 4QSXA 5C7NA 5KU3A 4QBMA 4ALHA 4NR5A 5II1A 3HMEA 5CRZA 4NR4A 5BT4A 5EI4A 4QYLA 1WUGA 4HXKA 4HXRA 4NR6A 4A9HA 5HRVA 5E9IA 3S91A 3GG3A 4BW3A 5FBXA 5EPSA 5L99A 5HM0A 5CQ4A 4UYHA 4MR4A 4QEWA 4BW4A 5DFCA 4A9KA 5II2A 4IOQA 5L8UA 4BJXA 4YABA 5A81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7E A;  4HBX A;  5D3J A;  2F6J A;  5C87 A;  4TT4 A;  4ZC9 A;  2R0S A;  5LUU A;  1EQF A;  4Z6I A;  2DWW A;  3G0J A;  3AAD A;  5LKX A;  4IR6 A;  5D3S A;  3MB3 A;  2OUO A;  4QY4 A;  5C85 A;  5HJC A;  5E7D A;  4PS5 A;  5FE0 A;  4YH3 A;  5F1H A;  2R0Y A;  4NXJ A;  5HFQ A;  5DLZ A;  4UIZ A;  5F63 A;  5I1Q A;  5FE6 A;  3MQM A;  5LKZ A;  2RS9 B;  4J0S A;  4TU4 A;  2RI7 A;  5J0D A;  4QC3 A;  5FFV A;  5TCM A;  3LQH A;  3HMF A;  5A5R A;  3UVX A;  4HXO A;  2YEM A;  4PKL A;  4HXN A;  5JI8 A;  2OSS A;  5EPB A;  4TTE A;  4YYH A;  4HXS A;  4YYJ A;  5EWV A;  5DYU A;  5ENG A;  4NQN A;  5HQ6 A;  4ALG A;  5DYA A;  5HEN A;  5G4S A;  4A9N A;  4J3I A;  5ACY A;  3UVD A;  3LQI A;  4A9I A;  4CL9 A;  3RCW A;  3UV2 A;  4TU6 A;  5IGK A;  2L84 A;  3UV5 A;  3JVK A;  4UYF B;  2R0V A;  5E9K A;  4O76 A;  4NUD A;  3LQJ A;  4NR8 A;  4XY8 A;  4YC9 A;  5E0R A;  4UIW A;  4WHU A;  4MR6 A;  5EIS A;  5CQ8 A;  3O36 A;  5H1T A;  5FH7 A;  5I83 A;  4N4F A;  4KCX A;  4IOO A;  3MUK A;  4MR3 A;  4LDF A;  5EIC A;  4LZ2 A;  4LRG A;  5I86 A;  4UIT A;  5FE4 A;  4CUT A;  4Z6H A;  3HMH A;  2YEL A;  5D3H A;  4MEO A;  5FE2 A;  2RNY A;  5KO4 A;  4TT2 A;  5ENJ A;  1JSP B;  2YEK A;  4NUC A;  4IR3 A;  5D3R A;  4XUA A;  4O7F A;  4MEN A;  5A5S A;  4NR9 A;  5EPR A;  4J1P A;  5ENI A;  5EK9 A;  3UVW A;  4A9L A;  4DON A;  2DVQ A;  4Z1Q A;  4O77 A;  5LJ0 A;  3TLP A;  4LYS A;  3D7C A;  5EWW A;  5EGU A;  5CU8 A;  5D0C A;  5DFD A;  5F25 A;  5CUA A;  3ZYU A;  3JVJ A;  5FG4 A;  5A7C A;  4N4G A;  4QUU A;  3AQA A;  2R10 A;  1F68 A;  2DAT A;  4KV4 A;  4ZQL A;  4CUU A;  4LZR A;  4HBV A;  4YK0 A;  5DX4 A;  4YBM A;  5DKD A;  3K2J A;  5D3T A;  3U5J A;  5A5O A;  5C89 A;  4TQN A;  2RNX A;  4YYG A;  4C67 A;  4HXM A;  5F2P A;  5IBN A;  5CPE A;  3I3J A;  4YBS A;  5E9M A;  