5EPFA

Crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
153
Chain Sequence
HMKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVKQAKFAEVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin
publication title Crystal structure of Peroxidoxin BcpB from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Oxidoreductase
total genus 51
structure length 153
sequence length 154
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5epfA00
4BA7A 3EMPA 1YDKA 3BOAA 3CSJA 4POKA 1PKZA 4DSRA 1AC1A 1U3IA 1ZL9A 1F2EA 5FHIA 1QUWA 2B5XA 2VCWA 1SK0A 3PGTA 3BBYA 1TTZA 3TKRA 1V40A 3TJJA 2CA8A 3GNJA 1SENA 4TR1B 2GSRA 2DLXA 3F4RA 5HFGA 4FO5A 2GTUA 4LL4B 4J2FA 2VOCA 1TJDA 4QL9A 3ZLPA 5L71A 5IPHA 3TB2A 1G0TA 3G7IA 1B9YC 1XIYA 5EPFA 1ON4A 4F82A 1A0FA 3PR8A 4ZB8A 1CQHA 3F4SA 2OE1A 4EKZA 3APQA 4E8EA 3VWXA 1R5AA 2FA4A 2VLTA 2VL2A 4O7HA 4EDZA 2M72A 2O85A 1SJZA 2IMEA 2JSZA 3DMLA 3M8NA 3CYNA 2AYTA 2REMA 1GTAA 2CX3A 3GV1A 4Q5QA 3EC3A 4V2LA 5DVBA 2VLVA 1YF0A 1J08A 1EWXA 4OFTA 3FZ5A 4IN0A 2CQ9A 1SD8A 2PVQA 3LYPA 1AIUA 3W6GA 5B6NA 3OR5A 1NM3A 1A8LA 2OADA 2K8SA 4ML1A 4K0GA 2Z9SA 3GTUB 1JFUA 2H0GA 3GN3A 4HS1A 2FA8A 3E3EA 3MWHA 3D0ZA 4X0XA 4J57E 3FZ9A 4NWYA 1PMTA 2H73A 1GL8A 4GWRA 1A2JA 4H86A 3TJGA 2X64A 2ZNMA 3Q18A 1G6WA 1X5CA 1Z9HA 3I9V2 3US3A 3UARA 2OBKA 4HEA2 2F3MA 2LNTA 3GL3A 1HYUA 2F8FA 4HDEA 3KGKA 2QKEA 4K9ZA 4YQVA 2GZYA 2WDUA 1M9AA 4BWQA 4DVCA 3CTFA 2RUEA 2JACA 2IWTA 1SL1B 2C3QA 5G1LA 5G2ZA 1XWBA 4PQIA 1XW6A 5ECIB 2YJ7A 4CW9A 5AIXA 5INYA 2H74A 1PGTA 1K0CA 1M99A 2HT9A 3QOUA 5IPGA 4KSOA 4L0WA 4K7OA 5HR2A 5D9XA 1DE2A 2HLSA 1OVNA 3IV4A 3GX0A 3HVSA 5H5RA 3TJKA 1TK5B 3R2QA 5GAND 1FG4A 4TR1A 2E2MA 1TU7A 5D9WA 2VM2A 1GTBA 2PWJA 1QXHA 2RM6A 4HU9A 1GSQA 3DD3A 4N30A 1V98A 3FR6A 2PN8A 5CREA 3RHBA 4DSSB 4XS4A 3W8JA 1XZOA 3MSZA 2LJKA 5J5NA 1K0BA 5FWGA 2R3XA 3O3TA 2E0QA 3HHVA 1J0FA 4JRRA 5CRDA 4KGIA 3KP9A 2YWNA 3BD2A 1WRYA 2IMKA 1UA5A 3CRTA 5CRHA 1BQ7A 4JEDA 4MABA 5J3RA 2CVKA 5DALB 4OFMA 4BWSA 3KH9A 3QMXA 5EL8A 4XS1A 5CP1A 3DRNA 1TRVA 3IOSA 3HVXA 5H5SA 2YWOA 2VIMA 1M9BA 3ZMKA 1TRUA 1GTIA 2FY6A 2IFQB 3M9JA 4PQHA 3IE3A 2HYXA 3IA1A 3KZQA 4POLA 4CDOA 3QD9A 4ECIA 2XPDA 3NOFA 2O7KA 2GSQA 1DSBA 2HZEB 2H75A 3M0FA 5JCWA 5IMCA 1SD9A 4EC0A 4MDCA 4TN8A 2B1LA 4G10A 2MMOA 1O8WA 2RLIA 2C8UA 5G1KA 3KP8A 4ECJA 1X5EA 8GSSA 4ML6A 4PUFC 4EDYA 3F8UA 1KEBA 2B7KA 4TR4A 1QMVA 5GSSA 2YP6A 1UN2A 2CZ3A 5DJMA 1F3AA 3WT1A 4XRDA 4IBPA 4ZBDA 3RDWA 1TDIA 5JWOB 1OE7A 1M2BA 3DVXA 3D4TA 5HR1A 4O32A 3P90A 3TRPA 2XHFA 1EGOA 2KLXA 4QL7A 1BEDA 1ZGNA 2MMAA 2FWHA 4V1Ap 2VCXA 2KUCA 4I2TA 2P5QA 3GKKA 5IMAA 1YKAA 2O8VB 2GT5A 3IPZA 4IJIA 1THXA 4ACSA 2WJUA 3WGXA 1LU4A 4IQ1A 4L8EA 5IQYA 4IGJA 2C0GA 2AHEA 2P5RA 3CSIA 1TXXA 3FZAA 4XHMA 4F0BA 4XRAA 4GCIA 5ECKB 4TKYA 5IMDA 1SYXA 3SBCA 5DDLA 1QGVA 2CX4A 3UVHA 3ISOA 2JZRA 2AUVA 2YWIA 1XVQA 1THOA 4DSQA 5J41A 1KNGA 2DJKA 3H79A 3ZVJA 1PN9A 5KN3A 5A4WA 3S9FA 2JADA 14GSA 2JU5A 4MJEA 1RQMA 2ON7A 4AF2A 4YQUA 3CMIA 1JLVA 2RM5A 2DSAA 2K6VA 4K7NA 1PA3A 3HXSA 3CBUA 4KUNA 1N8JA 1T7PB 3C71A 5KN1A 2N5AA 1XOAA 1YJ6A 2NPBA 2OKAA 3ERGA 2QC7A 1Z5YE 1G7EA 3EVIA 1A8YA 2LQQA 3EYTA 1Z7RA 3BJ5A 1X5DA 5ECQB 3HVVA 3HJMA 3GKMA 2X8GA 4WF5A 3BCIA 4PXOA 1ST9A 2OE3A 2LJAA 5C04A 5D96A 3GMFA 1JZOA 4BPYA 2LTKA 2PBJA 3EE2A 4K2DA 5AISA 1YF1A 4EL1A 3J7Yk 3A5WA 2YWMA 4PNGA 1YEXA 3F3QA 3TRQA 4ECBA 3ERFA 2NVLA 4E8HA 3F9UA 5ECRB 5F8BA 2G0FA 1GULA 4IELA 4ECCA 4PNFA 2VCVA 1LBKA 5KN0A 4MPFA 1B48A 4JBBA 1XWCA 3APOA 3A2VA 4YAVA 5IO0A 1T8EB 2LV3A 5ABRA 2OA7A 2X8HA 3HDCA 5D73A 2H0HA 2H6ZA 5DJLA 2AJQB 5B8AA 1K0NA 4RQRA 1K0DA 1GSUA 4MH2A 5ELGA 2GSSA 4HOJA 4X43A 2VCQA 4FYBA 3LJRA 4ZB6A 2K18A 4ZXGA 2HE3A 2AAWA 1MDJA 1SU9A 1WOUA 3I69A 3ME7A 2OACA 1VF4A 2HFDA 5IOWA 4MZWA 3GURA 2DMLA 4KE3A 2A2SA 3EINA 5C00A 5A5KA 1GSYA 3N9JA 2L6DA 5J9BA 3GIXA 4K6XA 4POMA 4MZBA 5B8BA 2O89A 4KW6A 4PUAA 1H4OA 4F0CA 3VWVA 4TR0A 1SK2A 4OFNA 1A2LA 1K0AA 3GH9A 2ES7A 4WR5A 4N0ZA 2I4AA 1GUKA 1A2MA 2VCZA 1AUCA 1EV4A 3DIEA 3LSZA 3LXTA 1MDIA 3GKNA 2YN1A 4ISDA 1SJ6A 1XXUA 2VLUA 6GSWA 3HZ8A 18GSA 1OKTA 1Q4JA 4MLYA 3HJPA 2IPAA 2H6XA 3PH9A 4EVMA 4KH7A 4V2MA 3DVWA 3UIWA 3RBTA 4LMVA 3K8NA 2PMTA 2AB6A 1X9MB 2PGTA 4X1UA 3UAPA 1OC9A 3VPQA 3P2AA 5A4VA 2JZTA 2TRCP 4NHWA 3QAWA 4K1FA 2ZUPA 4FYCA 4OO5A 1N2AA 2EIOA 3KEBA 3VI5A 2QSIA 2DMMA 4I97A 4N10A 2A2RA 1TI1A 4WXTA 2GZPA 4RI6A 2GS3A 3VPTA 3Q6OA 3TDGA 2C80A 1JZRA 1JHBA 2CVBA 5GZZB 1YEPA 2R37A 5H5QA 1BJXA 3ZITA 1B8XA 2HNLA 3RPNA 1C72A 1NW2A 1XOBA 5AIVA 3GA4A 1M2AA 2HXKA 2MZCA 3HJOA 1ABAA 3WT2A 2HI7A 4IQAA 4AJ7A 3EU4A 4O5RA 1TOFA 1GNWA 1GH2A 4TR3A 4MMMA 2YZUA 3J7Yb 3QCPA 2J9HA 3LYKA 5AGYA 5CYYA 1J9BA 2F8AA 4D73B 1I9DA 3L9SA 1XCCA 1XWAA 1HNAA 2CZ2A 1F3BA 4EE0A 2B7JA 2FNOA 2V32A 1G6YA 2H6YA 1PD21 2HSYA 3WGDA 3D4MA 1A24A 1FOVA 1B4PA 3CRUA 4WKWA 5CRGA 2I3YA 1XW9A 2G2QA 1FW1A 3FR3A 1EGRA 3VI7A 3WD6A 1TKDB 1K3YA 2AV4A 4LLRA 1ML6A 4F9ZA 4WBRD 4HU7A 4KDYA 1BAYA 5F05A 1AW9A 3TCOA 1U87A 1USBA 2K9FA 3U5RE 2H8LA 1DUGA 2IJYA 1XPVA 1GSFA 3ZTLA 4ID0A 3D6IA 3VK9A 3UMAA 5DCGA 2WULA 2C0DA 5IMFA 5ID2B 2V6OA 1ZMAA 3H93A 3FYGA 5DAKB 2P0GA 3L9UA 2BJXA 3LEFA 1R26A 5LCZA 3IDVA 5KN2A 3GTUA 1ZCPA 2YJHA 2N5BA 5G31A 2LKUA 1PX7A 4PQ1A 2HSHA 1SL0B 4XTSA 4IP1A 2VL2C 1X0RA 5J9CA 1ZZYA 5JWQB 1GWCA 1QK8A 2CAQA 2TRXA 3F6FA 3A3TA 3QPMA 5ECNB 5EY6A 3KTBA 3P8WA 3TKSA 2KHPA 3L0HA 4YAPA 3ZMLA 3UL3A 2R2JA 2XPEA 4BL7A 1OYJA 3HYPA 1GRXA 6GSXA 3ZYWA 3KM6A 4WR4A 3FK8A 2LQOA 2CT6A 4F2IA 2C4JA 1TK8B 3ZFLA 4CHSA 2PVOC 2KP1A 4J56E 6GSSA 3TJBA 2CAIA 5CNWA 4KNDA 1T1VA 1T4YA 2LSTA 5G30A 4NV2A 1XBSA 2H19A 1QFNA 2DJ0A 2DC5A 3N5OA 4MJAA 4KDUA 3PINA 4TW5A 1ERWA 3M9KA 4KDXA 5IMVA 3IK7A 4JE1A 1TU8A 3D22A 2WRTA 2L59A 2DIYA 1OE8A 2R6KA 2DBCA 1B4QA 2MBSA 5D8IA 1XFLA 3TUEA 3HA9A 1O6JA 2P31A 1GP1A 1ACVA 3ZVJD 5ELAA 1XWKA 1OC3A 2YANA 4GQFA 1WIKA 2GDRA 3ZIVA 1IYHA 2I81A 1EV9A 3UOMA 4DSSA 2LEGA 5HFIA 2IL3A 3LWAA 4IHUA 2BTOT 5HQPA 1ERUA 1V9WA 2VD1A 3BCKA 1YZXA 5HR3A 3VWUA 5B7CA 4OWYA 3KH7A 2GLRA 2LNSA 1M2DA 4FYUA 2V2GA 3GRXA 3RPPA 5DALA 2EIRA 2PPTA 4KCEA 1V57A 1UC7A 3GKXA 5HFKA 3HZ4A 1HD2A 5KEJA 2GT6A 3Q19A 2I1UA 1ZYQB 3QAGA 3EMXA 1RW1A 1PRXA 2DIZA 4ILFA 3F0IA 2C0FA 1FAAA 3TOUA 2IFQA 4G19A 3H1NA 1GUHA 3EU3A 5DQYA 1WJKA 1F37A 5JCGA 3GHAA 3TKPA 2M46A 1T4ZA 1BG5A 5FT3A 1Q98A 3C8EA 2TIRA 1SK1A 3ME8A 4I2UA 3EURA 6GSVA 2HZEA 1VF2A 3TGZA 1RK4A 5GAPD 4DEJA 2MYGA 4OMVA 3H4KA 2L6CA 3HKRA 2DJ3A 4RI7A 2PERA 2VD0A 3C1SA 3FHKA 1VF3A 22GSA 2H1GA 3ZREA 1AXDA 3L9VA 4HQZA 2ON5A 4G2EA 2MMZA 2WFCA 2MBTA 1R7HA 3HY2A 1AQVA 1OC8A 2H71A 5EVOA 4NAXA 1SKSB 4PX1A 4YQMA 3HD5A 1U3AA 5E4WA 3U6VA 1MEKA 3MNGA 3AY8A 4G9HA 3F6DA 5D9VA 3IR4A 3WYWA 1U6TA 1Y25A 2HZFA 2IN3A 2K8VA 1UVZA 2C3NA 4GSNA 5ECHB 3G7JA 4K7IA 1VF1A 2YNXA 2F51A 4OCEA 2H0IA 1JZDA 2CVDA 2J23A 3NIVA 4AJ8A 2LUSA 4MF6A 2D2ZA 2GSTA 3C73A 1HQOA 3UJ1A 1XVWA 2X8CA 5DQSA 5F06A 3D5JA 4Q5FA 4ZB9A 5CRWA 4HJMA 1AQWA 1BX9A 4IW9A 5ECMB 1H75A 3KMNA 3GYKA 4XCSA 2FD3A 2LJRA 3IK9A 4IKHA 1JZWA 1TP9A 4KAEA 1O8XA 1SKRB 2MMNA 3G7YA 4JZQA 3GH6A 2F9SA 3L4NA 2FHEA 1QQ2A 2YV9A 1SJIA 5LD0A 2HRNA 2BMXA 3Q74A 3ZL5A 1EP7A 5DCHA 2KP2A 1PX6A 4RQXA 2H72A 1YKCA 3F3RA 2L4QA 1EP8A 1O73A 5D9TA 3DWVA 2L57A 2C0EA 3DGQA 3O76A 3A2WA 4HUAA 2B5YA 2YV7A 1KBNA 1OAZA 4GQCA 4HJ2A 2VM1A 4ZL8A 4N11A 3KMOA 4GXZA 2FWFA 2IIYA 4MK3A 1EEMA 3IBHA 4XS4B 4ZILA 4XS6A 2VCTA 2B3SA 2DJJA 2EIQA 2V1MA 3QDNA 4I5QA 3VURA 3RAZA 3LXZA 2R5GA 4YH2A 2VL9A 1O81A 4RUVA 4V2NA 4P3YB 2FUG2 1F9MA 2LRTA 4BVYA 1W4VA 4NHZA 4MPGA 1O7UA 1GSSA 4TXOB 3G9BA 4TOPA 3TKSE 6GSTA 4OO4A 1GSDA 3GL5A 3E9JB 3UEMA 2NTOA 4V1Ag 5JCUA 4HZ4A 3KCMA 4ZBBA 2H01A 2H30A 2LRNA 4MF5A 1S3CA 2IMDA 3GX8A 1MDKA 2ZCTA 1E2YA 2YOIA 1KTEA 3ZRDA 5GSTA 3TJFA 2FCHA 3FR9A 3GSSA 3LORA 3IRAA 3WGEA 3GSTA 1Z6MA 2WCIA 4L5OA 1BYEA 1EZKA 2H1AA 3UBKA 4IP6A 1W89A 5F07A 4EF0A 13GSA 3FEUA 1R4WA 3KTLA 2FWGA 1VRSD 2FWEA 4LL1B 2H1BA 4MA9A 2XBIA 3VLNA 5IMZA 6GSYA 4KCAA 3GUSA 4ZL9A 2WS2A 4KA0A 9GSSA 1NHOA 3C1RA 1YQ1A 2V6KA 3ED3A 4GF0A 3F63A 3P7XA 2B5EA 5CO3A 3NZNA 1AQXA 2NBSA 3UBLA 3QFAC 4F03A 4OD7A 4K8MA 2L5OA 1Z3EA 1O85A 2IMFA 3GFKA 4JR4A 3A2XA 3IAS2 3ZFBA 3IAM2 4MJCA 1FB6A 2HRFA 5F0GA 1Y6EA 1GSEA 2B1KA 1K0MA 4O92A 1ZYEA 2JSYA 5ECSA 19GSA 2XC2A 3SWLA 3VWWA 1FVKA 1DBYA 3MAKA 20GSA 1PQNA 1GNEA 3QAVA 1AAZA 1OKDA 1V2AA 3QR6A 4GTUA 2IMIA 11GSA 1GLPA 2OE0A 4KX4A 2FLSA 12GSA 1EOHA 2LS5A 4XIHA 3TOTA 1TI3A 1TW9A 4ZL7A 4EXJA 3EWLA 2I9HA 4TXVA 1MD3A 1ERVA 5HR0A 4LA1A 2KOKA 3DXBA 4EUYA 4TXOA 1PKWA 7GSSA 4JU5A 1PL2A 1Z6NA 2B6MA 3APSA 3IHQA 4BVXA 1XW5A 3IC4A 2EC4A 4KSMA 5J4UA 1WMJA 3CSHA 1T3BA 2A4VA 1PSQA 4NV5A 16GSA 3KIJA 1ERTA 1WWJA 4PURA 5DBQA 1ZOFA 1HNCA 2JZSA 2GZZA 5IIZA 2GQKA 3CXGA 4MJBA 2GQLA 1CQGA 3M1GA 1IYIA 4L0UA 2RUFA 4JR6A 5D93A 3ZIJA 1G7OA 2RIIA 3JCML 1DE1A 1PL1A 1GLQA 3TKQA 4NXIA 1NSWA 4ULXA 2GGTA 2JL4A 3KJYA 1M0UA 2GVPA 1EEJA 4ZIJA 4MF7A 3O6TA 4IS0A 4I8BA 3F4TA 1T00A 3W8SA 3MDKA 3IXRA 5AN1A 4MCUA 4NMUA 1S3AA 5ECPB 4D73A 1X9SB 4MP4A 4POBA 3ZZXA 4FH8A 4ZBAA 2E7PA 1A0RP 1FHEA 4WETA 4WEYA 1TRSA 2OJLA 2LRCA 2H66A 2PUKC 2WZ9A 4QQ7A 1WE0A 5ENUA 17GSA 3KD0A 1SL2B 2ALBA 4Q5RA 3H8QA 3DEXA 3M3MA 3FY7A 1WP0A 2VUPA 2CV4A 3LQ7A 2WB9A 5ECOB 3C7MA 6GSUA 3FRCA 1WPIA 2FGXA 3L78A 4K0NA 2VAFA 2H1DA 4LMWA 2L4CA 2VO4A 4TRXA 1M7TA 2L5LA 1S3DA 5A4UA 3E0UA 3DYRA 4FIWA 1URMA 4AJ6A 2V41A 2H70A 1K3LA 4HI7A 5ID2A 2M80A 2YCDA 1HNBA 3FZ4A 1K0OA 1SYRA 5IOXA 5DAKA 2GQMA 1XWGA 10GSA 1JLWA 4IVFA 1GTUA 2X99A 1MTCA 3I6AA 1K3OA 1FO5A 3CTGA 4MH3A 3VFIA 2H76A 1LJRA 5LNKe 1TK0B 3ERWA 3V1WA 3HCZA 2R4VA 3LFLA 4HQSA 1R5PA 4GSTA 4MZCA 1TRWA 3UVTA 5G5FA 4PGTA 4TVEA 2NDOA 2WGRA 4OCFA 5ECLB 4GSSA 3FKFA 2DJ2A 2QGVA 1VGLA 3LGCA 3FW2A 1I5GA 3I43A 2O87A 5IM9A 4NPBA 4GLTA 3D21A 4WBJA 1GUMA 1FVJA 4IJ3A 3RHCA 5COHA 5IO2A 4GRFA 4I6XA 3KXOA 1Z7PA 2YPMA 2VL3A 1B9XC 2C1YA 4KB3A 4WF4A 3TRXA 3DKSA 1X9WB 1U88A 1MD4A 1OC9B 2E2GA 2C3TA 1V58A 1A23A 4AGSA 4HZ2A 3LG6A 4Q5NA 1EOGA 2PU9C 4Z7XA 5G5EA 5JWRB 1SKWB 4N0VA 4L5LA 1F6MC 2OBIA 5B6MA 1E6BA 3QFBC 4EO3A 3TKSC 1FB0A 2N5FA 1YY7A 1NHYA 5CAXA 2DJ1A 2XBQA 2YZHA 5E59A 1ILOA