5IID A;  5HFR A;  5IGM A;  5ENB A;  5FE1 A;  4QR3 A;  5I40 A;  4UYD A;  5CQA A;  5HEL A;  4PY6 A;  5CZG A;  5EWH A;  5L98 A;  5FG6 A;  5I29 A;  3G0L A;  5EWD A;  5CUC A;  5A83 A;  4Z1S A;  3UVY A;  5DW2 A;  4UIX A;  5CS8 A;  5IG6 A;  5CQ5 A;  5LJ1 A;  4QYD A;  4A9J A;  3IU5 A;  4UIV A;  5BT3 A;  3S92 A;  5FH6 A;  5CUD A;  5F62 A;  2YW5 A;  5EA1 A;  4QR5 A;  2YDW A;  5AMF A;  4WHW A;  5CGP A;  3MB4 A;  4YY4 A;  5LVR A;  5H1V A;  5KHM A;  2NXB A;  2LSP B;  5L8T A;  3U5M A;  5JWM A;  5EM3 A;  5KTX A;  2GRC A;  5A5P A;  3Q2E A;  4QST A;  4QR4 A;  4XUB A;  5CFW A;  1ZS5 A;  5IGN A;  4N3W A;  4X2I A;  3P5O A;  5DY7 A;  2E7N A;  3DWY A;  5AD3 A;  4MEP A;  4QSR A;  5IGL A;  3LJW A;  4J0R A;  4UIU A;  4Y03 A;  5D3P A;  4TT6 A;  4O72 A;  4F3I A;  2E7O A;  5E3G A;  4FLP A;  5D24 A;  4IR4 A;  4QC1 A;  5EVA A;  4TS8 A;  3MUL A;  4YAT A;  4QZS A;  5L96 A;  5A5Q A;  4BW2 A;  4TZ2 A;  4QSU A;  5CY9 A;  5I7Y A;  5CQ7 A;  5F1L A;  4PTB A;  4Q0O A;  2RO1 A;  5EP7 A;  5LJ2 A;  4NYW A;  3QZT A;  5I89 A;  5EU1 A;  5ETB A;  5EV9 A;  3O33 A;  4ZW1 A;  5FB0 A;  4RVR A;  5ENF A;  4LR6 A;  4YBT A;  3SVF A;  4CUR A;  3FKM X;  5I7X A;  4LZS A;  5DKH A;  3U5P A;  2DVV A;  3QZS A;  4C66 A;  4QSV A;  5A5N A;  4NYX A;  5CQ6 A;  4GPJ A;  2I7K A;  3O34 A;  4LYI A;  4TZ8 A;  3UV4 A;  5D25 A;  2WP1 A;  5F60 A;  4CLB A;  4CUS A;  5DW1 A;  4NRB A;  4O7B A;  5ENH A;  4MEQ A;  5HQ5 A;  5FDZ A;  4O74 A;  5ENE A;  1E6I A;  5E73 A;  4E96 A;  4A9O A;  5ENC A;  4A9F A;  4PCI A;  3LXJ A;  4O7C A;  5BT5 A;  4NR7 A;  2RNW A;  5H85 A;  5E3D A;  5CUG A;  3MXF A;  5FE8 A;  5A82 A;  4UYF A;  4OUF A;  4N4H A;  5G4R A;  5HCL A;  5CTL A;  5K29 A;  5LKT A;  2G4A A;  4O78 A;  4CUP A;  4YYK A;  2RFJ A;  3Q2F A;  5KTU A;  3QZV A;  4YAD A;  1WUM A;  5L97 A;  4IOR A;  5FG5 A;  4NYV A;  3ONI A;  5D3L A;  4QEU A;  3JVM A;  4O70 A;  4OGJ A;  4Q0N A;  5CQT A;  2DVS A;  3DAI A;  4LYW A;  3U5L A;  4QSS A;  4NS5 A;  4Z93 A;  5DYX A;  4O75 A;  2L85 A;  5FFW A;  4QUT A;  4NUE A;  5CP5 A;  1JM4 B;  5FE3 A;  5D3N A;  4YY6 A;  5AD2 A;  5HRX A;  1N72 