chains in the Genus database with same CATH superfamily
4BA7A 3EMPA 1YDKA 3BOAA 3CSJA 4POKA 1PKZA 4DSRA 1AC1A 1U3IA 1ZL9A 1F2EA 5FHIA 1QUWA 2B5XA 4CY6A 2VCWA 1SK0A 3PGTA 3BBYA 3HVNA 1TTZA 3TKRA 1V40A 3TJJA 2CA8A 3GNJA 1SENA 4TR1B 2GSRA 2DLXA 3F4RA 5HFGA 4FO5A 2GTUA 3MIXA 4LL4B 4J2FA 2VOCA 1TJDA 4QL9A 3ZLPA 5L71A 5IPHA 3TB2A 1G0TA 3G7IA 1B9YC 1XIYA 5EPFA 1ON4A 4F82A 1A0FA 3PR8A 4ZB8A 1CQHA 3F4SA 2OE1A 4EKZA 3APQA 4E8EA 3VWXA 1R5AA 2FA4A 2VLTA 2VL2A 4O7HA 4EDZA 2M72A 2O85A 1SJZA 2IMEA 2JSZA 3DMLA 3M8NA 3CYNA 2AYTA 2REMA 1GTAA 2CX3A 3GV1A 4Q5QA 3EC3A 4V2LA 5DVBA 3FMWA 2VLVA 1YF0A 1J08A 1EWXA 4OFTA 3FZ5A 4A5PA 4IN0A 2CQ9A 1SD8A 2PVQA 3LYPA 1AIUA 3W6GA 5B6NA 3OR5A 1NM3A 1A8LA 2OADA 2K8SA 4ML1A 4K0GA 2Z9SA 3GTUB 1JFUA 2H0GA 3GN3A 4HS1A 2FA8A 3E3EA 3MWHA 3D0ZA 4X0XA 4J57E 3FZ9A 4NWYA 1PMTA 2H73A 1GL8A 4GWRA 1A2JA 4H86A 3TJGA 2X64A 2ZNMA 3Q18A 1G6WA 4CY8A 1X5CA 1Z9HA 3I9V2 3US3A 3UARA 2OBKA 4HEA2 2F3MA 2LNTA 3GL3A 1HYUA 2F8FA 4HDEA 3KGKA 2QKEA 4K9ZA 4YQVA 2GZYA 2WDUA 1M9AA 4BWQA 4DVCA 3CTFA 2RUEA 2JACA 2IWTA 1SL1B 2C3QA 5G1LA 4BL7B 5G2ZA 1XWBA 4PQIA 1XW6A 5ECIB 2YJ7A 4CW9A 5AIXA 5INYA 2H74A 1PGTA 1K0CA 1M99A 2HT9A 3QOUA 5IPGA 4KSOA 2QA2A 4L0WA 4K7OA 5HR2A 4Z2TA 5D9XA 1DE2A 2HLSA 1OVNA 3IV4A 3GX0A 3HVSA 5H5RA 3TJKA 1TK5B 5BRTA 3R2QA 5GAND 1FG4A 4TR1A 2E2MA 1TU7A 5D9WA 2VM2A 1GTBA 2PWJA 1QXHA 2RM6A 4HU9A 1GSQA 3DD3A 4N30A 1V98A 3FR6A 2PN8A 5CREA 3RHBA 4DSSB 4XS4A 3W8JA 1XZOA 2R0GA 3MSZA 2LJKA 5J5NA 1K0BA 5FWGA 2R3XA 3O3TA 2E0QA 3HHVA 1J0FA 4JRRA 5CRDA 4KGIA 3KP9A 2YWNA 3BD2A 1WRYA 2IMKA 1UA5A 3CRTA 5CRHA 1BQ7A 4JEDA 4MABA 5J3RA 2CVKA 5DALB 4OFMA 4BWSA 3KH9A 3QMXA 5EL8A 1M3IA 4XS1A 5CP1A 3DRNA 1TRVA 3IOSA 3HVXA 5H5SA 2YWOA 2VIMA 1M9BA 3ZMKA 1TRUA 1GTIA 2FY6A 2IFQB 3M9JA 4PQHA 3IE3A 2HYXA 3IA1A 3KZQA 4POLA 4CDOA 3QD9A 4ECIA 2XPDA 3NOFA 4KF9A 2O7KA 4ICYA 2GSQA 1DSBA 2HZEB 2H75A 3M0FA 5JCWA 5IMCA 1SD9A 4EC0A 4MDCA 4TN8A 2B1LA 4G10A 2MMOA 1O8WA 2RLIA 2C8UA 5G1KA 3KP8A 4ECJA 1X5EA 8GSSA 1ZYNA 4ML6A 4PUFC 4EDYA 3F8UA 1KEBA 2B7KA 4TR4A 1QMVA 4G0KA 2YP6A 1UN2A 5GSSA 2CZ3A 5DJMA 1F3AA 3WT1A 4XRDA 4IBPA 4ZBDA 3RDWA 1TDIA 5JWOB 1OE7A 1M2BA 3DVXA 3D4TA 5HR1A 4O32A 3P90A 3TRPA 2XHFA 1EGOA 2KLXA 4QL7A 1BEDA 1ZGNA 2MMAA 2FWHA 4V1Ap 2VCXA 2KUCA 4I2TA 2P5QA 3GKKA 5IMAA 1YKAA 2O8VB 2GT5A 3IPZA 2X4AA 4IJIA 1THXA 4ACSA 2WJUA 3WGXA 1LU4A 4IQ1A 1M3JA 4L8EA 5IQYA 4IGJA 2C0GA 2AHEA 2P5RA 3CSIA 1TXXA 3FZAA 4XHMA 4F0BA 4XRAA 4GCIA 5ECKB 4TKYA 3EPTA 5IMDA 1SYXA 3SBCA 5DDLA 1QGVA 2CX4A 3UVHA 3ISOA 2JZRA 2AUVA 2YWIA 1XVQA 1THOA 4DSQA 5J41A 1KNGA 2DJKA 3H79A 3ZVJA 1PN9A 5KN3A 5A4WA 3S9FA 2JADA 14GSA 2JU5A 4MJEA 1RQMA 2ON7A 4AF2A 4YQUA 3CMIA 1JLVA 2RM5A 2DSAA 2K6VA 4K7NA 1PA3A 3HXSA 3CBUA 4KUNA 1N8JA 1T7PB 3C71A 4Z2RA 5KN1A 2N5AA 1XOAA 1YJ6A 2NPBA 2OKAA 3ERGA 2QC7A 1Z5YE 1G7EA 3EVIA 1A8YA 2LQQA 3EYTA 1Z7RA 3BJ5A 1X5DA 5ECQB 3HVVA 3HJMA 3GKMA 2X8GA 4WF5A 3BCIA 4PXOA 1ST9A 2OE3A 2LJAA 5C04A 5D96A 3GMFA 4BVYB 1JZOA 4BPYA 2LTKA 2PBJA 3EE2A 4K2DA 5AISA 1YF1A 4EL1A 3J7Yk 3A5WA 2YWMA 4PNGA 1YEXA 3F3QA 3TRQA 4ECBA 3ERFA 2NVLA 4E8HA 3F9UA 5ECRB 5F8BA 2G0FA 1GULA 4IELA 4ECCA 4PNFA 2VCVA 1LBKA 5KN0A 4MPFA 1B48A 4JBBA 1XWCA 3APOA 3A2VA 1FOHA 4YAVA 5IO0A 1T8EB 2LV3A 5ABRA 2OA7A 2X8HA 3HDCA 5D73A 2H0HA 2H6ZA 5DJLA 2AJQB 5B8AA 1K0NA 4FQUA 4RQRA 1K0DA 1GSUA 4MH2A 5ELGA 2GSSA 4HOJA 4X43A 2VCQA 4FYBA 3LJRA 4ZB6A 2K18A 4ZXGA 2HE3A 2QA1A 2AAWA 1MDJA 1SU9A 1WOUA 3I69A 3ME7A 2OACA 1VF4A 2HFDA 5IOWA 4MZWA 3GURA 2DMLA 4KE3A 2A2SA 3EINA 5C00A 5A5KA 1GSYA 3N9JA 2L6DA 5J9BA 3GIXA 4K6XA 4POMA 4MZBA 5B8BA 2O89A 4KW6A 4PUAA 1H4OA 4F0CA 3VWVA 4TR0A 1SK2A 4OFNA 1A2LA 1K0AA 3GH9A 2ES7A 4WR5A 4N0ZA 2I4AA 1GUKA 1A2MA 2VCZA 1AUCA 1EV4A 3DIEA 3LSZA 3LXTA 1MDIA 3GKNA 2YN1A 4ISDA 1SJ6A 1XXUA 2VLUA 6GSWA 3HZ8A 18GSA 1OKTA 1Q4JA 4MLYA 3HJPA 2IPAA 2H6XA 3PH9A 4EVMA 4KH7A 4V2MA 3DVWA 3UIWA 3RBTA 4LMVA 3K8NA 2PMTA 2AB6A 1X9MB 2PGTA 4X1UA 3UAPA 1OC9A 3VPQA 3P2AA 5A4VA 3LW9A 4BVXB 2JZTA 2TRCP 4NHWA 2HSMA 3QAWA 4K1FA 2ZUPA 4FYCA 4OO5A 1N2AA 2EIOA 3KEBA 3VI5A 2QSIA 2DMMA 4I97A 4N10A 2A2RA 1TI1A 4WXTA 1ZYPA 2GZPA 2UZ8A 4RI6A 2GS3A 3VPTA 3Q6OA 3TDGA 2C80A 1JZRA 1JHBA 2CVBA 5GZZB 1YEPA 2DKIA 2R37A 5H5QA 4K2XA 1BJXA 3ZITA 1B8XA 2HNLA 3RPNA 1C72A 1NW2A 1XOBA 5AIVA 3GA4A 1M2AA 2HXKA 2MZCA 3HJOA 4K5SA 1ABAA 3WT2A 2HI7A 4IQAA 4AJ7A 3EU4A 4O5RA 1TOFA 1GNWA 1GH2A 4TR3A 4K5RA 4MMMA 5BMUA 2YZUA 3J7Yb 3QCPA 2J9HA 3LYKA 5AGYA 5CYYA 1J9BA 2F8AA 4D73B 1I9DA 3L9SA 1XCCA 1XWAA 1HNAA 4O5UA 2CZ2A 1F3BA 4EE0A 2B7JA 2FNOA 2V32A 4USSA 1G6YA 2H6YA 1PD21 2HSYA 3WGDA 3D4MA 1A24A 1FOVA 1B4PA 3CRUA 4WKWA 5CRGA 2I3YA 1XW9A 2G2QA 4HSCX 1FW1A 3FR3A 1EGRA 3VI7A 3WD6A 1TKDB 1K3YA 2AV4A 4LLRA 1ML6A 4F9ZA 4WBRD 4HU7A 4KDYA 1XG8A 1BAYA 5F05A 1AW9A 3TCOA 1PFOA 1U87A 1USBA 2K9FA 3U5RE 2H8LA 1DUGA 2IJYA 1XPVA 1GSFA 3ZTLA 4ID0A 3D6IA 3VK9A 3UMAA 5DCGA 2WULA 2C0DA 5IMFA 5ID2B 2V6OA 1ZMAA 3H93A 3FYGA 5DAKB 2P0GA 3L9UA 2BJXA 3LEFA 1R26A 5LCZA 3IDVA 5KN2A 3GTUA 1ZCPA 5KOWA 2YJHA 2N5BA 5G31A 2LKUA 2DKHA 3MYDA 1PX7A 4PQ1A 2HSHA 1SL0B 4XTSA 4IP1A 2VL2C 1X0RA 5J9CA 4BIKA 1ZZYA 5JWQB 1GWCA 1QK8A 2CAQA 2TRXA 3F6FA 3A3TA 3QPMA 5ECNB 5EY6A 3KTBA 3P8WA 3TKSA 2KHPA 3L0HA 4YAPA 3ZMLA 3UL3A 2R2JA 2XPEA 4BL7A 1OYJA 3HYPA 1GRXA 3IHGA 6GSXA 3ZYWA 3KM6A 4WR4A 3FK8A 2LQOA 2CT6A 4F2IA 2C4JA 1TK8B 3ZFLA 4CHSA 2PVOC 2KP1A 4J56E 6GSSA 3TJBA 2CAIA 5CNWA 4KNDA 1T1VA 1T4YA 4X4JA 2LSTA 5G30A 4NV2A 1XBSA 2H19A 1QFNA 2DJ0A 2DC5A 3N5OA 4MJAA 4KDUA 3PINA 4TW5A 2X49A 1ERWA 3M9KA 4KDXA 5IMVA 4G0IA 3IK7A 4JE1A 1TU8A 3D22A 2WRTA 2L59A 2DIYA 1OE8A 2R6KA 2DBCA 1B4QA 2MBSA 5D8IA 1XFLA 3TUEA 3HA9A 1O6JA 2P31A 1GP1A 1ACVA 3ZVJD 5ELAA 1XWKA 1OC3A 2YANA 4GQFA 1WIKA 2GDRA 3ZIVA 1IYHA 2I81A 4EIPA 1EV9A 3UOMA 4DSSA 2LEGA 5HFIA 2IL3A 3LWAA 4IHUA 2BTOT 5HQPA 1ERUA 1V9WA 2VD1A 3BCKA 1YZXA 5HR3A 3VWUA 5B7CA 4OWYA 3KH7A 2GLRA 2LNSA 1M2DA 4FYUA 2V2GA 3GRXA 3RPPA 5DALA 2EIRA 2PPTA 4KCEA 1V57A 1UC7A 3GKXA 5HFKA 3HZ4A 1HD2A 5KEJA 2GT6A 3Q19A 2I1UA 1ZYQB 3QAGA 3EMXA 1RW1A 1PRXA 2DIZA 4ILFA 3F0IA 2C0FA 1FAAA 3TOUA 2IFQA 4G19A 4G0LA 3H1NA 1GUHA 3EU3A 5DQYA 1WJKA 1F37A 5JCGA 3GHAA 3TKPA 2M46A 1T4ZA 1BG5A 5FT3A 1Q98A 3C8EA 2TIRA 1SK1A 3ME8A 4I2UA 3EURA 6GSVA 2HZEA 1VF2A 3TGZA 1RK4A 5GAPD 4DEJA 2MYGA 4OMVA 2A4HA 3H4KA 2L6CA 3HKRA 2DJ3A 4RI7A 2PERA 2VD0A 3C1SA 3FHKA 1VF3A 22GSA 2H1GA 3ZREA 1AXDA 3L9VA 4HQZA 2ON5A 4G2EA 2MMZA 2WFCA 2MBTA 1R7HA 3HY2A 3IC8A 1AQVA 1OC8A 2H71A 5EVOA 4NAXA 1SKSB 4PX1A 4YQMA 3HD5A 1U3AA 5E4WA 3U6VA 1MEKA 3MNGA 3AY8A 4G9HA 3F6DA 5D9VA 3IR4A 3WYWA 1U6TA 1Y25A 2HZFA 2IN3A 2K8VA 1UVZA 2C3NA 4GSNA 5ECHB 3G7JA 4K7IA 1VF1A 2YNXA 2F51A 4OCEA 2H0IA 1JZDA 2CVDA 2J23A 3NIVA 4AJ8A 2LUSA 4MF6A 2D2ZA 2GSTA 3C73A 1HQOA 3UJ1A 1XVWA 2X8CA 5DQSA 5F06A 3D5JA 4Q5FA 4ZB9A 4YKGA 5CRWA 4HJMA 1AQWA 1BX9A 4IW9A 5ECMB 1H75A 3KMNA 3GYKA 4XCSA 2FD3A 2LJRA 3IK9A 4IKHA 1JZWA 1TP9A 4KAEA 1O8XA 1SKRB 2MMNA 3G7YA 4JZQA 3GH6A 2F9SA 3L4NA 2FHEA 1QQ2A 2YV9A 2A2PA 1SJIA 4MNNA 5LD0A 2HRNA 2BMXA 3Q74A 3ZL5A 1EP7A 5DCHA 2KP2A 1PX6A 4RQXA 2H72A 1YKCA 3F3RA 2L4QA 1EP8A 1O73A 5D9TA 3DWVA 2L57A 2C0EA 3DGQA 3O76A 3A2WA 4HUAA 2B5YA 2YV7A 1KBNA 1OAZA 4GQCA 4HJ2A 2VM1A 4ZL8A 3A5IA 4N11A 3KMOA 4GXZA 2FWFA 2IIYA 4MK3A 1EEMA 3IBHA 4XS4B 4ZILA 4XS6A 2VCTA 2B3SA 2DJJA 2EIQA 2HRKA 4O5QA 2V1MA 3QDNA 1S3RA 4I5QA 3VURA 3RAZA 3LXZA 2R5GA 4YH2A 2VL9A 1O81A 4RUVA 4V2NA 4P3YB 2FUG2 1F9MA 2LRTA 4BVYA 1W4VA 4NHZA 4MPGA 1O7UA 1GSSA 4TXOB 3G9BA 4TOPA 3TKSE 6GSTA 4OO4A 1GSDA 1PN0A 3GL5A 3E9JB 3UEMA 2NTOA 4V1Ag 5JCUA 4HZ4A 3KCMA 4ZBBA 2H01A 2H30A 2LRNA 4MF5A 1S3CA 2IMDA 3GX8A 1MDKA 2ZCTA 1E2YA 2YOIA 1KTEA 3ZRDA 5GSTA 3TJFA 2FCHA 3FR9A 3GSSA 3LORA 3IRAA 3WGEA 3GSTA 1Z6MA 2WCIA 4L5OA 1BYEA 1EZKA 2H1AA 3UBKA 4IP6A 1W89A 5F07A 4EF0A 13GSA 3FEUA 1R4WA 3KTLA 2FWGA 1VRSD 2FWEA 4Z2UA 4LL1B 2H1BA 4MA9A 2XBIA 3VLNA 5IMZA 6GSYA 4KCAA 3GUSA 4ZL9A 2WS2A 4KA0A 4YKFA 3R3EA 