A;  5CUE A;  4YYN A;  5COI A;  5HRW A;  5I80 A;  2D82 A;  2WP2 A;  4XY9 A;  5DLX A;  3P1F A;  2E3K A;  4XYA A;  3SVG A;  5C4Q A;  4NQM A;  3P1D A;  5CQ3 A;  4MR5 A;  4NRA A;  5CRM A;  2OO1 A;  5CUB A;  5HLS A;  4BHW A;  5DFB A;  4OGI A;  4N4I A;  3U5K A;  2DKW A;  4A9E A;  3SVH A;  4CUQ A;  4HXL A;  5DBM A;  4WIV A;  5D26 A;  2N9G A;  5F61 A;  4QSQ A;  4QSW A;  5E9V A;  5KTW A;  4O71 A;  5FFY A;  5C8G A;  3IU6 A;  5H1U A;  2KTB B;  5E9Y A;  3U5N A;  3JVL A;  2YYN A;  5ETD A;  3U5O A;  2YQD A;  5AME A;  4CFK A;  4YYI A;  5D7X A;  4QSP A;  4YH4 A;  4IR5 A;  5FE9 A;  5I88 A;  4HBW A;  4KV1 A;  5F36 A;  3NXB A;  1X0J A;  4QNS A;  2F6N A;  5FE7 A;  2DVR A;  3UW9 A;  2I8N A;  4QB3 A;  4YAX A;  3O35 A;  4UYE A;  4HBY A;  5F3A A;  4YYD A;  5F5Z A;  5FB1 A;  5LKU A;  5E9L A;  5FH8 A;  5EWC A;  4A9M A;  2L5E A;  4AKN A;  4TYL A;  2D9E A;  5LVQ A;  5E74 A;  4UIY A;  5HEM A;  5DYC A;  5TB6 A;  5DKC A;  4CFL A;  4PCE A;  2H60 A;  2MJV B;  4HXP A;  4NRC A;  5EQ1 A;  5A85 A;  4YYM A;  3O37 A;  4BW1 A;  3P1C A;  5HQ7 A;  4UYG A;  5FE5 A;  3P1E A;  4QEV A;  4O7A A;  4LC2 A;  2FSA A;  4QSX A;  5C7N A;  5KU3 A;  4QBM A;  4ALH A;  4NR5 A;  5II1 A;  3HME A;  5CRZ A;  4NR4 A;  5BT4 A;  5EI4 A;  4QYL A;  1WUG A;  4HXK A;  4HXR A;  4NR6 A;  4A9H A;  5HRV A;  5E9I A;  3S91 A;  3GG3 A;  4BW3 A;  5FBX A;  5EPS A;  5L99 A;  5HM0 A;  5CQ4 A;  4UYH A;  4MR4 A;  4QEW A;  4BW4 A;  5DFC A;  4A9K A;  5II2 A;  4IOQ A;  5L8U A;  4BJX A;  4YAB A;  5A81 A; 
#chains in the Genus database with same CATH topology
 4O7E A;  4HBX A;  5D3J A;  2F6J A;  5C87 A;  4TT4 A;  4ZC9 A;  2R0S A;  5LUU A;  1EQF A;  4Z6I A;  2DWW A;  3G0J A;  3AAD A;  5LKX A;  4IR6 A;  5D3S A;  3MB3 A;  2OUO A;  4QY4 A;  3ERR A;  5C85 A;  5HJC A;  5E7D A;  4PS5 A;  5FE0 A;  4YH3 A;  5F1H A;  2R0Y A;  4NXJ A;  5HFQ A;  1ZKR A;  5DLZ A;  4UIZ A;  5F63 A;  5I1Q A;  5FE6 A;  3MQM A;  5LKZ A;  2RS9 B;  4J0S A;  4TU4 A;  2RI7 A;  5J0D A;  4QC3 A;  5FFV A;  5TCM A;  3LQH A;  3HMF A;  5A5R A;  3UVX A;  4HXO A;  2YEM A;  4PKL A;  4HXN A;  5JI8 A;  2OSS A;  5EPB A;  4TTE A;  4YYH A;  4HXS A;  4YYJ A;  5EWV A;  5DYU A;  5ENG A;  4NQN A;  5HQ6 A;  4ALG A;  5DYA A;  5HEN A;  5G4S A;  4A9N A;  4J3I A;  5ACY A;  3UVD A;  3LQI A;  4A9I A;  4CL9 A;  3RCW A;  3UV2 A;  4TU6 A;  5IGK A;  2L84 A;  3UV5 A;  3JVK A;  4UYF B;  2R0V A;  5E9K A;  4O76 A;  4NUD A;  3LQJ A;  4NR8 A;  4XY8 A;  4YC9 A;  5E0R A;  4UIW A;  4WHU A;  4MR6 A;  5EIS A;  5CQ8 A;  3O36 A;  5H1T A;  5FH7 A;  5I83 A;  4N4F A;  4KCX A;  4IOO A;  3MUK A;  4MR3 A;  4LDF A;  5EIC A;  4LZ2 A;  4LRG A;  5I86 A;  4UIT A;  5FE4 A;  4CUT A;  4Z6H A;  3HMH A;  2YEL A;  5D3H A;  4MEO A;  5FE2 A;  2RNY A;  5KO4 A;  4TT2 A;  5ENJ A;  1JSP B;  2YEK A;  4NUC A;  4IR3 A;  5D3R A;  4XUA A;  4O7F A;  4MEN A;  5A5S A;  4NR9 A;  5EPR A;  4J1P A;  5ENI A;  5EK9 A;  3UVW A;  4A9L A;  4DON A;  2DVQ A;  4Z1Q A;  4O77 A;  5LJ0 A;  3TLP A;  4LYS A;  3D7C A;  5EWW A;  5EGU A;  5CU8 A;  5D0C A;  5DFD A;  5F25 A;  5CUA A;  3ZYU A;  3JVJ A;  5FG4 A;  5A7C A;  4N4G A;  4QUU A;  3D1B A;  3AQA A;  2R10 A;  1F68 A;  2DAT A;  4KV4 A;  4ZQL A;  4CUU A;  4LZR A;  4HBV A;  4YK0 A;  5DX4 A;  4YBM A;  5DKD A;  3K2J A;  5D3T A;  3U5J A;  5A5O A;  5C89 A;  4TQN A;  2RNX A;  4YYG A;  4C67 A;  4HXM A;  5F2P A;  5IBN A;  4AKI A;  5CPE A;  3I3J A;  4YBS A;  5E9M A;  5IID A;  5HFR A;  5IGM A;  5ENB A;  5FE1 A;  4QR3 A;  5I40 A;  4UYD A;  5CQA A;  5HEL A;  4PY6 A;  5CZG A;  5EWH A;  5L98 A;  5FG6 A;  5I29 A;  3G0L A;  5EWD A;  5CUC A;  5A83 A;  4Z1S A;  3UVY A;  5DW2 A;  4UIX A;  5CS8 A;  5IG6 A;  5CQ5 A;  5LJ1 A;  4QYD A;  4A9J A;  3IU5 A;  4UIV A;  1PUO A;  5BT3 A;  3S92 A;  5FH6 A;  5CUD A;  5F62 A;  2YW5 A;  5EA1 A;  4QR5 A;  2YDW A;  5AMF A;  4WHW A;  5CGP A;  3MB4 A;  4YY4 A;  5LVR A;  5H1V A;  5KHM A;  2NXB A;  2LSP B;  5L8T A;  3U5M A;  5JWM A;  5EM3 A;  5KTX A;  2GRC A;  5A5P A;  3Q2E A;  4QST A;  4QR4 A;  4XUB A;  5CFW A;  1ZS5 A;  5IGN A;  4N3W A;  4X2I A;  3P5O A;  5DY7 A;  2E7N A;  3DWY A;  5AD3 A;  4MEP A;  4QSR A;  5IGL A;  3LJW A;  4J0R A;  4UIU A;  4Y03 A;  5D3P A;  4TT6 A;  4O72 A;  4F3I A;  2E7O A;  