9GSSA 1NHOA 3C1RA 1YQ1A 2V6KA 3ED3A 4GF0A 4PTSA 3F63A 3P7XA 2B5EA 5CO3A 3NZNA 1AQXA 2NBSA 3UBLA 3QFAC 4F03A 4OD7A 4K8MA 2L5OA 1Z3EA 1O85A 2IMFA 3GFKA 4JR4A 3A2XA 3IAS2 3ZFBA 3IAM2 4MJCA 1FB6A 2HRFA 5F0GA 1Y6EA 1GSEA 2B1KA 1K0MA 4O92A 1ZYEA 2JSYA 5ECSA 19GSA 2XC2A 3SWLA 3VWWA 1FVKA 1DBYA 3MAKA 20GSA 1PQNA 1GNEA 3QAVA 1AAZA 1OKDA 1V2AA 3QR6A 4GTUA 2IMIA 11GSA 1GLPA 2OE0A 4KX4A 2FLSA 12GSA 1EOHA 2LS5A 4XIHA 3TOTA 1TI3A 1TW9A 4ZL7A 4EXJA 3EWLA 2I9HA 4TXVA 1MD3A 1ERVA 5HR0A 4LA1A 2KOKA 3DXBA 4EUYA 4TXOA 1PKWA 7GSSA 4JU5A 1PL2A 1Z6NA 2B6MA 3APSA 3IHQA 4BVXA 1XW5A 3IC4A 2EC4A 4KSMA 5J4UA 1WMJA 3CSHA 1T3BA 2A4VA 1PSQA 4NV5A 3CQFA 16GSA 3KIJA 1ERTA 2R0CA 1WWJA 4PURA 5DBQA 2R0PA 1ZOFA 1HNCA 2JZSA 2GZZA 5IIZA 2GQKA 3CXGA 4MJBA 2GQLA 1CQGA 3M1GA 1IYIA 3PPUA 4L0UA 2RUFA 4JR6A 5D93A 3ZIJA 1G7OA 2RIIA 3JCML 1DE1A 1PL1A 1GLQA 3TKQA 4NXIA 1NSWA 4ULXA 2GGTA 2JL4A 3KJYA 1M0UA 2GVPA 1EEJA 4ZIJA 4MF7A 3O6TA 4IS0A 4I8BA 3F4TA 1T00A 3W8SA 3MDKA 3IXRA 5AN1A 4MCUA 4NMUA 1S3AA 5ECPB 4D73A 1X9SB 4MP4A 4POBA 3ZZXA 4FH8A 4ZBAA 2E7PA 1A0RP 1FHEA 4WETA 4WEYA 1TRSA 2OJLA 2LRCA 2H66A 2PUKC 2WZ9A 4QQ7A 1WE0A 5ENUA 17GSA 3KD0A 1SL2B 2ALBA 4Q5RA 3H8QA 3DEXA 3M3MA 3FY7A 1WP0A 2VUPA 2CV4A 3LQ7A 2WB9A 5ECOB 3C7MA 6GSUA 3FRCA 1WPIA 2FGXA 3L78A 4K0NA 2VAFA 2H1DA 4LMWA 2L4CA 2VO4A 4TRXA 1M7TA 2L5LA 1S3DA 5A4UA 3E0UA 3DYRA 4FIWA 1URMA 4AJ6A 2V41A 2H70A 1K3LA 4HI7A 5ID2A 2M80A 2YCDA 1HNBA 3FZ4A 1K0OA 1SYRA 5IOXA 5DAKA 2GQMA 1XWGA 10GSA 1JLWA 4IVFA 1GTUA 2X99A 1MTCA 3I6AA 1K3OA 1FO5A 3CTGA 4MH3A 3VFIA 2H76A 1LJRA 2HRAA 5LNKe 1TK0B 3ERWA 3V1WA 3HCZA 2R4VA 3LFLA 4HQSA 1R5PA 4GSTA 4MZCA 1TRWA 3UVTA 5G5FA 4PGTA 4TVEA 2NDOA 2WGRA 4OCFA 5ECLB 4EIQA 4GSSA 3FKFA 2DJ2A 2QGVA 1VGLA 3LGCA 3FW2A 1I5GA 3I43A 2O87A 5IM9A 4NPBA 4GLTA 3D21A 4WBJA 1GUMA 1FVJA 4IJ3A 3RHCA 5COHA 5IO2A 4GRFA 4I6XA 3KXOA 1Z7PA 2YPMA 2VL3A 1B9XC 2C1YA 4KB3A 4WF4A 3TRXA 3DKSA 1X9WB 1U88A 1MD4A 1OC9B 2E2GA 2C3TA 1V58A 1A23A 4AGSA 4HZ2A 3LG6A 4Q5NA 1EOGA 2PU9C 4Z7XA 5G5EA 5JWRB 1SKWB 4N0VA 4L5LA 1F6MC 2OBIA 5B6MA 1E6BA 3QFBC 4EO3A 3TKSC 1FB0A 2N5FA 5KOXA 1YY7A 1NHYA 5CAXA 2DJ1A 2XBQA 2YZHA 5E59A 1ILOA
chains in the Genus database with same CATH topology
4BA7A 3EMPA 1YDKA 3BOAA 3CSJA 4POKA 1PKZA 4DSRA 1AC1A 1U3IA 1ZL9A 1F2EA 5FHIA 1QUWA 2B5XA 4CY6A 2VCWA 1SK0A 3PGTA 3BBYA 1TTZA 3TKRA 1V40A 3TJJA 2CA8A 3GNJA 1SENA 4TR1B 2GSRA 2DLXA 3F4RA 5HFGA 4FO5A 2GTUA 3MIXA 4LL4B 4J2FA 2VOCA 1TJDA 4QL9A 3ZLPA 5L71A 5IPHA 3TB2A 1G0TA 3G7IA 1B9YC 1XIYA 5EPFA 1ON4A 4F82A 1A0FA 3PR8A 4ZB8A 1CQHA 3F4SA 2OE1A 4EKZA 3APQA 4E8EA 3VWXA 1R5AA 2FA4A 2VLTA 2VL2A 4O7HA 4EDZA 2M72A 2O85A 1SJZA 2IMEA 2JSZA 3DMLA 3M8NA 3CYNA 2AYTA 2REMA 1GTAA 2CX3A 3GV1A 4Q5QA 3EC3A 4V2LA 5DVBA 3FMWA 2VLVA 1YF0A 1J08A 1EWXA 4OFTA 3FZ5A 4A5PA 4IN0A 2CQ9A 1SD8A 2PVQA 3LYPA 1AIUA 3W6GA 5B6NA 3OR5A 1NM3A 1A8LA 2OADA 2K8SA 4ML1A 4K0GA 2Z9SA 3GTUB 1JFUA 2H0GA 3GN3A 4HS1A 2FA8A 3E3EA 3MWHA 3D0ZA 4X0XA 4J57E 3FZ9A 4NWYA 1PMTA 2H73A 1GL8A 4GWRA 1A2JA 4H86A 3TJGA 2X64A 2ZNMA 3Q18A 1G6WA 4CY8A 1X5CA 1Z9HA 3I9V2 3US3A 3UARA 2OBKA 4HEA2 2F3MA 2LNTA 3GL3A 1HYUA 2F8FA 4HDEA 3KGKA 2QKEA 4K9ZA 4YQVA 2GZYA 2WDUA 1M9AA 4BWQA 4DVCA 3CTFA 2RUEA 2JACA 2IWTA 1SL1B 2C3QA 5G1LA 4BL7B 5G2ZA 1XWBA 4PQIA 1XW6A 5ECIB 2YJ7A 4CW9A 5AIXA 5INYA 2H74A 1PGTA 1K0CA 1M99A 2HT9A 3QOUA 5IPGA 4KSOA 2QA2A 4L0WA 4K7OA 5HR2A 4Z2TA 5D9XA 1DE2A 2HLSA 1OVNA 3IV4A 3GX0A 3HVSA 5H5RA 3TJKA 1TK5B 5BRTA 3R2QA 5GAND 1FG4A 4TR1A 2E2MA 1TU7A 5D9WA 2VM2A 1GTBA 2PWJA 1QXHA 2RM6A 4HU9A 1GSQA 3DD3A 4N30A 1V98A 3FR6A 2PN8A 5CREA 3RHBA 4DSSB 4XS4A 3W8JA 1XZOA 2R0GA 3MSZA 2LJKA 5J5NA 1K0BA 5FWGA 2R3XA 3O3TA 2E0QA 3HHVA 1J0FA 4JRRA 5CRDA 4KGIA 3KP9A 2YWNA 3BD2A 1WRYA 2IMKA 1UA5A 3CRTA 5CRHA 1BQ7A 4JEDA 4MABA 5J3RA 2CVKA 5DALB 4OFMA 4BWSA 3KH9A 3QMXA 5EL8A 4XS1A 5CP1A 3DRNA 1TRVA 3IOSA 3HVXA 5H5SA 2YWOA 2VIMA 1M9BA 3ZMKA 1TRUA 1GTIA 2FY6A 2IFQB 3M9JA 4PQHA 3IE3A 2HYXA 3IA1A 3KZQA 4POLA 4CDOA 3QD9A 4ECIA 2XPDA 3NOFA 4KF9A 2O7KA 4ICYA 2GSQA 1DSBA 2HZEB 2H75A 3M0FA 5JCWA 5IMCA 1SD9A 4EC0A 4MDCA 4TN8A 2B1LA 4G10A 2MMOA 1O8WA 2RLIA 2C8UA 5G1KA 3KP8A 4ECJA 1X5EA 8GSSA 1ZYNA 4ML6A 4PUFC 4EDYA 3F8UA 1KEBA 2B7KA 4TR4A 1QMVA 4G0KA 2YP6A 1UN2A 5GSSA 2CZ3A 5DJMA 1F3AA 3WT1A 4XRDA 4IBPA 4ZBDA 3RDWA 1TDIA 5JWOB 1OE7A 1M2BA 3DVXA 3D4TA 5HR1A 4O32A 3P90A 3TRPA 2XHFA 1EGOA 2KLXA 4QL7A 1BEDA 1ZGNA 2MMAA 2FWHA 4V1Ap 2VCXA 2KUCA 4I2TA 2P5QA 3GKKA 5IMAA 1YKAA 2O8VB 2GT5A 3IPZA 2X4AA 4IJIA 1THXA 4ACSA 2WJUA 3WGXA 1LU4A 4IQ1A 4L8EA 5IQYA 4IGJA 2C0GA 2AHEA 2P5RA 3CSIA 1TXXA 3FZAA 4XHMA 4F0BA 4XRAA 4GCIA 5ECKB 4TKYA 3EPTA 5IMDA 1SYXA 3SBCA 5DDLA 1QGVA 2CX4A 3UVHA 3ISOA 2JZRA 2AUVA 2YWIA 1XVQA 1THOA 4DSQA 5J41A 1KNGA 2DJKA 3H79A 3ZVJA 1PN9A 5KN3A 5A4WA 3S9FA 2JADA 14GSA 2JU5A 4MJEA 1RQMA 2ON7A 4AF2A 4YQUA 3CMIA 1JLVA 2RM5A 2DSAA 2K6VA 4K7NA 1PA3A 3HXSA 3CBUA 4KUNA 1N8JA 1T7PB 3C71A 4Z2RA 5KN1A 2N5AA 1XOAA 1YJ6A 2NPBA 2OKAA 3ERGA 2QC7A 1Z5YE 1G7EA 3EVIA 1A8YA 2LQQA 3EYTA 1Z7RA 3BJ5A 1X5DA 5ECQB 3HVVA 3HJMA 3GKMA 2X8GA 4WF5A 3BCIA 4PXOA 1ST9A 2OE3A 2LJAA 5C04A 5D96A 3GMFA 4BVYB 1JZOA 4BPYA 2LTKA 2PBJA 3EE2A 4K2DA 5AISA 1YF1A 4EL1A 3J7Yk 3A5WA 2YWMA 4PNGA 1YEXA 3F3QA 3TRQA 4ECBA 3ERFA 2NVLA 4E8HA 3F9UA 5ECRB 5F8BA 2G0FA 1GULA 4IELA 4ECCA 4PNFA 2VCVA 1LBKA 5KN0A 4MPFA 1B48A 4JBBA 1XWCA 3APOA 3A2VA 1FOHA 4YAVA 5IO0A 1T8EB 2LV3A 5ABRA 2OA7A 2X8HA 3HDCA 5D73A 2H0HA 2H6ZA 5DJLA 2AJQB 5B8AA 1K0NA 4FQUA 4RQRA 1K0DA 1GSUA 4MH2A 5ELGA 2GSSA 4HOJA 4X43A 2VCQA 4FYBA 3LJRA 4ZB6A 2K18A 4ZXGA 2HE3A 2QA1A 2AAWA 1MDJA 1SU9A 1WOUA 3I69A 3ME7A 2OACA 1VF4A 2HFDA 5IOWA 4MZWA 3GURA 2DMLA 4KE3A 2A2SA 3EINA 5C00A 5A5KA 1GSYA 3N9JA 2L6DA 5J9BA 3GIXA 4K6XA 4POMA 4MZBA 5B8BA 2O89A 4KW6A 4PUAA 1H4OA 4F0CA 3VWVA 4TR0A 1SK2A 4OFNA 1A2LA 1K0AA 3GH9A 2ES7A 4WR5A 4N0ZA 2I4AA 1GUKA 1A2MA 2VCZA 1AUCA 1EV4A 3DIEA 3LSZA 3LXTA 1MDIA 3GKNA 2YN1A 4ISDA 1SJ6A 1XXUA 2VLUA 6GSWA 3HZ8A 18GSA 1OKTA 1Q4JA 4MLYA 3HJPA 2IPAA 2H6XA 3PH9A 4EVMA 4KH7A 4V2MA 3DVWA 3UIWA 3RBTA 4LMVA 3K8NA 2PMTA 2AB6A 1X9MB 2PGTA 4X1UA 3UAPA 1OC9A 3VPQA 3P2AA 5A4VA 3LW9A 4BVXB 2JZTA 2TRCP 4NHWA 2HSMA 3QAWA 4K1FA 2ZUPA 4FYCA 4OO5A 1N2AA 2EIOA 3KEBA 3VI5A 2QSIA 2DMMA 4I97A 4N10A 2A2RA 1TI1A 4WXTA 1ZYPA 2GZPA 2UZ8A 4RI6A 2GS3A 3VPTA 3Q6OA 3TDGA 2C80A 1JZRA 1JHBA 2CVBA 5GZZB 1YEPA 2DKIA 2R37A 5H5QA 4K2XA 1BJXA 3ZITA 1B8XA 2HNLA 3RPNA 1C72A 1NW2A 1XOBA 5AIVA 3GA4A 1M2AA 2HXKA 2MZCA 3HJOA 4K5SA 1ABAA 3WT2A 2HI7A 4IQAA 4AJ7A 3EU4A 4O5RA 1TOFA 1GNWA 1GH2A 4TR3A 4K5RA 4MMMA 5BMUA 2YZUA 3J7Yb 3QCPA 2J9HA 3LYKA 5AGYA 5CYYA 1J9BA 2F8AA 4D73B 1I9DA 3L9SA 1XCCA 1XWAA 1HNAA 4O5UA 2CZ2A 1F3BA 4EE0A 2B7JA 2FNOA 2V32A 4USSA 1G6YA 2H6YA 1PD21 2HSYA 3WGDA 3D4MA 1A24A 1FOVA 1B4PA 3CRUA 4WKWA 5CRGA 2I3YA 1XW9A 2G2QA 1FW1A 3FR3A 1EGRA 3VI7A 3WD6A 1TKDB 1K3YA 2AV4A 4LLRA 1ML6A 4F9ZA 4WBRD 4HU7A 4KDYA 1BAYA 5F05A 1AW9A 3TCOA 1U87A 1USBA 2K9FA 3U5RE 2H8LA 1DUGA 2IJYA 1XPVA 1GSFA 3ZTLA 4ID0A 3D6IA 3VK9A 3UMAA 5DCGA 2WULA 2C0DA 5IMFA 5ID2B 2V6OA 1ZMAA 3H93A 3FYGA 5DAKB 2P0GA 3L9UA 2BJXA 3LEFA 1R26A 5LCZA 3IDVA 5KN2A 3GTUA 1ZCPA 5KOWA 2YJHA 2N5BA 5G31A 2LKUA 2DKHA 3MYDA 1PX7A 4PQ1A 2HSHA 1SL0B 4XTSA 4IP1A 2VL2C 1X0RA 5J9CA 1ZZYA 5JWQB 1GWCA 1QK8A 2CAQA 2TRXA 3F6FA 3A3TA 3QPMA 5ECNB 5EY6A 3KTBA 3P8WA 3TKSA 2KHPA 3L0HA 4YAPA 3ZMLA 3UL3A 2R2JA 2XPEA 4BL7A 1OYJA 3HYPA 1GRXA 3IHGA 6GSXA 3ZYWA 3KM6A 4WR4A 3FK8A 2LQOA 2CT6A 4F2IA 2C4JA 1TK8B 3ZFLA 4CHSA 2PVOC 2KP1A 4J56E 6GSSA 3TJBA 2CAIA 5CNWA 4KNDA 1T1VA 1T4YA 4X4JA 2LSTA 5G30A 4NV2A 1XBSA 2H19A 1QFNA 2DJ0A 2DC5A 3N5OA 4MJAA 4KDUA 3PINA 4TW5A 2X49A 1ERWA 3M9KA 4KDXA 5IMVA 4G0IA 3IK7A 4JE1A 1TU8A 3D22A 2WRTA 2L59A 2DIYA 1OE8A 2R6KA 2DBCA 1B4QA 2MBSA 5D8IA 1XFLA 3TUEA 3HA9A 1O6JA 2P31A 1GP1A 1ACVA 3ZVJD 5ELAA 1XWKA 1OC3A 2YANA 4GQFA 1WIKA 2GDRA 3ZIVA 1IYHA 2I81A 4EIPA 1EV9A 3UOMA 4DSSA 2LEGA 5HFIA 2IL3A 3LWAA 4IHUA 2BTOT 5HQPA 1ERUA 1V9WA 2VD1A 3BCKA 1YZXA 5HR3A 3VWUA 5B7CA 4OWYA 3KH7A 2GLRA 2LNSA 1M2DA 4FYUA 2V2GA 3GRXA 3RPPA 5DALA 2EIRA 2PPTA 4KCEA 1V57A 1UC7A 3GKXA 5HFKA 3HZ4A 1HD2A 5KEJA 2GT6A 3Q19A 2I1UA 1ZYQB 3QAGA 3EMXA 1RW1A 1PRXA 2DIZA 4ILFA 3F0IA 2C0FA 1FAAA 3TOUA 2IFQA 4G19A 4G0LA 3H1NA 1GUHA 3EU3A 5DQYA 1WJKA 1F37A 5JCGA 3GHAA 3TKPA 2M46A 1T4ZA 1BG5A 5FT3A 1Q98A 3C8EA 2TIRA 1SK1A 3ME8A 4I2UA 3EURA 6GSVA 2HZEA 1VF2A 3TGZA 1RK4A 5GAPD 4DEJA 2MYGA 4OMVA 2A4HA 3H4KA 2L6CA 3HKRA 2DJ3A 4RI7A 2PERA 2VD0A 3C1SA 3FHKA 1VF3A 22GSA 2H1GA 3ZREA 1AXDA 3L9VA 4HQZA 2ON5A 4G2EA 2MMZA 2WFCA 2MBTA 1R7HA 3HY2A 3IC8A 1AQVA 1OC8A 2H71A 5EVOA 4NAXA 1SKSB 4PX1A 4YQMA 3HD5A 1U3AA 5E4WA 3U6VA 1MEKA 3MNGA 3AY8A 4G9HA 3F6DA 5D9VA 3IR4A 3WYWA 1U6TA 1Y25A 2HZFA 2IN3A 2K8VA 1UVZA 2C3NA 4GSNA 5ECHB 3G7JA 4K7IA 1VF1A 2YNXA 2F51A 4OCEA 2H0IA 1JZDA 2CVDA 2J23A 3NIVA 4AJ8A 2LUSA 4MF6A 2D2ZA 2GSTA 3C73A 1HQOA 3UJ1A 1XVWA 2X8CA 5DQSA 5F06A 3D5JA 4Q5FA 4ZB9A 4YKGA 5CRWA 4HJMA 1AQWA 1BX9A 4IW9A 5ECMB 1H75A 3KMNA 3GYKA 4XCSA 2FD3A 