5E3G A;  4FLP A;  5D24 A;  4IR4 A;  4QC1 A;  5EVA A;  4TS8 A;  3MUL A;  4YAT A;  4QZS A;  5L96 A;  5A5Q A;  4BW2 A;  4TZ2 A;  4QSU A;  5CY9 A;  5I7Y A;  5CQ7 A;  5F1L A;  4PTB A;  4Q0O A;  4AI6 A;  2RO1 A;  5EP7 A;  5LJ2 A;  4NYW A;  3QZT A;  5I89 A;  5EU1 A;  5ETB A;  5EV9 A;  3O33 A;  4ZW1 A;  5FB0 A;  4RVR A;  5ENF A;  4LR6 A;  4YBT A;  3SVF A;  4CUR A;  3FKM X;  5I7X A;  4LZS A;  5DKH A;  3U5P A;  3VKH A;  2DVV A;  3QZS A;  4C66 A;  4QSV A;  5A5N A;  4NYX A;  5CQ6 A;  4GPJ A;  2I7K A;  3O34 A;  4LYI A;  4TZ8 A;  3UV4 A;  5D25 A;  2WP1 A;  5F60 A;  4CLB A;  4CUS A;  5DW1 A;  4NRB A;  4O7B A;  5ENH A;  4MEQ A;  5HQ5 A;  5FDZ A;  4O74 A;  5ENE A;  4AKH A;  1E6I A;  3VKG A;  5E73 A;  4E96 A;  4A9O A;  5ENC A;  4A9F A;  4PCI A;  3LXJ A;  4O7C A;  5BT5 A;  4NR7 A;  2RNW A;  5H85 A;  5E3D A;  5CUG A;  3MXF A;  5FE8 A;  5A82 A;  4UYF A;  4OUF A;  4N4H A;  5G4R A;  5HCL A;  5CTL A;  5K29 A;  5LKT A;  2G4A A;  4O78 A;  4CUP A;  4YYK A;  2RFJ A;  3Q2F A;  5KTU A;  3QZV A;  4YAD A;  1WUM A;  5L97 A;  4IOR A;  5FG5 A;  4NYV A;  3ONI A;  5D3L A;  4QEU A;  3JVM A;  4O70 A;  4OGJ A;  4Q0N A;  5CQT A;  2DVS A;  3DAI A;  4LYW A;  3U5L A;  4QSS A;  4NS5 A;  4Z93 A;  5DYX A;  4O75 A;  2L85 A;  5FFW A;  4QUT A;  4NUE A;  5CP5 A;  1JM4 B;  5FE3 A;  5D3N A;  4YY6 A;  5AD2 A;  5HRX A;  2EJN A;  1N72 A;  5CUE A;  4YYN A;  5COI A;  5HRW A;  5I80 A;  2D82 A;  2WP2 A;  4XY9 A;  5DLX A;  3P1F A;  2E3K A;  4XYA A;  3SVG A;  5C4Q A;  4NQM A;  3P1D A;  5CQ3 A;  4MR5 A;  4NRA A;  5CRM A;  2OO1 A;  5CUB A;  5HLS A;  4BHW A;  5DFB A;  4OGI A;  4N4I A;  3U5K A;  2DKW A;  4A9E A;  3SVH A;  4CUQ A;  4HXL A;  5DBM A;  4WIV A;  5D26 A;  2N9G A;  5F61 A;  4QSQ A;  4QSW A;  5E9V A;  5KTW A;  4O71 A;  5FFY A;  5C8G A;  3IU6 A;  5H1U A;  2KTB B;  5E9Y A;  3U5N A;  3JVL A;  4AKG A;  2YYN A;  5ETD A;  3U5O A;  2YQD A;  5AME A;  4CFK A;  4YYI A;  5D7X A;  4QSP A;  4YH4 A;  4IR5 A;  5FE9 A;  5I88 A;  4HBW A;  4KV1 A;  5F36 A;  3NXB A;  1X0J A;  4QNS A;  2F6N A;  5FE7 A;  2DVR A;  3UW9 A;  2I8N A;  4QB3 A;  4YAX A;  3O35 