2LJRA 3IK9A 4IKHA 1JZWA 1TP9A 4KAEA 1O8XA 1SKRB 2MMNA 3G7YA 4JZQA 3GH6A 2F9SA 3L4NA 2FHEA 1QQ2A 2YV9A 2A2PA 1SJIA 4MNNA 5LD0A 2HRNA 2BMXA 3Q74A 3ZL5A 1EP7A 5DCHA 2KP2A 1PX6A 4RQXA 2H72A 1YKCA 3F3RA 2L4QA 1EP8A 1O73A 5D9TA 3DWVA 2L57A 2C0EA 3DGQA 3O76A 3A2WA 4HUAA 2B5YA 2YV7A 1KBNA 1OAZA 4GQCA 4HJ2A 2VM1A 4ZL8A 3A5IA 4N11A 3KMOA 4GXZA 2FWFA 2IIYA 4MK3A 1EEMA 3IBHA 4XS4B 4ZILA 4XS6A 2VCTA 2B3SA 2DJJA 2EIQA 2HRKA 4O5QA 2V1MA 3QDNA 4I5QA 3VURA 3RAZA 3LXZA 2R5GA 4YH2A 2VL9A 1O81A 4RUVA 4V2NA 4P3YB 2FUG2 1F9MA 2LRTA 4BVYA 1W4VA 4NHZA 4MPGA 1O7UA 1GSSA 4TXOB 3G9BA 4TOPA 3TKSE 6GSTA 4OO4A 1GSDA 1PN0A 3GL5A 3E9JB 3UEMA 2NTOA 4V1Ag 5JCUA 4HZ4A 3KCMA 4ZBBA 2H01A 2H30A 2LRNA 4MF5A 1S3CA 2IMDA 3GX8A 1MDKA 2ZCTA 1E2YA 2YOIA 1KTEA 3ZRDA 5GSTA 3TJFA 2FCHA 3FR9A 3GSSA 3LORA 3IRAA 3WGEA 3GSTA 1Z6MA 2WCIA 4L5OA 1BYEA 1EZKA 2H1AA 3UBKA 4IP6A 1W89A 5F07A 4EF0A 13GSA 3FEUA 1R4WA 3KTLA 2FWGA 1VRSD 2FWEA 4Z2UA 4LL1B 2H1BA 4MA9A 2XBIA 3VLNA 5IMZA 6GSYA 4KCAA 3GUSA 4ZL9A 2WS2A 4KA0A 4YKFA 3R3EA 9GSSA 1NHOA 3C1RA 1YQ1A 2V6KA 3ED3A 4GF0A 4PTSA 3F63A 3P7XA 2B5EA 5CO3A 3NZNA 1AQXA 2NBSA 3UBLA 3QFAC 4F03A 4OD7A 4K8MA 2L5OA 1Z3EA 1O85A 2IMFA 3GFKA 4JR4A 3A2XA 3IAS2 3ZFBA 3IAM2 4MJCA 1FB6A 2HRFA 5F0GA 1Y6EA 1GSEA 2B1KA 1K0MA 4O92A 1ZYEA 2JSYA 5ECSA 19GSA 2XC2A 3SWLA 3VWWA 1FVKA 1DBYA 3MAKA 20GSA 1PQNA 1GNEA 3QAVA 1AAZA 1OKDA 1V2AA 3QR6A 4GTUA 2IMIA 11GSA 1GLPA 2OE0A 4KX4A 2FLSA 12GSA 1EOHA 2LS5A 4XIHA 3TOTA 1TI3A 1TW9A 4ZL7A 4EXJA 3EWLA 2I9HA 4TXVA 1MD3A 1ERVA 5HR0A 4LA1A 2KOKA 3DXBA 4EUYA 4TXOA 1PKWA 7GSSA 4JU5A 1PL2A 1Z6NA 2B6MA 3APSA 3IHQA 4BVXA 1XW5A 3IC4A 2EC4A 4KSMA 5J4UA 1WMJA 3CSHA 1T3BA 2A4VA 1PSQA 4NV5A 16GSA 3KIJA 1ERTA 2R0CA 1WWJA 4PURA 5DBQA 2R0PA 1ZOFA 1HNCA 2JZSA 2GZZA 5IIZA 2GQKA 3CXGA 4MJBA 2GQLA 1CQGA 3M1GA 1IYIA 3PPUA 4L0UA 2RUFA 4JR6A 5D93A 3ZIJA 1G7OA 2RIIA 3JCML 1DE1A 1PL1A 1GLQA 3TKQA 4NXIA 1NSWA 4ULXA 2GGTA 2JL4A 3KJYA 1M0UA 2GVPA 1EEJA 4ZIJA 4MF7A 3O6TA 4IS0A 4I8BA 3F4TA 1T00A 3W8SA 3MDKA 3IXRA 5AN1A 4MCUA 4NMUA 1S3AA 5ECPB 4D73A 1X9SB 4MP4A 4POBA 3ZZXA 4FH8A 4ZBAA 2E7PA 1A0RP 1FHEA 4WETA 4WEYA 1TRSA 2OJLA 2LRCA 2H66A 2PUKC 2WZ9A 4QQ7A 1WE0A 5ENUA 17GSA 3KD0A 1SL2B 2ALBA 4Q5RA 3H8QA 3DEXA 3M3MA 3FY7A 1WP0A 2VUPA 2CV4A 3LQ7A 2WB9A 5ECOB 3C7MA 6GSUA 3FRCA 1WPIA 2FGXA 3L78A 4K0NA 2VAFA 2H1DA 4LMWA 2L4CA 2VO4A 4TRXA 1M7TA 2L5LA 1S3DA 5A4UA 3E0UA 3DYRA 4FIWA 1URMA 4AJ6A 2V41A 2H70A 1K3LA 4HI7A 5ID2A 2M80A 2YCDA 1HNBA 3FZ4A 1K0OA 1SYRA 5IOXA 5DAKA 2GQMA 1XWGA 10GSA 1JLWA 4IVFA 1GTUA 2X99A 1MTCA 3I6AA 1K3OA 1FO5A 3CTGA 4MH3A 3VFIA 2H76A 1LJRA 2HRAA 5LNKe 1TK0B 3ERWA 3V1WA 3HCZA 2R4VA 3LFLA 4HQSA 1R5PA 4GSTA 4MZCA 1TRWA 3UVTA 5G5FA 4PGTA 4TVEA 2NDOA 2WGRA 4OCFA 5ECLB 4EIQA 4GSSA 3FKFA 2DJ2A 2QGVA 1VGLA 3LGCA 3FW2A 1I5GA 3I43A 2O87A 5IM9A 4NPBA 4GLTA 3D21A 4WBJA 1GUMA 1FVJA 4IJ3A 3RHCA 5COHA 5IO2A 4GRFA 4I6XA 3KXOA 1Z7PA 2YPMA 2VL3A 1B9XC 2C1YA 4KB3A 4WF4A 3TRXA 3DKSA 1X9WB 1U88A 1MD4A 1OC9B 2E2GA 2C3TA 1V58A 1A23A 4AGSA 4HZ2A 3LG6A 4Q5NA 1EOGA 2PU9C 4Z7XA 5G5EA 5JWRB 1SKWB 4N0VA 4L5LA 1F6MC 2OBIA 5B6MA 1E6BA 3QFBC 4EO3A 3TKSC 1FB0A 2N5FA 5KOXA 1YY7A 1NHYA 5CAXA 2DJ1A 2XBQA 2YZHA 5E59A 1ILOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA7 A;  3EMP A;  1YDK A;  3BOA A;  3CSJ A;  4POK A;  1PKZ A;  4DSR A;  1AC1 A;  1U3I A;  1ZL9 A;  1F2E A;  5FHI A;  1QUW A;  2B5X A;  2VCW A;  1SK0 A;  3PGT A;  3BBY A;  1TTZ A;  3TKR A;  1V40 A;  3TJJ A;  2CA8 A;  3GNJ A;  1SEN A;  4TR1 B;  2GSR A;  2DLX A;  3F4R A;  5HFG A;  4FO5 A;  2GTU A;  4LL4 B;  4J2F A;  2VOC A;  1TJD A;  4QL9 A;  3ZLP A;  5L71 A;  5IPH A;  3TB2 A;  1G0T A;  3G7I A;  1B9Y C;  1XIY A;  5EPF A;  1ON4 A;  4F82 A;  1A0F A;  3PR8 A;  4ZB8 A;  1CQH A;  3F4S A;  2OE1 A;  4EKZ A;  3APQ A;  4E8E A;  3VWX A;  1R5A A;  2FA4 A;  2VLT A;  2VL2 A;  4O7H A;  4EDZ A;  2M72 A;  2O85 A;  1SJZ A;  2IME A;  2JSZ A;  3DML A;  3M8N A;  3CYN A;  2AYT A;  2REM A;  1GTA A;  2CX3 A;  3GV1 A;  4Q5Q A;  3EC3 A;  4V2L A;  5DVB A;  2VLV A;  1YF0 A;  1J08 A;  1EWX A;  4OFT A;  3FZ5 A;  4IN0 A;  2CQ9 A;  1SD8 A;  2PVQ A;  3LYP A;  1AIU A;  3W6G A;  5B6N A;  3OR5 A;  1NM3 A;  1A8L A;  2OAD A;  2K8S A;  4ML1 A;  4K0G A;  2Z9S A;  3GTU B;  1JFU A;  2H0G A;  3GN3 A;  4HS1 A;  2FA8 A;  3E3E A;  3MWH A;  3D0Z A;  4X0X A;  4J57 E;  3FZ9 A;  4NWY A;  1PMT A;  2H73 A;  1GL8 A;  4GWR A;  1A2J A;  4H86 A;  3TJG A;  2X64 A;  2ZNM A;  3Q18 A;  1G6W A;  1X5C A;  1Z9H A;  3I9V 2;  3US3 A;  3UAR A;  2OBK A;  4HEA 2;  2F3M A;  2LNT A;  3GL3 A;  1HYU A;  2F8F A;  4HDE A;  3KGK A;  2QKE A;  4K9Z A;  4YQV A;  2GZY A;  2WDU A;  1M9A A;  4BWQ A;  4DVC A;  3CTF A;  2RUE A;  2JAC A;  2IWT A;  1SL1 B;  2C3Q A;  5G1L A;  5G2Z A;  1XWB A;  4PQI A;  1XW6 A;  5ECI B;  2YJ7 A;  4CW9 A;  5AIX A;  5INY A;  2H74 A;  1PGT A;  1K0C A;  1M99 A;  2HT9 A;  3QOU A;  5IPG A;  4KSO A;  4L0W A;  4K7O A;  5HR2 A;  5D9X A;  1DE2 A;  2HLS A;  1OVN A;  3IV4 A;  3GX0 A;  3HVS A;  5H5R A;  3TJK A;  1TK5 B;  3R2Q A;  5GAN D;  1FG4 A;  4TR1 A;  2E2M A;  1TU7 A;  5D9W A;  2VM2 A;  1GTB A;  2PWJ A;  1QXH A;  2RM6 A;  4HU9 A;  1GSQ A;  3DD3 A;  4N30 A;  1V98 A;  3FR6 A;  2PN8 A;  5CRE A;  3RHB A;  4DSS B;  4XS4 A;  3W8J A;  1XZO A;  3MSZ A;  2LJK A;  5J5N A;  1K0B A;  5FWG A;  2R3X A;  3O3T A;  2E0Q A;  3HHV A;  1J0F A;  4JRR A;  5CRD A;  4KGI A;  3KP9 A;  2YWN A;  3BD2 A;  1WRY A;  2IMK A;  1UA5 A;  3CRT A;  5CRH A;  1BQ7 A;  4JED A;  4MAB A;  5J3R A;  2CVK A;  5DAL B;  4OFM A;  4BWS A;  3KH9 A;  3QMX A;  5EL8 A;  4XS1 A;  5CP1 A;  3DRN A;  1TRV A;  3IOS A;  3HVX A;  5H5S A;  2YWO A;  2VIM A;  1M9B A;  3ZMK A;  1TRU A;  1GTI A;  2FY6 A;  2IFQ B;  3M9J A;  4PQH A;  3IE3 A;  2HYX A;  3IA1 A;  3KZQ A;  4POL A;  4CDO A;  3QD9 A;  4ECI A;  2XPD A;  3NOF A;  2O7K A;  2GSQ A;  1DSB A;  2HZE B;  2H75 A;  3M0F A;  5JCW A;  5IMC A;  1SD9 A;  4EC0 A;  4MDC A;  4TN8 A;  2B1L A;  4G10 A;  2MMO A;  1O8W A;  2RLI A;  2C8U A;  5G1K A;  3KP8 A;  4ECJ A;  1X5E A;  8GSS A;  4ML6 A;  4PUF C;  4EDY A;  3F8U A;  1KEB A;  2B7K A;  4TR4 A;  1QMV A;  5GSS A;  2YP6 A;  1UN2 A;  2CZ3 A;  5DJM A;  1F3A A;  3WT1 A;  4XRD A;  4IBP A;  4ZBD A;  3RDW A;  1TDI A;  5JWO B;  1OE7 A;  1M2B A;  3DVX A;  3D4T A;  5HR1 A;  4O32 A;  3P90 A;  3TRP A;  2XHF A;  1EGO A;  2KLX A;  4QL7 A;  1BED A;  1ZGN A;  2MMA A;  2FWH A;  4V1A p;  2VCX A;  2KUC A;  4I2T A;  2P5Q A;  3GKK A;  5IMA A;  1YKA A;  2O8V B;  2GT5 A;  3IPZ A;  4IJI A;  1THX A;  4ACS A;  2WJU A;  3WGX A;  1LU4 A;  4IQ1 A;  4L8E A;  5IQY A;  4IGJ A;  2C0G A;  2AHE A;  2P5R A;  3CSI A;  1TXX A;  3FZA A;  4XHM A;  4F0B A;  4XRA A;  4GCI A;  5ECK B;  4TKY A;  5IMD A;  1SYX A;  3SBC A;  5DDL A;  1QGV A;  2CX4 A;  3UVH A;  3ISO A;  2JZR A;  2AUV A;  2YWI A;  1XVQ A;  1THO A;  4DSQ A;  5J41 A;  1KNG A;  2DJK A;  3H79 A;  3ZVJ A;  1PN9 A;  5KN3 A;  5A4W A;  3S9F A;  2JAD A;  14GS A;  2JU5 A;  4MJE A;  1RQM A;  2ON7 A;  4AF2 A;  4YQU A;  3CMI A;  1JLV A;  2RM5 A;  2DSA A;  2K6V A;  4K7N A;  1PA3 A;  3HXS A;  3CBU A;  4KUN A;  1N8J A;  1T7P B;  3C71 A;  5KN1 A;  2N5A A;  1XOA A;  1YJ6 A;  2NPB A;  2OKA A;  3ERG A;  2QC7 A;  1Z5Y E;  1G7E A;  3EVI A;  1A8Y A;  2LQQ A;  3EYT A;  1Z7R A;  3BJ5 A;  1X5D A;  5ECQ B;  3HVV A;  3HJM A;  3GKM A;  2X8G A;  4WF5 A;  3BCI A;  4PXO A;  1ST9 A;  2OE3 A;  2LJA A;  5C04 A;  5D96 A;  3GMF A;  1JZO A;  4BPY A;  2LTK A;  2PBJ A;  3EE2 A;  4K2D A;  5AIS A;  1YF1 A;  4EL1 A;  3J7Y k;  3A5W A;  2YWM A;  4PNG A;  1YEX A;  3F3Q A;  3TRQ A;  4ECB A;  3ERF A;  2NVL A;  4E8H A;  3F9U A;  5ECR B;  5F8B A;  2G0F A;  1GUL A;  4IEL A;  4ECC A;  4PNF A;  2VCV A;  1LBK A;  5KN0 A;  4MPF A;  1B48 A;  4JBB A;  1XWC A;  3APO A;  3A2V A;  4YAV A;  5IO0 A;  1T8E B;  2LV3 A;  5ABR A;  2OA7 A;  2X8H A;  3HDC A;  5D73 A;  2H0H A;  2H6Z A;  5DJL A;  2AJQ B;  5B8A A;  1K0N A;  4RQR A;  1K0D A;  1GSU A;  4MH2 A;  5ELG A;  2GSS A;  4HOJ A;  4X43 A;  2VCQ A;  4FYB A;  3LJR A;  4ZB6 A;  2K18 A;  4ZXG A;  2HE3 A;  2AAW A;  1MDJ A;  1SU9 A;  1WOU A;  3I69 A;  3ME7 A;  2OAC A;  1VF4 A;  2HFD A;  5IOW A;  4MZW A;  3GUR A;  2DML A;  4KE3 A;  2A2S A;  3EIN A;  5C00 A;  5A5K A;  1GSY A;  3N9J A;  2L6D A;  5J9B A;  3GIX A;  4K6X A;  4POM A;  4MZB A;  5B8B A;  2O89 A;  4KW6 A;  4PUA A;  1H4O A;  4F0C A;  3VWV A;  4TR0 A;  1SK2 A;  4OFN A;  1A2L A;  1K0A A;  3GH9 A;  2ES7 A;  4WR5 A;  4N0Z A;  2I4A A;  1GUK A;  1A2M A;  2VCZ A;  1AUC A;  1EV4 A;  3DIE A;  3LSZ A;  3LXT A;  1MDI A;  3GKN A;  2YN1 A;  4ISD A;  1SJ6 A;  1XXU A;  2VLU A;  6GSW A;  3HZ8 A;  18GS A;  1OKT A;  1Q4J A;  4MLY A;  3HJP A;  2IPA A;  2H6X A;  3PH9 A;  4EVM A;  4KH7 A;  4V2M A;  3DVW A;  3UIW A;  3RBT A;  4LMV A;  3K8N A;  2PMT A;  2AB6 A;  1X9M B;  2PGT A;  4X1U A;  3UAP A;  1OC9 A;  3VPQ A;  3P2A A;  5A4V A;  2JZT A;  2TRC P;  4NHW A;  3QAW A;  4K1F A;  2ZUP A;  4FYC A;  4OO5 A;  1N2A A;  2EIO A;  3KEB A;  3VI5 A;  2QSI A;  2DMM A;  4I97 A;  4N10 A;  2A2R A;  1TI1 A;  4WXT A;  2GZP A;  4RI6 A;  2GS3 A;  3VPT A;  3Q6O A;  3TDG A;  2C80 A;  1JZR A;  1JHB A;  2CVB A;  5GZZ B;  1YEP A;  2R37 A;  5H5Q A;  1BJX A;  3ZIT A;  1B8X A;  2HNL A;  3RPN A;  1C72 A;  1NW2 A;  1XOB A;  5AIV A;  3GA4 A;  1M2A A;  2HXK A;  2MZC A;  3HJO A;  1ABA A;  3WT2 A;  2HI7 A;  4IQA A;  4AJ7 A;  3EU4 A;  4O5R A;  1TOF A;  1GNW A;  1GH2 A;  4TR3 A;  4MMM A;  2YZU A;  3J7Y b;  3QCP A;  2J9H A;  3LYK A;  5AGY A;  5CYY A;  1J9B A;  2F8A A;  4D73 B;  1I9D A;  3L9S A;  1XCC A;  1XWA A;  1HNA A;  2CZ2 A;  1F3B A;  4EE0 A;  2B7J A;  2FNO A;  2V32 A;  1G6Y A;  2H6Y A;  1PD2 1;  2HSY A;  3WGD A;  3D4M A;  1A24 A;  1FOV A;  1B4P A;  3CRU A;  4WKW A;  5CRG A;  2I3Y A;  1XW9 A;  2G2Q A;  1FW1 A;  3FR3 A;  1EGR A;  3VI7 A;  3WD6 A;  1TKD B;  1K3Y A;  2AV4 A;  4LLR A;  1ML6 A;  4F9Z A;  4WBR D;  4HU7 A;  4KDY A;  1BAY A;  5F05 A;  1AW9 A;  3TCO A;  1U87 A;  1USB A;  2K9F A;  3U5R E;  2H8L A;  1DUG A;  2IJY A;  1XPV A;  1GSF A;  3ZTL A;  4ID0 A;  3D6I A;  3VK9 A;  3UMA A;  5DCG A;  2WUL A;  2C0D A;  5IMF A;  5ID2 B;  2V6O A;  1ZMA A;  3H93 A;  3FYG A;  5DAK B;  2P0G A;  3L9U A;  2BJX A;  3LEF A;  1R26 A;  5LCZ A;  3IDV A;  5KN2 A;  3GTU A;  1ZCP A;  2YJH A;  2N5B A;  5G31 A;  2LKU A;  1PX7 A;  4PQ1 A;  2HSH A;  1SL0 B;  4XTS A;  4IP1 A;  2VL2 C;  1X0R A;  5J9C A;  1ZZY A;  5JWQ B;  1GWC A;  1QK8 A;  2CAQ A;  2TRX A;  3F6F A;  3A3T A;  3QPM A;  5ECN B;  5EY6 A;  3KTB A;  3P8W A;  3TKS A;  2KHP A;  3L0H A;  4YAP A;  3ZML A;  3UL3 A;  2R2J A;  2XPE A;  4BL7 A;  1OYJ A;  3HYP A;  1GRX A;  6GSX A;  3ZYW A;  3KM6 A;  4WR4 A;  3FK8 A;  2LQO A;  2CT6 A;  4F2I A;  2C4J A;  1TK8 B;  3ZFL A;  4CHS A;  2PVO C;  2KP1 A;  4J56 E;  6GSS A;  3TJB A;  2CAI A;  5CNW A;  4KND A;  1T1V A;  1T4Y A;  2LST A;  5G30 A;  4NV2 A;  1XBS A;  2H19 A;  1QFN A;  2DJ0 A;  2DC5 A;  3N5O A;  4MJA A;  4KDU A;  3PIN A;  4TW5 A;  1ERW A;  3M9K A;  4KDX A;  5IMV A;  3IK7 A;  4JE1 A;  1TU8 A;  3D22 A;  2WRT A;  2L59 A;  2DIY A;  1OE8 A;  2R6K A;  2DBC A;  1B4Q A;  2MBS A;  5D8I A;  1XFL A;  3TUE A;  3HA9 A;  1O6J A;  2P31 A;  1GP1 A;  1ACV A;  3ZVJ D;  5ELA A;  1XWK A;  1OC3 A;  2YAN A;  4GQF A;  1WIK A;  2GDR A;  3ZIV A;  1IYH A;  2I81 A;  1EV9 A;  3UOM A;  4DSS A;  2LEG A;  5HFI A;  2IL3 A;  3LWA A;  4IHU A;  2BTO T;  5HQP A;  1ERU A;  1V9W A;  2VD1 A;  3BCK A;  1YZX A;  5HR3 A;  3VWU A;  5B7C A;  4OWY A;  3KH7 A;  2GLR A;  2LNS A;  1M2D A;  4FYU A;  2V2G A;  3GRX A;  3RPP A;  5DAL A;  2EIR A;  2PPT A;  4KCE A;  1V57 A;  1UC7 A;  3GKX A;  5HFK A;  3HZ4 A;  1HD2 A;  5KEJ A;  2GT6 A;  3Q19 A;  2I1U A;  1ZYQ B;  3QAG A;  3EMX A;  1RW1 A;  1PRX A;  2DIZ A;  4ILF A;  3F0I A;  2C0F A;  1FAA A;  3TOU A;  2IFQ A;  4G19 A;  3H1N A;  1GUH A;  3EU3 A;  5DQY A;  1WJK A;  1F37 A;  5JCG A;  3GHA A;  3TKP A;  2M46 A;  1T4Z A;  1BG5 A;  5FT3 A;  1Q98 A;  3C8E A;  2TIR A;  1SK1 A;  3ME8 A;  4I2U A;  3EUR A;  6GSV A;  2HZE A;  1VF2 A;  3TGZ A;  1RK4 A;  5GAP D;  4DEJ A;  2MYG A;  4OMV A;  3H4K A;  2L6C A;  3HKR A;  2DJ3 A;  4RI7 A;  2PER A;  2VD0 A;  3C1S A;  3FHK A;  1VF3 A;  22GS A;  2H1G A;  3ZRE A;  1AXD A;  3L9V A;  4HQZ A;  2ON5 A;  4G2E A;  2MMZ A;  2WFC A;  2MBT A;  1R7H A;  3HY2 A;  1AQV A;  1OC8 A;  2H71 A;  5EVO A;  4NAX A;  1SKS B;  4PX1 A;  4YQM A;  3HD5 A;  1U3A A;  5E4W A;  3U6V A;  1MEK A;  3MNG A;  3AY8 A;  4G9H A;  3F6D A;  5D9V A;  3IR4 A;  3WYW A;  1U6T A;  1Y25 A;  2HZF A;  2IN3 A;  2K8V A;  1UVZ A;  2C3N A;  4GSN A;  5ECH B;  3G7J A;  4K7I A;  1VF1 A;  2YNX A;  2F51 A;  4OCE A;  2H0I A;  1JZD A;  2CVD A;  2J23 A;  3NIV A;  4AJ8 A;  2LUS A;  4MF6 A;  2D2Z A;  2GST A;  3C73 A;  1HQO A;  3UJ1 A;  1XVW A;  2X8C A;  5DQS A;  5F06 A;  3D5J A;  4Q5F A;  4ZB9 A;  5CRW A;  4HJM A;  1AQW A;  1BX9 A;  4IW9 A;  5ECM B;  1H75 A;  3KMN A;  3GYK A;  4XCS A;  2FD3 A;  2LJR A;  3IK9 A;  4IKH A;  1JZW A;  1TP9 A;  4KAE A;  1O8X A;  1SKR B;  2MMN A;  3G7Y A;  4JZQ A;  3GH6 A;  2F9S A;  3L4N A;  2FHE A;  1QQ2 A;  2YV9 A;  1SJI A;  5LD0 A;  2HRN A;  2BMX A;  3Q74 A;  3ZL5 A;  1EP7 A;  5DCH A;  2KP2 A;  1PX6 A;  4RQX A;  2H72 A;  1YKC A;  3F3R A;  2L4Q A;  1EP8 A;  1O73 A;  5D9T A;  3DWV A;  2L57 A;  2C0E A;  3DGQ A;  3O76 A;  3A2W A;  4HUA A;  2B5Y A;  2YV7 A;  1KBN A;  1OAZ A;  4GQC A;  4HJ2 A;  2VM1 A;  4ZL8 A;  4N11 A;  3KMO A;  4GXZ A;  2FWF A;  2IIY A;  4MK3 A;  1EEM A;  3IBH A;  4XS4 B;  4ZIL A;  4XS6 A;  2VCT A;  2B3S A;  2DJJ A;  2EIQ A;  2V1M A;  3QDN A;  4I5Q A;  3VUR A;  3RAZ A;  3LXZ A;  2R5G A;  4YH2 A;  2VL9 A;  1O81 A;  4RUV A;  4V2N A;  4P3Y B;  2FUG 2;  1F9M A;  2LRT A;  4BVY A;  1W4V A;  4NHZ A;  4MPG A;  1O7U A;  1GSS A;  4TXO B;  3G9B A;  4TOP A;  3TKS E;  6GST A;  4OO4 A;  1GSD A;  3GL5 A;  3E9J B;  3UEM A;  2NTO A;  4V1A g;  5JCU A;  4HZ4 A;  3KCM A;  4ZBB A;  2H01 A;  2H30 A;  2LRN A;  4MF5 A;  1S3C A;  2IMD A;  3GX8 A;  1MDK A;  2ZCT A;  1E2Y A;  2YOI A;  1KTE A;  3ZRD A;  5GST A;  3TJF A;  2FCH A;  3FR9 A;  3GSS A;  3LOR A;  3IRA A;  3WGE A;  3GST A;  1Z6M A;  2WCI A;  4L5O A;  1BYE A;  1EZK A;  2H1A A;  3UBK A;  4IP6 A;  1W89 A;  5F07 A;  4EF0 A;  13GS A;  3FEU A;  1R4W A;  3KTL A;  2FWG A;  1VRS D;  2FWE A;  4LL1 B;  2H1B A;  4MA9 A;  2XBI A;  3VLN A;  5IMZ A;  6GSY A;  4KCA A;  3GUS A;  4ZL9 A;  2WS2 A;  4KA0 A;  9GSS A;  1NHO A;  3C1R A;  1YQ1 A;  2V6K A;  3ED3 A;  4GF0 A;  3F63 A;  3P7X A;  2B5E A;  5CO3 A;  3NZN A;  1AQX A;  2NBS A;  3UBL A;  3QFA C;  4F03 A;  4OD7 A;  4K8M A;  2L5O A;  1Z3E A;  1O85 A;  2IMF A;  3GFK A;  4JR4 A;  3A2X A;  3IAS 2;  3ZFB A;  3IAM 2;  4MJC A;  1FB6 A;  2HRF A;  5F0G A;  1Y6E A;  1GSE A;  2B1K A;  1K0M A;  4O92 A;  1ZYE A;  2JSY A;  5ECS A;  19GS A;  2XC2 A;  3SWL A;  3VWW A;  1FVK A;  1DBY A;  3MAK A;  20GS A;  1PQN A;  1GNE A;  3QAV A;  1AAZ A;  1OKD A;  1V2A A;  3QR6 A;  4GTU A;  2IMI A;  11GS A;  1GLP A;  2OE0 A;  4KX4 A;  2FLS A;  12GS A;  1EOH A;  2LS5 A;  4XIH A;  3TOT A;  1TI3 A;  1TW9 A;  4ZL7 A;  4EXJ A;  3EWL A;  2I9H A;  4TXV A;  1MD3 A;  1ERV A;  5HR0 A;  4LA1 A;  2KOK A;  3DXB A;  4EUY A;  4TXO A;  1PKW A;  7GSS A;  4JU5 A;  1PL2 A;  1Z6N A;  2B6M A;  3APS A;  3IHQ A;  4BVX A;  1XW5 A;  3IC4 A;  2EC4 A;  4KSM A;  5J4U A;  1WMJ A;  3CSH A;  1T3B A;  2A4V A;  1PSQ A;  4NV5 A;  16GS A;  3KIJ A;  1ERT A;  1WWJ A;  4PUR A;  5DBQ A;  1ZOF A;  1HNC A;  2JZS A;  2GZZ A;  5IIZ A;  2GQK A;  3CXG A;  4MJB A;  2GQL A;  1CQG A;  3M1G A;  1IYI A;  4L0U A;  2RUF A;  4JR6 A;  5D93 A;  3ZIJ A;  1G7O A;  2RII A;  3JCM L;  1DE1 A;  1PL1 A;  1GLQ A;  3TKQ A;  4NXI A;  1NSW A;  4ULX A;  2GGT A;  2JL4 A;  3KJY A;  1M0U A;  2GVP A;  1EEJ A;  4ZIJ A;  4MF7 A;  3O6T A;  4IS0 A;  4I8B A;  3F4T A;  1T00 A;  3W8S A;  3MDK A;  3IXR A;  5AN1 A;  4MCU A;  4NMU A;  1S3A A;  5ECP B;  4D73 A;  1X9S B;  4MP4 A;  4POB A;  3ZZX A;  4FH8 A;  4ZBA A;  2E7P A;  1A0R P;  1FHE A;  4WET A;  4WEY A;  1TRS A;  2OJL A;  2LRC A;  2H66 A;  2PUK C;  2WZ9 A;  4QQ7 A;  1WE0 A;  5ENU A;  17GS A;  3KD0 A;  1SL2 B;  2ALB A;  4Q5R A;  3H8Q A;  3DEX A;  3M3M A;  3FY7 A;  1WP0 A;  2VUP A;  2CV4 A;  3LQ7 A;  2WB9 A;  5ECO B;  3C7M A;  6GSU A;  3FRC A;  1WPI A;  2FGX A;  3L78 A;  4K0N A;  2VAF A;  2H1D A;  4LMW A;  2L4C A;  2VO4 A;  4TRX A;  1M7T A;  2L5L A;  1S3D A;  5A4U A;  3E0U A;  3DYR A;  4FIW A;  1URM A;  4AJ6 A;  2V41 A;  2H70 A;  1K3L A;  4HI7 A;  5ID2 A;  2M80 A;  2YCD A;  1HNB A;  3FZ4 A;  1K0O A;  1SYR A;  5IOX A;  5DAK A;  2GQM A;  1XWG A;  10GS A;  1JLW A;  4IVF A;  1GTU A;  2X99 A;  1MTC A;  3I6A A;  1K3O A;  1FO5 A;  3CTG A;  4MH3 A;  3VFI A;  2H76 A;  1LJR A;  5LNK e;  1TK0 B;  3ERW A;  3V1W A;  3HCZ A;  2R4V A;  3LFL A;  4HQS A;  1R5P A;  4GST A;  4MZC A;  1TRW A;  3UVT A;  5G5F A;  4PGT A;  4TVE A;  2NDO A;  2WGR A;  4OCF A;  5ECL B;  4GSS A;  3FKF A;  2DJ2 A;  2QGV A;  1VGL A;  3LGC A;  3FW2 A;  1I5G A;  3I43 A;  2O87 A;  5IM9 A;  4NPB A;  4GLT A;  3D21 A;  4WBJ A;  1GUM A;  1FVJ A;  4IJ3 A;  3RHC A;  5COH A;  5IO2 A;  4GRF A;  4I6X A;  3KXO A;  1Z7P A;  2YPM A;  2VL3 A;  1B9X C;  2C1Y A;  4KB3 A;  4WF4 A;  3TRX A;  3DKS A;  1X9W B;  1U88 A;  1MD4 A;  1OC9 B;  2E2G A;  2C3T A;  1V58 A;  1A23 A;  4AGS A;  4HZ2 A;  3LG6 A;  4Q5N A;  1EOG A;  2PU9 C;  4Z7X A;  5G5E A;  5JWR B;  1SKW B;  4N0V A;  4L5L A;  1F6M C;  2OBI A;  5B6M A;  1E6B A;  3QFB C;  4EO3 A;  3TKS C;  1FB0 A;  2N5F A;  1YY7 A;  1NHY A;  5CAX A;  2DJ1 A;  2XBQ A;  2YZH A;  5E59 A;  1ILO A; 
#chains in the Genus database with same CATH topology