A;  4UYE A;  4HBY A;  5F3A A;  4YYD A;  5F5Z A;  5FB1 A;  5LKU A;  5E9L A;  5FH8 A;  5EWC A;  4A9M A;  2L5E A;  4AKN A;  4TYL A;  2D9E A;  5LVQ A;  5E74 A;  4UIY A;  5HEM A;  5DYC A;  5TB6 A;  5DKC A;  3D1D A;  4CFL A;  4PCE A;  2H60 A;  2MJV B;  4HXP A;  4NRC A;  5EQ1 A;  5A85 A;  4YYM A;  3O37 A;  4BW1 A;  3P1C A;  5HQ7 A;  4UYG A;  5FE5 A;  3P1E A;  4QEV A;  4O7A A;  4LC2 A;  2FSA A;  4QSX A;  5C7N A;  5KU3 A;  4QBM A;  4ALH A;  4NR5 A;  5II1 A;  3HME A;  5CRZ A;  4NR4 A;  5BT4 A;  5EI4 A;  4QYL A;  1WUG A;  4HXK A;  4HXR A;  4NR6 A;  4A9H A;  5HRV A;  5E9I A;  3S91 A;  3GG3 A;  4BW3 A;  5FBX A;  5EPS A;  5L99 A;  5HM0 A;  5CQ4 A;  4UYH A;  4MR4 A;  4QEW A;  4BW4 A;  5DFC A;  4A9K A;  5II2 A;  4IOQ A;  5L8U A;  4BJX A;  4YAB A;  5A81 A; 
#chains in the Genus database with same CATH homology
 4O7E A;  4HBX A;  5D3J A;  2F6J A;  5C87 A;  4TT4 A;  4ZC9 A;  2R0S A;  5LUU A;  1EQF A;  4Z6I A;  2DWW A;  3G0J A;  3AAD A;  5LKX A;  4IR6 A;  5D3S A;  3MB3 A;  2OUO A;  4QY4 A;  5C85 A;  5HJC A;  5E7D A;  4PS5 A;  5FE0 A;  4YH3 A;  5F1H A;  2R0Y A;  4NXJ A;  5HFQ A;  5DLZ A;  4UIZ A;  5F63 A;  5I1Q A;  5FE6 A;  3MQM A;  5LKZ A;  2RS9 B;  4J0S A;  4TU4 A;  2RI7 A;  5J0D A;  4QC3 A;  5FFV A;  5TCM A;  3LQH A;  3HMF A;  5A5R A;  3UVX A;  4HXO A;  2YEM A;  4PKL A;  4HXN A;  5JI8 A;  2OSS A;  5EPB A;  4TTE A;  4YYH A;  4HXS A;  4YYJ A;  5EWV A;  5DYU A;  5ENG A;  4NQN A;  5HQ6 A;  4ALG A;  5DYA A;  5HEN A;  5G4S A;  4A9N A;  4J3I A;  5ACY A;  3UVD A;  3LQI A;  4A9I A;  4CL9 A;  3RCW A;  3UV2 A;  4TU6 A;  5IGK A;  2L84 A;  3UV5 A;  3JVK A;  4UYF B;  2R0V A;  5E9K A;  4O76 A;  4NUD A;  3LQJ A;  4NR8 A;  4XY8 A;  4YC9 A;  5E0R A;  4UIW A;  4WHU A;  4MR6 A;  5EIS A;  5CQ8 A;  3O36 A;  5H1T A;  5FH7 A;  5I83 A;  4N4F A;  4KCX A;  4IOO A;  3MUK A;  4MR3 A;  4LDF A;  5EIC A;  4LZ2 A;  4LRG A;  5I86 A;  4UIT A;  5FE4 A;  4CUT A;  4Z6H A;  3HMH A;  2YEL A;  5D3H A;  4MEO A;  5FE2 A;  2RNY A;  5KO4 A;  4TT2 A;  5ENJ A;  1JSP B;  2YEK A;  4NUC A;  4IR3 A;  5D3R A;  4XUA A;  4O7F A;  4MEN A;  5A5S A;  4NR9 A;  5EPR A;  4J1P A;  5ENI A;  5EK9 A;  3UVW A;  4A9L A;  4DON A;  2DVQ A;  4Z1Q A;  4O77 A;  5LJ0 A;  3TLP A;  4LYS A;  3D7C A;  5EWW A;  5EGU A;  5CU8 A;  5D0C A;  5DFD A;  5F25 A;  5CUA A;  3ZYU A;  3JVJ A;  5FG4 A;  5A7C A;  4N4G A;  4QUU A;  3AQA A;  2R10 A;  1F68 A;  2DAT A;  4KV4 A;  4ZQL A;  4CUU A;  4LZR A;  4HBV A;  4YK0 A;  5DX4 A;  4YBM A;  5DKD A;  3K2J A;  5D3T A;  3U5J A;  5A5O A;  5C89 A;  4TQN A;  2RNX A;  4YYG A;  4C67 A;  4HXM A;  5F2P A;  5IBN A;  5CPE A;  3I3J A;  4YBS A;  5E9M A;  5IID A;  5HFR A;  5IGM A;  5ENB A;  5FE1 A;  4QR3 A;  5I40 A;  4UYD A;  5CQA A;  5HEL A;  4PY6 A;  5CZG A;  5EWH A;  5L98 A;  5FG6 A;  5I29 A;  3G0L A;  5EWD A;  5CUC A;  5A83 A;  4Z1S A;  3UVY A;  5DW2 A;  4UIX A;  5CS8 A;  5IG6 A;  5CQ5 A;  5LJ1 A;  4QYD A;  4A9J A;  3IU5 A;  4UIV A;  5BT3 A;  3S92 A;  5FH6 A;  5CUD A;  5F62 A;  2YW5 A;  5EA1 A;  4QR5 A;  2YDW A;  5AMF A;  4WHW A;  5CGP A;  3MB4 A;  4YY4 A;  5LVR A;  5H1V A;  5KHM A;  2NXB A;  2LSP B;  5L8T A;  3U5M A;  5JWM A;  5EM3 A;  5KTX A;  2GRC A;  5A5P A;  3Q2E A;  4QST A;  4QR4 A;  4XUB A;  5CFW A;  1ZS5 A;  5IGN A;  4N3W A;  4X2I A;  3P5O A;  5DY7 A;  2E7N A;  3DWY A;  5AD3 A;  4MEP A;  4QSR A;  5IGL A;  3LJW A;  4J0R A;  4UIU A;  4Y03 A;  5D3P A;  4TT6 A;  4O72 A;  4F3I A;  2E7O A;  5E3G A;  4FLP A;  5D24 A;  4IR4 A;  4QC1 A;  5EVA A;  4TS8 A;  3MUL A;  4YAT A;  4QZS A;  5L96 A;  5A5Q A;  4BW2 A;  4TZ2 A;  4QSU A;  5CY9 A;  5I7Y A;  5CQ7 A;  5F1L A;  4PTB A;  4Q0O A;  2RO1 A;  5EP7 A;  5LJ2 A;  4NYW A;  3QZT A;  5I89 A;  5EU1 A;  5ETB A;  5EV9 A;  3O33 A;  4ZW1 A;  5FB0 A;  4RVR A;  5ENF A;  4LR6 A;  4YBT A;  3SVF A;  4CUR A;  3FKM X;  5I7X A;  4LZS A;  5DKH A;  3U5P A;  2DVV A;  3QZS A;  4C66 A;  4QSV A;  5A5N A;  4NYX A;  5CQ6 A;  4GPJ A;  2I7K A;  3O34 A;  4LYI A;  4TZ8 A;  3UV4 A;  5D25 A;  2WP1 A;  5F60 A;  4CLB A;  4CUS A;  5DW1 A;  4NRB A;  4O7B A;  5ENH A;  4MEQ A;  5HQ5 A;  5FDZ A;  4O74 A;  5ENE A;  1E6I A;  5E73 A;  4E96 A;  4A9O A;  5ENC A;  4A9F A;  4PCI A;  3LXJ A;  4O7C A;  5BT5 A;  4NR7 A;  