 4BA7 A;  3EMP A;  1YDK A;  3BOA A;  3CSJ A;  4POK A;  1PKZ A;  4DSR A;  1AC1 A;  1U3I A;  1ZL9 A;  1F2E A;  5FHI A;  1QUW A;  2B5X A;  4CY6 A;  2VCW A;  1SK0 A;  3PGT A;  3BBY A;  3HVN A;  1TTZ A;  3TKR A;  1V40 A;  3TJJ A;  2CA8 A;  3GNJ A;  1SEN A;  4TR1 B;  2GSR A;  2DLX A;  3F4R A;  5HFG A;  4FO5 A;  2GTU A;  3MIX A;  4LL4 B;  4J2F A;  2VOC A;  1TJD A;  4QL9 A;  3ZLP A;  5L71 A;  5IPH A;  3TB2 A;  1G0T A;  3G7I A;  1B9Y C;  1XIY A;  5EPF A;  1ON4 A;  4F82 A;  1A0F A;  3PR8 A;  4ZB8 A;  1CQH A;  3F4S A;  2OE1 A;  4EKZ A;  3APQ A;  4E8E A;  3VWX A;  1R5A A;  2FA4 A;  2VLT A;  2VL2 A;  4O7H A;  4EDZ A;  2M72 A;  2O85 A;  1SJZ A;  2IME A;  2JSZ A;  3DML A;  3M8N A;  3CYN A;  2AYT A;  2REM A;  1GTA A;  2CX3 A;  3GV1 A;  4Q5Q A;  3EC3 A;  4V2L A;  5DVB A;  3FMW A;  2VLV A;  1YF0 A;  1J08 A;  1EWX A;  4OFT A;  3FZ5 A;  4A5P A;  4IN0 A;  2CQ9 A;  1SD8 A;  2PVQ A;  3LYP A;  1AIU A;  3W6G A;  5B6N A;  3OR5 A;  1NM3 A;  1A8L A;  2OAD A;  2K8S A;  4ML1 A;  4K0G A;  2Z9S A;  3GTU B;  1JFU A;  2H0G A;  3GN3 A;  4HS1 A;  2FA8 A;  3E3E A;  3MWH A;  3D0Z A;  4X0X A;  4J57 E;  3FZ9 A;  4NWY A;  1PMT A;  2H73 A;  1GL8 A;  4GWR A;  1A2J A;  4H86 A;  3TJG A;  2X64 A;  2ZNM A;  3Q18 A;  1G6W A;  4CY8 A;  1X5C A;  1Z9H A;  3I9V 2;  3US3 A;  3UAR A;  2OBK A;  4HEA 2;  2F3M A;  2LNT A;  3GL3 A;  1HYU A;  2F8F A;  4HDE A;  3KGK A;  2QKE A;  4K9Z A;  4YQV A;  2GZY A;  2WDU A;  1M9A A;  4BWQ A;  4DVC A;  3CTF A;  2RUE A;  2JAC A;  2IWT A;  1SL1 B;  2C3Q A;  5G1L A;  4BL7 B;  5G2Z A;  1XWB A;  4PQI A;  1XW6 A;  5ECI B;  2YJ7 A;  4CW9 A;  5AIX A;  5INY A;  2H74 A;  1PGT A;  1K0C A;  1M99 A;  2HT9 A;  3QOU A;  5IPG A;  4KSO A;  2QA2 A;  4L0W A;  4K7O A;  5HR2 A;  4Z2T A;  5D9X A;  1DE2 A;  2HLS A;  1OVN A;  3IV4 A;  3GX0 A;  3HVS A;  5H5R A;  3TJK A;  1TK5 B;  5BRT A;  3R2Q A;  5GAN D;  1FG4 A;  4TR1 A;  2E2M A;  1TU7 A;  5D9W A;  2VM2 A;  1GTB A;  2PWJ A;  1QXH A;  2RM6 A;  4HU9 A;  1GSQ A;  3DD3 A;  4N30 A;  1V98 A;  3FR6 A;  2PN8 A;  5CRE A;  3RHB A;  4DSS B;  4XS4 A;  3W8J A;  1XZO A;  2R0G A;  3MSZ A;  2LJK A;  5J5N A;  1K0B A;  5FWG A;  2R3X A;  3O3T A;  2E0Q A;  3HHV A;  1J0F A;  4JRR A;  5CRD A;  4KGI A;  3KP9 A;  2YWN A;  3BD2 A;  1WRY A;  2IMK A;  1UA5 A;  3CRT A;  5CRH A;  1BQ7 A;  4JED A;  4MAB A;  5J3R A;  2CVK A;  5DAL B;  4OFM A;  4BWS A;  3KH9 A;  3QMX A;  5EL8 A;  1M3I A;  4XS1 A;  5CP1 A;  3DRN A;  1TRV A;  3IOS A;  3HVX A;  5H5S A;  2YWO A;  2VIM A;  1M9B A;  3ZMK A;  1TRU A;  1GTI A;  2FY6 A;  2IFQ B;  3M9J A;  4PQH A;  3IE3 A;  2HYX A;  3IA1 A;  3KZQ A;  4POL A;  4CDO A;  3QD9 A;  4ECI A;  2XPD A;  3NOF A;  4KF9 A;  2O7K A;  4ICY A;  2GSQ A;  1DSB A;  2HZE B;  2H75 A;  3M0F A;  5JCW A;  5IMC A;  1SD9 A;  4EC0 A;  4MDC A;  4TN8 A;  2B1L A;  4G10 A;  2MMO A;  1O8W A;  2RLI A;  2C8U A;  5G1K A;  3KP8 A;  4ECJ A;  1X5E A;  8GSS A;  1ZYN A;  4ML6 A;  4PUF C;  4EDY A;  3F8U A;  1KEB A;  2B7K A;  4TR4 A;  1QMV A;  4G0K A;  2YP6 A;  1UN2 A;  5GSS A;  2CZ3 A;  5DJM A;  1F3A A;  3WT1 A;  4XRD A;  4IBP A;  4ZBD A;  3RDW A;  1TDI A;  5JWO B;  1OE7 A;  1M2B A;  3DVX A;  3D4T A;  5HR1 A;  4O32 A;  3P90 A;  3TRP A;  2XHF A;  1EGO A;  2KLX A;  4QL7 A;  1BED A;  1ZGN A;  2MMA A;  2FWH A;  4V1A p;  2VCX A;  2KUC A;  4I2T A;  2P5Q A;  3GKK A;  5IMA A;  1YKA A;  2O8V B;  2GT5 A;  3IPZ A;  2X4A A;  4IJI A;  1THX A;  4ACS A;  2WJU A;  3WGX A;  1LU4 A;  4IQ1 A;  1M3J A;  4L8E A;  5IQY A;  4IGJ A;  2C0G A;  2AHE A;  2P5R A;  3CSI A;  1TXX A;  3FZA A;  4XHM A;  4F0B A;  4XRA A;  4GCI A;  5ECK B;  4TKY A;  3EPT A;  5IMD A;  1SYX A;  3SBC A;  5DDL A;  1QGV A;  2CX4 A;  3UVH A;  3ISO A;  2JZR A;  2AUV A;  2YWI A;  1XVQ A;  1THO A;  4DSQ A;  5J41 A;  1KNG A;  2DJK A;  3H79 A;  3ZVJ A;  1PN9 A;  5KN3 A;  5A4W A;  3S9F A;  2JAD A;  14GS A;  2JU5 A;  4MJE A;  1RQM A;  2ON7 A;  4AF2 A;  4YQU A;  3CMI A;  1JLV A;  2RM5 A;  2DSA A;  2K6V A;  4K7N A;  1PA3 A;  3HXS A;  3CBU A;  4KUN A;  1N8J A;  1T7P B;  3C71 A;  4Z2R A;  5KN1 A;  2N5A A;  1XOA A;  1YJ6 A;  2NPB A;  2OKA A;  3ERG A;  2QC7 A;  1Z5Y E;  1G7E A;  3EVI A;  1A8Y A;  2LQQ A;  3EYT A;  1Z7R A;  3BJ5 A;  1X5D A;  5ECQ B;  3HVV A;  3HJM A;  3GKM A;  2X8G A;  4WF5 A;  3BCI A;  4PXO A;  1ST9 A;  2OE3 A;  2LJA A;  5C04 A;  5D96 A;  3GMF A;  4BVY B;  1JZO A;  4BPY A;  2LTK A;  2PBJ A;  3EE2 A;  4K2D A;  5AIS A;  1YF1 A;  4EL1 A;  3J7Y k;  3A5W A;  2YWM A;  4PNG A;  1YEX A;  3F3Q A;  3TRQ A;  4ECB A;  3ERF A;  2NVL A;  4E8H A;  3F9U A;  5ECR B;  5F8B A;  2G0F A;  1GUL A;  4IEL A;  4ECC A;  4PNF A;  2VCV A;  1LBK A;  5KN0 A;  4MPF A;  1B48 A;  4JBB A;  1XWC A;  3APO A;  3A2V A;  1FOH A;  4YAV A;  5IO0 A;  1T8E B;  2LV3 A;  5ABR A;  2OA7 A;  2X8H A;  3HDC A;  5D73 A;  2H0H A;  2H6Z A;  5DJL A;  2AJQ B;  5B8A A;  1K0N A;  4FQU A;  4RQR A;  1K0D A;  1GSU A;  4MH2 A;  5ELG A;  2GSS A;  4HOJ A;  4X43 A;  2VCQ A;  4FYB A;  3LJR A;  4ZB6 A;  2K18 A;  4ZXG A;  2HE3 A;  2QA1 A;  2AAW A;  1MDJ A;  1SU9 A;  1WOU A;  3I69 A;  3ME7 A;  2OAC A;  1VF4 A;  2HFD A;  5IOW A;  4MZW A;  3GUR A;  2DML A;  4KE3 A;  2A2S A;  3EIN A;  5C00 A;  5A5K A;  1GSY A;  3N9J A;  2L6D A;  5J9B A;  3GIX A;  4K6X A;  4POM A;  4MZB A;  5B8B A;  2O89 A;  4KW6 A;  4PUA A;  1H4O A;  4F0C A;  3VWV A;  4TR0 A;  1SK2 A;  4OFN A;  1A2L A;  1K0A A;  3GH9 A;  2ES7 A;  4WR5 A;  4N0Z A;  2I4A A;  1GUK A;  1A2M A;  2VCZ A;  1AUC A;  1EV4 A;  3DIE A;  3LSZ A;  3LXT A;  1MDI A;  3GKN A;  2YN1 A;  4ISD A;  1SJ6 A;  1XXU A;  2VLU A;  6GSW A;  3HZ8 A;  18GS A;  1OKT A;  1Q4J A;  4MLY A;  3HJP A;  2IPA A;  2H6X A;  3PH9 A;  4EVM A;  4KH7 A;  4V2M A;  3DVW A;  3UIW A;  3RBT A;  4LMV A;  3K8N A;  2PMT A;  2AB6 A;  1X9M B;  2PGT A;  4X1U A;  3UAP A;  1OC9 A;  3VPQ A;  3P2A A;  5A4V A;  3LW9 A;  4BVX B;  2JZT A;  2TRC P;  4NHW A;  2HSM A;  3QAW A;  4K1F A;  2ZUP A;  4FYC A;  4OO5 A;  1N2A A;  2EIO A;  3KEB A;  3VI5 A;  2QSI A;  2DMM A;  4I97 A;  4N10 A;  2A2R A;  1TI1 A;  4WXT A;  1ZYP A;  2GZP A;  2UZ8 A;  4RI6 A;  2GS3 A;  3VPT A;  3Q6O A;  3TDG A;  2C80 A;  1JZR A;  1JHB A;  2CVB A;  5GZZ B;  1YEP A;  2DKI A;  2R37 A;  5H5Q A;  4K2X A;  1BJX A;  3ZIT A;  1B8X A;  2HNL A;  3RPN A;  1C72 A;  1NW2 A;  1XOB A;  5AIV A;  3GA4 A;  1M2A A;  2HXK A;  2MZC A;  3HJO A;  4K5S A;  1ABA A;  3WT2 A;  2HI7 A;  4IQA A;  4AJ7 A;  3EU4 A;  4O5R A;  1TOF A;  1GNW A;  1GH2 A;  4TR3 A;  4K5R A;  4MMM A;  5BMU A;  2YZU A;  3J7Y b;  3QCP A;  2J9H A;  3LYK A;  5AGY A;  5CYY A;  1J9B A;  2F8A A;  4D73 B;  1I9D A;  3L9S A;  1XCC A;  1XWA A;  1HNA A;  4O5U A;  2CZ2 A;  1F3B A;  4EE0 A;  2B7J A;  2FNO A;  2V32 A;  4USS A;  1G6Y A;  2H6Y A;  1PD2 1;  2HSY A;  3WGD A;  3D4M A;  1A24 A;  1FOV A;  1B4P A;  3CRU A;  4WKW A;  5CRG A;  2I3Y A;  1XW9 A;  2G2Q A;  4HSC X;  1FW1 A;  3FR3 A;  1EGR A;  3VI7 A;  3WD6 A;  1TKD B;  1K3Y A;  2AV4 A;  4LLR A;  1ML6 A;  4F9Z A;  4WBR D;  4HU7 A;  4KDY A;  1XG8 A;  1BAY A;  5F05 A;  1AW9 A;  3TCO A;  1PFO A;  1U87 A;  1USB A;  2K9F A;  3U5R E;  2H8L A;  1DUG A;  2IJY A;  1XPV A;  1GSF A;  3ZTL A;  4ID0 A;  3D6I A;  3VK9 A;  3UMA A;  5DCG A;  2WUL A;  2C0D A;  5IMF A;  5ID2 B;  2V6O A;  1ZMA A;  3H93 A;  3FYG A;  5DAK B;  2P0G A;  3L9U A;  2BJX A;  3LEF A;  1R26 A;  5LCZ A;  3IDV A;  5KN2 A;  3GTU A;  1ZCP A;  5KOW A;  2YJH A;  2N5B A;  5G31 A;  2LKU A;  2DKH A;  3MYD A;  1PX7 A;  4PQ1 A;  2HSH A;  1SL0 B;  4XTS A;  4IP1 A;  2VL2 C;  1X0R A;  5J9C A;  4BIK A;  1ZZY A;  5JWQ B;  1GWC A;  1QK8 A;  2CAQ A;  2TRX A;  3F6F A;  3A3T A;  3QPM A;  5ECN B;  5EY6 A;  3KTB A;  3P8W A;  3TKS A;  2KHP A;  3L0H A;  4YAP A;  3ZML A;  3UL3 A;  2R2J A;  2XPE A;  4BL7 A;  1OYJ A;  3HYP A;  1GRX A;  3IHG A;  6GSX A;  3ZYW A;  3KM6 A;  4WR4 A;  3FK8 A;  2LQO A;  2CT6 A;  4F2I A;  2C4J A;  1TK8 B;  3ZFL A;  4CHS A;  2PVO C;  2KP1 A;  4J56 E;  6GSS A;  3TJB A;  2CAI A;  5CNW A;  4KND A;  1T1V A;  1T4Y A;  4X4J A;  2LST A;  5G30 A;  4NV2 A;  1XBS A;  2H19 A;  1QFN A;  2DJ0 A;  2DC5 A;  3N5O A;  4MJA A;  4KDU A;  3PIN A;  4TW5 A;  2X49 A;  1ERW A;  3M9K A;  4KDX A;  5IMV A;  4G0I A;  3IK7 A;  4JE1 A;  1TU8 A;  3D22 A;  2WRT A;  2L59 A;  2DIY A;  1OE8 A;  2R6K A;  2DBC A;  1B4Q A;  2MBS A;  5D8I A;  1XFL A;  3TUE A;  3HA9 A;  1O6J A;  2P31 A;  1GP1 A;  1ACV A;  3ZVJ D;  5ELA A;  1XWK A;  1OC3 A;  2YAN A;  4GQF A;  1WIK A;  2GDR A;  3ZIV A;  1IYH A;  2I81 A;  4EIP A;  1EV9 A;  3UOM A;  4DSS A;  2LEG A;  5HFI A;  2IL3 A;  3LWA A;  4IHU A;  2BTO T;  5HQP A;  1ERU A;  1V9W A;  2VD1 A;  3BCK A;  1YZX A;  5HR3 A;  3VWU A;  5B7C A;  4OWY A;  3KH7 A;  2GLR A;  2LNS A;  1M2D A;  4FYU A;  2V2G A;  3GRX A;  3RPP A;  5DAL A;  2EIR A;  2PPT A;  4KCE A;  1V57 A;  1UC7 A;  3GKX A;  5HFK A;  3HZ4 A;  1HD2 A;  5KEJ A;  2GT6 A;  3Q19 A;  2I1U A;  1ZYQ B;  3QAG A;  3EMX A;  1RW1 A;  1PRX A;  2DIZ A;  4ILF A;  3F0I A;  2C0F A;  1FAA A;  3TOU A;  2IFQ A;  4G19 A;  4G0L A;  3H1N A;  1GUH A;  3EU3 A;  5DQY A;  1WJK A;  1F37 A;  5JCG A;  3GHA A;  3TKP A;  2M46 A;  1T4Z A;  1BG5 A;  5FT3 A;  1Q98 A;  3C8E A;  2TIR A;  1SK1 A;  3ME8 A;  4I2U A;  3EUR A;  6GSV A;  2HZE A;  1VF2 A;  3TGZ A;  1RK4 A;  5GAP D;  4DEJ A;  2MYG A;  4OMV A;  2A4H A;  3H4K A;  2L6C A;  3HKR A;  2DJ3 A;  4RI7 A;  2PER A;  2VD0 A;  3C1S A;  3FHK A;  1VF3 A;  22GS A;  2H1G A;  3ZRE A;  1AXD A;  3L9V A;  4HQZ A;  2ON5 A;  4G2E A;  2MMZ A;  2WFC A;  2MBT A;  1R7H A;  3HY2 A;  3IC8 A;  1AQV A;  1OC8 A;  2H71 A;  5EVO A;  4NAX A;  1SKS B;  4PX1 A;  4YQM A;  3HD5 A;  1U3A A;  5E4W A;  3U6V A;  1MEK A;  3MNG A;  3AY8 A;  4G9H A;  3F6D A;  5D9V A;  3IR4 A;  3WYW A;  1U6T A;  1Y25 A;  2HZF A;  2IN3 A;  2K8V A;  1UVZ A;  2C3N A;  4GSN A;  5ECH B;  3G7J A;  4K7I A;  1VF1 A;  2YNX A;  2F51 A;  4OCE A;  2H0I A;  1JZD A;  2CVD A;  2J23 A;  3NIV A;  4AJ8 A;  2LUS A;  4MF6 A;  2D2Z A;  2GST A;  3C73 A;  1HQO A;  3UJ1 A;  1XVW A;  2X8C A;  5DQS A;  5F06 A;  3D5J A;  4Q5F A;  4ZB9 A;  4YKG A;  5CRW A;  4HJM A;  1AQW A;  1BX9 A;  4IW9 A;  5ECM B;  1H75 A;  3KMN A;  3GYK A;  4XCS A;  2FD3 A;  2LJR A;  3IK9 A;  4IKH A;  1JZW A;  1TP9 A;  4KAE A;  1O8X A;  1SKR B;  2MMN A;  3G7Y A;  4JZQ A;  3GH6 A;  2F9S A;  3L4N A;  2FHE A;  1QQ2 A;  2YV9 A;  2A2P A;  1SJI A;  4MNN A;  5LD0 A;  2HRN A;  2BMX A;  3Q74 A;  3ZL5 A;  1EP7 A;  5DCH A;  2KP2 A;  1PX6 A;  4RQX A;  2H72 A;  1YKC A;  3F3R A;  2L4Q A;  1EP8 A;  1O73 A;  5D9T A;  3DWV A;  2L57 A;  2C0E A;  3DGQ A;  3O76 A;  3A2W A;  4HUA A;  2B5Y A;  2YV7 A;  1KBN A;  1OAZ A;  4GQC A;  4HJ2 A;  2VM1 A;  4ZL8 A;  3A5I A;  4N11 A;  3KMO A;  4GXZ A;  2FWF A;  2IIY A;  4MK3 A;  1EEM A;  3IBH A;  4XS4 B;  4ZIL A;  4XS6 A;  2VCT A;  2B3S A;  2DJJ A;  2EIQ A;  2HRK A;  4O5Q A;  2V1M A;  3QDN A;  1S3R A;  4I5Q A;  3VUR A;  3RAZ A;  3LXZ A;  2R5G A;  4YH2 A;  2VL9 A;  1O81 A;  4RUV A;  4V2N A;  4P3Y B;  2FUG 2;  1F9M A;  2LRT A;  4BVY A;  1W4V A;  4NHZ A;  4MPG A;  1O7U A;  1GSS A;  4TXO B;  3G9B A;  4TOP A;  3TKS E;  6GST A;  4OO4 A;  1GSD A;  1PN0 A;  3GL5 A;  3E9J B;  3UEM A;  2NTO A;  4V1A g;  5JCU A;  4HZ4 A;  3KCM A;  4ZBB A;  2H01 A;  2H30 A;  2LRN A;  4MF5 A;  1S3C A;  2IMD A;  3GX8 A;  1MDK A;  2ZCT A;  1E2Y A;  2YOI A;  1KTE A;  3ZRD A;  5GST A;  3TJF A;  2FCH A;  3FR9 A;  3GSS A;  3LOR A;  3IRA A;  3WGE A;  3GST A;  1Z6M A;  2WCI A;  4L5O A;  1BYE A;  1EZK A;  2H1A A;  3UBK A;  4IP6 A;  1W89 A;  5F07 A;  4EF0 A;  13GS A;  3FEU A;  1R4W A;  3KTL A;  2FWG A;  1VRS D;  2FWE A;  4Z2U A;  4LL1 B;  2H1B A;  4MA9 A;  2XBI A;  3VLN A;  5IMZ A;  6GSY A;  4KCA A;  3GUS A;  4ZL9 A;  2WS2 A;  4KA0 A;  4YKF A;  3R3E A;  9GSS A;  1NHO A;  3C1R A;  1YQ1 A;  2V6K A;  3ED3 A;  4GF0 A;  4PTS A;  3F63 A;  3P7X A;  2B5E A;  5CO3 A;  3NZN A;  1AQX A;  2NBS A;  3UBL A;  3QFA C;  4F03 A;  4OD7 A;  4K8M A;  2L5O A;  1Z3E A;  1O85 A;  2IMF A;  3GFK A;  4JR4 A;  3A2X A;  3IAS 2;  3ZFB A;  3IAM 2;  4MJC A;  1FB6 A;  2HRF A;  5F0G A;  1Y6E A;  1GSE A;  2B1K A;  1K0M A;  4O92 A;  1ZYE A;  2JSY A;  5ECS A;  19GS A;  2XC2 A;  3SWL A;  3VWW A;  1FVK A;  1DBY A;  3MAK A;  20GS A;  1PQN A;  1GNE A;  3QAV A;  1AAZ A;  1OKD A;  1V2A A;  3QR6 A;  4GTU A;  2IMI A;  11GS A;  1GLP A;  2OE0 A;  4KX4 A;  2FLS A;  12GS A;  1EOH A;  2LS5 A;  4XIH A;  3TOT A;  1TI3 A;  1TW9 A;  4ZL7 A;  4EXJ A;  3EWL A;  2I9H A;  4TXV A;  1MD3 A;  1ERV A;  5HR0 A;  4LA1 A;  2KOK A;  3DXB A;  4EUY A;  4TXO A;  1PKW A;  7GSS A;  4JU5 A;  1PL2 A;  1Z6N A;  2B6M A;  3APS A;  3IHQ A;  4BVX A;  1XW5 A;  3IC4 A;  2EC4 A;  4KSM A;  5J4U A;  1WMJ A;  3CSH A;  1T3B A;  2A4V A;  1PSQ A;  4NV5 A;  3CQF A;  16GS A;  3KIJ A;  1ERT A;  2R0C A;  1WWJ A;  4PUR A;  5DBQ A;  2R0P A;  1ZOF A;  1HNC A;  2JZS A;  2GZZ A;  5IIZ A;  2GQK A;  3CXG A;  4MJB A;  2GQL A;  1CQG A;  3M1G A;  1IYI A;  3PPU A;  4L0U A;  2RUF A;  4JR6 A;  5D93 A;  3ZIJ A;  1G7O A;  2RII A;  3JCM L;  1DE1 A;  1PL1 A;  1GLQ A;  3TKQ A;  4NXI A;  1NSW A;  4ULX A;  2GGT A;  2JL4 A;  3KJY A;  1M0U A;  2GVP A;  1EEJ A;  4ZIJ A;  4MF7 A;  3O6T A;  4IS0 A;  4I8B A;  3F4T A;  1T00 A;  3W8S A;  3MDK A;  3IXR A;  5AN1 A;  4MCU A;  4NMU A;  1S3A A;  5ECP B;  4D73 A;  1X9S B;  4MP4 A;  4POB A;  3ZZX A;  4FH8 A;  4ZBA A;  2E7P A;  1A0R P;  1FHE A;  4WET A;  4WEY A;  1TRS A;  2OJL A;  2LRC A;  2H66 A;  2PUK C;  2WZ9 A;  4QQ7 A;  1WE0 A;  5ENU A;  17GS A;  3KD0 A;  1SL2 B;  2ALB A;  4Q5R A;  3H8Q A;  3DEX A;  3M3M A;  3FY7 A;  1WP0 A;  2VUP A;  2CV4 A;  3LQ7 A;  2WB9 A;  5ECO B;  3C7M A;  6GSU A;  3FRC A;  1WPI A;  2FGX A;  3L78 A;  4K0N A;  2VAF A;  2H1D A;  4LMW A;  2L4C A;  2VO4 A;  4TRX A;  1M7T A;  2L5L A;  1S3D A;  5A4U A;  3E0U A;  3DYR A;  4FIW A;  1URM A;  4AJ6 A;  2V41 A;  2H70 A;  1K3L A;  4HI7 A;  5ID2 A;  2M80 A;  2YCD A;  1HNB A;  3FZ4 A;  1K0O A;  1SYR A;  5IOX A;  5DAK A;  2GQM A;  1XWG A;  10GS A;  1JLW A;  4IVF A;  1GTU A;  2X99 A;  1MTC A;  3I6A A;  1K3O A;  1FO5 A;  3CTG A;  4MH3 A;  3VFI A;  2H76 A;  1LJR A;  2HRA A;  5LNK e;  1TK0 B;  3ERW A;  3V1W A;  3HCZ A;  2R4V A;  3LFL A;  4HQS A;  1R5P A;  4GST A;  4MZC A;  1TRW A;  3UVT A;  5G5F A;  4PGT A;  4TVE A;  2NDO A;  2WGR A;  4OCF A;  5ECL B;  4EIQ A;  4GSS A;  3FKF A;  2DJ2 A;  2QGV A;  1VGL A;  3LGC A;  3FW2 A;  1I5G A;  3I43 A;  2O87 A;  5IM9 A;  4NPB A;  4GLT A;  3D21 A;  4WBJ A;  1GUM A;  1FVJ A;  4IJ3 A;  3RHC A;  5COH A;  5IO2 A;  4GRF A;  4I6X A;  3KXO A;  1Z7P A;  2YPM A;  2VL3 A;  1B9X C;  2C1Y A;  4KB3 A;  4WF4 A;  3TRX A;  3DKS A;  1X9W B;  1U88 A;  1MD4 A;  1OC9 B;  2E2G A;  2C3T A;  1V58 A;  1A23 A;  4AGS A;  4HZ2 A;  3LG6 A;  4Q5N A;  1EOG A;  2PU9 C;  4Z7X A;  5G5E A;  5JWR B;  1SKW B;  4N0V A;  4L5L A;  1F6M C;  2OBI A;  5B6M A;  1E6B A;  3QFB C;  4EO3 A;  3TKS C;  1FB0 A;  2N5F A;  5KOX A;  1YY7 A;  1NHY A;  5CAX A;  2DJ1 A;  2XBQ A;  2YZH A;  5E59 A;  1ILO A; 
#chains in the Genus database with same CATH homology
 4BA7 A;  3EMP A;  1YDK A;  3BOA A;  3CSJ A;  4POK A;  1PKZ A;  4DSR A;  1AC1 A;  1U3I A;  1ZL9 A;  1F2E A;  5FHI A;  1QUW A;  2B5X A;  4CY6 A;  2VCW A;  1SK0 A;  3PGT A;  3BBY A;  1TTZ A;  3TKR A;  1V40 A;  3TJJ A;  2CA8 A;  3GNJ A;  1SEN A;  4TR1 B;  2GSR A;  2DLX A;  3F4R A;  5HFG A;  4FO5 A;  2GTU A;  3MIX A;  4LL4 B;  4J2F A;  2VOC A;  1TJD A;  4QL9 A;  3ZLP A;  5L71 A;  5IPH A;  3TB2 A;  1G0T A;  3G7I A;  1B9Y C;  1XIY A;  5EPF A;  1ON4 A;  4F82 A;  1A0F A;  3PR8 A;  4ZB8 A;  1CQH A;  3F4S A;  2OE1 A;  4EKZ A;  3APQ A;  4E8E A;  3VWX A;  1R5A A;  2FA4 A;  2VLT A;  2VL2 A;  4O7H A;  4EDZ A;  2M72 A;  2O85 A;  1SJZ A;  2IME A;  2JSZ A;  3DML A;  3M8N A;  3CYN A;  2AYT A;  2REM A;  1GTA A;  2CX3 A;  3GV1 A;  4Q5Q A;  3EC3 A;  4V2L A;  5DVB A;  3FMW A;  2VLV A;  1YF0 A;  1J08 A;  1EWX A;  4OFT A;  3FZ5 A;  4A5P A;  4IN0 A;  2CQ9 A;  1SD8 A;  2PVQ A;  3LYP A;  1AIU A;  3W6G A;  5B6N A;  3OR5 A;  1NM3 A;  1A8L A;  2OAD A;  2K8S A;  4ML1 A;  4K0G A;  2Z9S A;  3GTU B;  1JFU A;  2H0G A;  3GN3 A;  4HS1 A;  2FA8 A;  3E3E A;  3MWH A;  3D0Z A;  4X0X A;  4J57 E;  3FZ9 A;  4NWY A;  1PMT A;  2H73 A;  1GL8 A;  4GWR A;  1A2J A;  4H86 A;  3TJG A;  2X64 A;  2ZNM A;  3Q18 A;  1G6W A;  4CY8 A;  1X5C A;  1Z9H A;  3I9V 2;  3US3 A;  3UAR A;  2OBK A;  4HEA 2;  2F3M A;  2LNT A;  3GL3 A;  1HYU A;  2F8F A;  4HDE A;  3KGK A;  2QKE A;  4K9Z A;  4YQV A;  2GZY A;  2WDU A;  1M9A A;  4BWQ A;  4DVC A;  3CTF A;  2RUE A;  2JAC A;  2IWT A;  1SL1 B;  2C3Q A;  5G1L A;  4BL7 B;  5G2Z A;  1XWB A;  4PQI A;  1XW6 A;  5ECI B;  2YJ7 A;  4CW9 A;  5AIX A;  5INY A;  2H74 A;  1PGT A;  1K0C A;  1M99 A;  2HT9 A;  3QOU A;  5IPG A;  4KSO A;  2QA2 A;  4L0W A;  4K7O A;  5HR2 A;  4Z2T A;  5D9X A;  1DE2 A;  2HLS A;  1OVN A;  3IV4 A;  3GX0 A;  3HVS A;  5H5R A;  3TJK A;  1TK5 B;  5BRT A;  3R2Q A;  5GAN D;  1FG4 A;  4TR1 A;  2E2M A;  1TU7 A;  5D9W A;  2VM2 A;  1GTB A;  2PWJ A;  1QXH A;  2RM6 A;  4HU9 A;  1GSQ A;  3DD3 A;  4N30 A;  1V98 A;  3FR6 A;  2PN8 A;  5CRE A;  3RHB A;  4DSS B;  4XS4 A;  3W8J A;  1XZO A;  2R0G A;  3MSZ A;  2LJK A;  5J5N A;  1K0B A;  5FWG A;  2R3X A;  3O3T A;  2E0Q A;  3HHV A;  1J0F A;  4JRR A;  5CRD A;  4KGI A;  3KP9 A;  2YWN A;  3BD2 A;  1WRY A;  2IMK A;  1UA5 A;  3CRT A;  5CRH A;  1BQ7 A;  4JED A;  4MAB A;  5J3R A;  2CVK A;  5DAL B;  4OFM A;  4BWS A;  3KH9 A;  3QMX A;  5EL8 A;  4XS1 A;  5CP1 A;  3DRN A;  1TRV A;  3IOS A;  3HVX A;  5H5S A;  2YWO A;  2VIM A;  1M9B A;  3ZMK A;  1TRU A;  1GTI A;  2FY6 A;  2IFQ B;  3M9J A;  4PQH A;  3IE3 A;  2HYX A;  3IA1 A;  3KZQ A;  4POL A;  4CDO A;  3QD9 A;  4ECI A;  2XPD A;  3NOF A;  4KF9 A;  2O7K A;  4ICY A;  2GSQ A;  1DSB A;  2HZE B;  2H75 A;  3M0F A;  5JCW A;  5IMC A;  1SD9 A;  4EC0 A;  4MDC A;  4TN8 A;  2B1L A;  4G10 A;  2MMO A;  1O8W A;  2RLI A;  2C8U A;  5G1K A;  3KP8 A;  4ECJ A;  1X5E A;  8GSS A;  1ZYN A;  4ML6 A;  4PUF C;  4EDY A;  3F8U A;  1KEB A;  2B7K A;  4TR4 A;  1QMV A;  4G0K A;  2YP6 A;  1UN2 A;  5GSS A;  2CZ3 A;  5DJM A;  1F3A A;  3WT1 A;  4XRD A;  4IBP A;  4ZBD A;  3RDW A;  1TDI A;  5JWO B;  1OE7 A;  1M2B