2RNW A;  5H85 A;  5E3D A;  5CUG A;  3MXF A;  5FE8 A;  5A82 A;  4UYF A;  4OUF A;  4N4H A;  5G4R A;  5HCL A;  5CTL A;  5K29 A;  5LKT A;  2G4A A;  4O78 A;  4CUP A;  4YYK A;  2RFJ A;  3Q2F A;  5KTU A;  3QZV A;  4YAD A;  1WUM A;  5L97 A;  4IOR A;  5FG5 A;  4NYV A;  3ONI A;  5D3L A;  4QEU A;  3JVM A;  4O70 A;  4OGJ A;  4Q0N A;  5CQT A;  2DVS A;  3DAI A;  4LYW A;  3U5L A;  4QSS A;  4NS5 A;  4Z93 A;  5DYX A;  4O75 A;  2L85 A;  5FFW A;  4QUT A;  4NUE A;  5CP5 A;  1JM4 B;  5FE3 A;  5D3N A;  4YY6 A;  5AD2 A;  5HRX A;  1N72 A;  5CUE A;  4YYN A;  5COI A;  5HRW A;  5I80 A;  2D82 A;  2WP2 A;  4XY9 A;  5DLX A;  3P1F A;  2E3K A;  4XYA A;  3SVG A;  5C4Q A;  4NQM A;  3P1D A;  5CQ3 A;  4MR5 A;  4NRA A;  5CRM A;  2OO1 A;  5CUB A;  5HLS A;  4BHW A;  5DFB A;  4OGI A;  4N4I A;  3U5K A;  2DKW A;  4A9E A;  3SVH A;  4CUQ A;  4HXL A;  5DBM A;  4WIV A;  5D26 A;  2N9G A;  5F61 A;  4QSQ A;  4QSW A;  5E9V A;  5KTW A;  4O71 A;  5FFY A;  5C8G A;  3IU6 A;  5H1U A;  2KTB B;  5E9Y A;  3U5N A;  3JVL A;  2YYN A;  5ETD A;  3U5O A;  2YQD A;  5AME A;  4CFK A;  4YYI A;  5D7X A;  4QSP A;  4YH4 A;  4IR5 A;  5FE9 A;  5I88 A;  4HBW A;  4KV1 A;  5F36 A;  3NXB A;  1X0J A;  4QNS A;  2F6N A;  5FE7 A;  2DVR A;  3UW9 A;  2I8N A;  4QB3 A;  4YAX A;  3O35 A;  4UYE A;  4HBY A;  5F3A A;  4YYD A;  5F5Z A;  5FB1 A;  5LKU A;  5E9L A;  5FH8 A;  5EWC A;  4A9M A;  2L5E A;  4AKN A;  4TYL A;  2D9E A;  5LVQ A;  5E74 A;  4UIY A;  5HEM A;  5DYC A;  5TB6 A;  5DKC A;  4CFL A;  4PCE A;  2H60 A;  2MJV B;  4HXP A;  4NRC A;  5EQ1 A;  5A85 A;  4YYM A;  3O37 A;  4BW1 A;  3P1C A;  5HQ7 A;  4UYG A;  5FE5 A;  3P1E A;  4QEV A;  4O7A A;  4LC2 A;  2FSA A;  4QSX A;  5C7N A;  5KU3 A;  4QBM A;  4ALH A;  4NR5 A;  5II1 A;  3HME A;  5CRZ A;  4NR4 A;  5BT4 A;  5EI4 A;  4QYL A;  1WUG A;  4HXK A;  4HXR A;  4NR6 A;  4A9H A;  5HRV A;  5E9I A;  3S91 A;  3GG3 A;  4BW3 A;  5FBX A;  5EPS A;  5L99 A;  5HM0 A;  5CQ4 A;  4UYH A;  4MR4 A;  4QEW A;  4BW4 A;  5DFC A;  4A9K A;  5II2 A;  4IOQ A;  5L8U A;  4BJX A;  4YAB A;  5A81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...