A;  3DVX A;  3D4T A;  5HR1 A;  4O32 A;  3P90 A;  3TRP A;  2XHF A;  1EGO A;  2KLX A;  4QL7 A;  1BED A;  1ZGN A;  2MMA A;  2FWH A;  4V1A p;  2VCX A;  2KUC A;  4I2T A;  2P5Q A;  3GKK A;  5IMA A;  1YKA A;  2O8V B;  2GT5 A;  3IPZ A;  2X4A A;  4IJI A;  1THX A;  4ACS A;  2WJU A;  3WGX A;  1LU4 A;  4IQ1 A;  4L8E A;  5IQY A;  4IGJ A;  2C0G A;  2AHE A;  2P5R A;  3CSI A;  1TXX A;  3FZA A;  4XHM A;  4F0B A;  4XRA A;  4GCI A;  5ECK B;  4TKY A;  3EPT A;  5IMD A;  1SYX A;  3SBC A;  5DDL A;  1QGV A;  2CX4 A;  3UVH A;  3ISO A;  2JZR A;  2AUV A;  2YWI A;  1XVQ A;  1THO A;  4DSQ A;  5J41 A;  1KNG A;  2DJK A;  3H79 A;  3ZVJ A;  1PN9 A;  5KN3 A;  5A4W A;  3S9F A;  2JAD A;  14GS A;  2JU5 A;  4MJE A;  1RQM A;  2ON7 A;  4AF2 A;  4YQU A;  3CMI A;  1JLV A;  2RM5 A;  2DSA A;  2K6V A;  4K7N A;  1PA3 A;  3HXS A;  3CBU A;  4KUN A;  1N8J A;  1T7P B;  3C71 A;  4Z2R A;  5KN1 A;  2N5A A;  1XOA A;  1YJ6 A;  2NPB A;  2OKA A;  3ERG A;  2QC7 A;  1Z5Y E;  1G7E A;  3EVI A;  1A8Y A;  2LQQ A;  3EYT A;  1Z7R A;  3BJ5 A;  1X5D A;  5ECQ B;  3HVV A;  3HJM A;  3GKM A;  2X8G A;  4WF5 A;  3BCI A;  4PXO A;  1ST9 A;  2OE3 A;  2LJA A;  5C04 A;  5D96 A;  3GMF A;  4BVY B;  1JZO A;  4BPY A;  2LTK A;  2PBJ A;  3EE2 A;  4K2D A;  5AIS A;  1YF1 A;  4EL1 A;  3J7Y k;  3A5W A;  2YWM A;  4PNG A;  1YEX A;  3F3Q A;  3TRQ A;  4ECB A;  3ERF A;  2NVL A;  4E8H A;  3F9U A;  5ECR B;  5F8B A;  2G0F A;  1GUL A;  4IEL A;  4ECC A;  4PNF A;  2VCV A;  1LBK A;  5KN0 A;  4MPF A;  1B48 A;  4JBB A;  1XWC A;  3APO A;  3A2V A;  1FOH A;  4YAV A;  5IO0 A;  1T8E B;  2LV3 A;  5ABR A;  2OA7 A;  2X8H A;  3HDC A;  5D73 A;  2H0H A;  2H6Z A;  5DJL A;  2AJQ B;  5B8A A;  1K0N A;  4FQU A;  4RQR A;  1K0D A;  1GSU A;  4MH2 A;  5ELG A;  2GSS A;  4HOJ A;  4X43 A;  2VCQ A;  4FYB A;  3LJR A;  4ZB6 A;  2K18 A;  4ZXG A;  2HE3 A;  2QA1 A;  2AAW A;  1MDJ A;  1SU9 A;  1WOU A;  3I69 A;  3ME7 A;  2OAC A;  1VF4 A;  2HFD A;  5IOW A;  4MZW A;  3GUR A;  2DML A;  4KE3 A;  2A2S A;  3EIN A;  5C00 A;  5A5K A;  1GSY A;  3N9J A;  2L6D A;  5J9B A;  3GIX A;  4K6X A;  4POM A;  4MZB A;  5B8B A;  2O89 A;  4KW6 A;  4PUA A;  1H4O A;  4F0C A;  3VWV A;  4TR0 A;  1SK2 A;  4OFN A;  1A2L A;  1K0A A;  3GH9 A;  2ES7 A;  4WR5 A;  4N0Z A;  2I4A A;  1GUK A;  1A2M A;  2VCZ A;  1AUC A;  1EV4 A;  3DIE A;  3LSZ A;  3LXT A;  1MDI A;  3GKN A;  2YN1 A;  4ISD A;  1SJ6 A;  1XXU A;  2VLU A;  6GSW A;  3HZ8 A;  18GS A;  1OKT A;  1Q4J A;  4MLY A;  3HJP A;  2IPA A;  2H6X A;  3PH9 A;  4EVM A;  4KH7 A;  4V2M A;  3DVW A;  3UIW A;  3RBT A;  4LMV A;  3K8N A;  2PMT A;  2AB6 A;  1X9M B;  2PGT A;  4X1U A;  3UAP A;  1OC9 A;  3VPQ A;  3P2A A;  5A4V A;  3LW9 A;  4BVX B;  2JZT A;  2TRC P;  4NHW A;  2HSM A;  3QAW A;  4K1F A;  2ZUP A;  4FYC A;  4OO5 A;  1N2A A;  2EIO A;  3KEB A;  3VI5 A;  2QSI A;  2DMM A;  4I97 A;  4N10 A;  2A2R A;  1TI1 A;  4WXT A;  1ZYP A;  2GZP A;  2UZ8 A;  4RI6 A;  2GS3 A;  3VPT A;  3Q6O A;  3TDG A;  2C80 A;  1JZR A;  1JHB A;  2CVB A;  5GZZ B;  1YEP A;  2DKI A;  2R37 A;  5H5Q A;  4K2X A;  1BJX A;  3ZIT A;  1B8X A;  2HNL A;  3RPN A;  1C72 A;  1NW2 A;  1XOB A;  5AIV A;  3GA4 A;  1M2A A;  2HXK A;  2MZC A;  3HJO A;  4K5S A;  1ABA A;  3WT2 A;  2HI7 A;  4IQA A;  4AJ7 A;  3EU4 A;  4O5R A;  1TOF A;  1GNW A;  1GH2 A;  4TR3 A;  4K5R A;  4MMM A;  5BMU A;  2YZU A;  3J7Y b;  3QCP A;  2J9H A;  3LYK A;  5AGY A;  5CYY A;  1J9B A;  2F8A A;  4D73 B;  1I9D A;  3L9S A;  1XCC A;  1XWA A;  1HNA A;  4O5U A;  2CZ2 A;  1F3B A;  4EE0 A;  2B7J A;  2FNO A;  2V32 A;  4USS A;  1G6Y A;  2H6Y A;  1PD2 1;  2HSY A;  3WGD A;  3D4M A;  1A24 A;  1FOV A;  1B4P A;  3CRU A;  4WKW A;  5CRG A;  2I3Y A;  1XW9 A;  2G2Q A;  1FW1 A;  3FR3 A;  1EGR A;  3VI7 A;  3WD6 A;  1TKD B;  1K3Y A;  2AV4 A;  4LLR A;  1ML6 A;  4F9Z A;  4WBR D;  4HU7 A;  4KDY A;  1BAY A;  5F05 A;  1AW9 A;  3TCO A;  1U87 A;  1USB A;  2K9F A;  3U5R E;  2H8L A;  1DUG A;  2IJY A;  1XPV A;  1GSF A;  3ZTL A;  4ID0 A;  3D6I A;  3VK9 A;  3UMA A;  5DCG A;  2WUL A;  2C0D A;  5IMF A;  5ID2 B;  2V6O A;  1ZMA A;  3H93 A;  3FYG A;  5DAK B;  2P0G A;  3L9U A;  2BJX A;  3LEF A;  1R26 A;  5LCZ A;  3IDV A;  5KN2 A;  3GTU A;  1ZCP A;  5KOW A;  2YJH A;  2N5B A;  5G31 A;  2LKU A;  2DKH A;  3MYD A;  1PX7 A;  4PQ1 A;  2HSH A;  1SL0 B;  4XTS A;  4IP1 A;  2VL2 C;  1X0R A;  5J9C A;  1ZZY A;  5JWQ B;  1GWC A;  1QK8 A;  2CAQ A;  2TRX A;  3F6F A;  3A3T A;  3QPM A;  5ECN B;  5EY6 A;  3KTB A;  3P8W A;  3TKS A;  2KHP A;  3L0H A;  4YAP A;  3ZML A;  3UL3 A;  2R2J A;  2XPE A;  4BL7 A;  1OYJ A;  3HYP A;  1GRX A;  3IHG A;  6GSX A;  3ZYW A;  3KM6 A;  4WR4 A;  3FK8 A;  2LQO A;  2CT6 A;  4F2I A;  2C4J A;  1TK8 B;  3ZFL A;  4CHS A;  2PVO C;  2KP1 A;  4J56 E;  6GSS A;  3TJB A;  2CAI A;  5CNW A;  4KND A;  1T1V A;  1T4Y A;  4X4J A;  2LST A;  5G30 A;  4NV2 A;  1XBS A;  2H19 A;  1QFN A;  2DJ0 A;  2DC5 A;  3N5O A;  4MJA A;  4KDU A;  3PIN A;  4TW5 A;  2X49 A;  1ERW A;  3M9K A;  4KDX A;  5IMV A;  4G0I A;  3IK7 A;  4JE1 A;  1TU8 A;  3D22 A;  2WRT A;  2L59 A;  2DIY A;  1OE8 A;  2R6K A;  2DBC A;  1B4Q A;  2MBS A;  5D8I A;  1XFL A;  3TUE A;  3HA9 A;  1O6J A;  2P31 A;  1GP1 A;  1ACV A;  3ZVJ D;  5ELA A;  1XWK A;  1OC3 A;  2YAN A;  4GQF A;  1WIK A;  2GDR A;  3ZIV A;  1IYH A;  2I81 A;  4EIP A;  1EV9 A;  3UOM A;  4DSS A;  2LEG A;  5HFI A;  2IL3 A;  3LWA A;  4IHU A;  2BTO T;  5HQP A;  1ERU A;  1V9W A;  2VD1 A;  3BCK A;  1YZX A;  5HR3 A;  3VWU A;  5B7C A;  4OWY A;  3KH7 A;  2GLR A;  2LNS A;  1M2D A;  4FYU A;  2V2G A;  3GRX A;  3RPP A;  5DAL A;  2EIR A;  2PPT A;  4KCE A;  1V57 A;  1UC7 A;  3GKX A;  5HFK A;  3HZ4 A;  1HD2 A;  5KEJ A;  2GT6 A;  3Q19 A;  2I1U A;  1ZYQ B;  3QAG A;  3EMX A;  1RW1 A;  1PRX A;  2DIZ A;  4ILF A;  3F0I A;  2C0F A;  1FAA A;  3TOU A;  2IFQ A;  4G19 A;  4G0L A;  3H1N A;  1GUH A;  3EU3 A;  5DQY A;  1WJK A;  1F37 A;  5JCG A;  3GHA A;  3TKP A;  2M46 A;  1T4Z A;  1BG5 A;  5FT3 A;  1Q98 A;  3C8E A;  2TIR A;  1SK1 A;  3ME8 A;  4I2U A;  3EUR A;  6GSV A;  2HZE A;  1VF2 A;  3TGZ A;  1RK4 A;  5GAP D;  4DEJ A;  2MYG A;  4OMV A;  2A4H A;  3H4K A;  2L6C A;  3HKR A;  2DJ3 A;  4RI7 A;  2PER A;  2VD0 A;  3C1S A;  3FHK A;  1VF3 A;  22GS A;  2H1G A;  3ZRE A;  1AXD A;  3L9V A;  4HQZ A;  2ON5 A;  4G2E A;  2MMZ A;  2WFC A;  2MBT A;  1R7H A;  3HY2 A;  3IC8 A;  1AQV A;  1OC8 A;  2H71 A;  5EVO A;  4NAX A;  1SKS B;  4PX1 A;  4YQM A;  3HD5 A;  1U3A A;  5E4W A;  3U6V A;  1MEK A;  3MNG A;  3AY8 A;  4G9H A;  3F6D A;  5D9V A;  3IR4 A;  3WYW A;  1U6T A;  1Y25 A;  2HZF A;  2IN3 A;  2K8V A;  1UVZ A;  2C3N A;  4GSN A;  5ECH B;  3G7J A;  4K7I A;  1VF1 A;  2YNX A;  2F51 A;  4OCE A;  2H0I A;  1JZD A;  2CVD A;  2J23 A;  3NIV A;  4AJ8 A;  2LUS A;  4MF6 A;  2D2Z A;  2GST A;  3C73 A;  1HQO A;  3UJ1 A;  1XVW A;  2X8C A;  5DQS A;  5F06 A;  3D5J A;  4Q5F A;  4ZB9 A;  4YKG A;  5CRW A;  4HJM A;  1AQW A;  1BX9 A;  4IW9 A;  5ECM B;  1H75 A;  3KMN A;  3GYK A;  4XCS A;  2FD3 A;  2LJR A;  3IK9 A;  4IKH A;  1JZW A;  1TP9 A;  4KAE A;  1O8X A;  1SKR B;  2MMN A;  3G7Y A;  4JZQ A;  3GH6 A;  2F9S A;  3L4N A;  2FHE A;  1QQ2 A;  2YV9 A;  2A2P A;  1SJI A;  4MNN A;  5LD0 A;  2HRN A;  2BMX A;  3Q74 A;  3ZL5 A;  1EP7 A;  5DCH A;  2KP2 A;  1PX6 A;  4RQX A;  2H72 A;  1YKC A;  3F3R A;  2L4Q A;  1EP8 A;  1O73 A;  5D9T A;  3DWV A;  2L57 A;  2C0E A;  3DGQ A;  3O76 A;  3A2W A;  4HUA A;  2B5Y A;  2YV7 A;  1KBN A;  1OAZ A;  4GQC A;  4HJ2 A;  2VM1 A;  4ZL8 A;  3A5I A;  4N11 A;  3KMO A;  4GXZ A;  2FWF A;  2IIY A;  4MK3 A;  1EEM A;  3IBH A;  4XS4 B;  4ZIL A;  4XS6 A;  2VCT A;  2B3S A;  2DJJ A;  2EIQ A;  2HRK A;  4O5Q A;  2V1M A;  3QDN A;  4I5Q A;  3VUR A;  3RAZ A;  3LXZ A;  2R5G A;  4YH2 A;  2VL9 A;  1O81 A;  4RUV A;  4V2N A;  4P3Y B;  2FUG 2;  1F9M A;  2LRT A;  4BVY A;  1W4V A;  4NHZ A;  4MPG A;  1O7U A;  1GSS A;  4TXO B;  3G9B A;  4TOP A;  3TKS E;  6GST A;  4OO4 A;  1GSD A;  1PN0 A;  3GL5 A;  3E9J B;  3UEM A;  2NTO A;  4V1A g;  5JCU A;  4HZ4 A;  3KCM A;  4ZBB A;  2H01 A;  2H30 A;  2LRN A;  4MF5 A;  1S3C A;  2IMD A;  3GX8 A;  1MDK A;  2ZCT A;  1E2Y A;  2YOI A;  1KTE A;  3ZRD A;  5GST A;  3TJF A;  2FCH A;  3FR9 A;  3GSS A;  3LOR A;  3IRA A;  3WGE A;  3GST A;  1Z6M A;  2WCI A;  4L5O A;  1BYE A;  1EZK A;  2H1A A;  3UBK A;  4IP6 A;  1W89 A;  5F07 A;  4EF0 A;  13GS A;  3FEU A;  1R4W A;  3KTL A;  2FWG A;  1VRS D;  2FWE A;  4Z2U A;  4LL1 B;  2H1B A;  4MA9 A;  2XBI A;  3VLN A;  5IMZ A;  6GSY A;  4KCA A;  3GUS A;  4ZL9 A;  2WS2 A;  4KA0 A;  4YKF A;  3R3E A;  9GSS A;  1NHO A;  3C1R A;  1YQ1 A;  2V6K A;  3ED3 A;  4GF0 A;  4PTS A;  3F63 A;  3P7X A;  2B5E A;  5CO3 A;  3NZN A;  1AQX A;  2NBS A;  3UBL A;  3QFA C;  4F03 A;  4OD7 A;  4K8M A;  2L5O A;  1Z3E A;  1O85 A;  2IMF A;  3GFK A;  4JR4 A;  3A2X A;  3IAS 2;  3ZFB A;  3IAM 2;  4MJC A;  1FB6 A;  2HRF A;  5F0G A;  1Y6E A;  1GSE A;  2B1K A;  1K0M A;  4O92 A;  1ZYE A;  2JSY A;  5ECS A;  19GS A;  2XC2 A;  3SWL A;  3VWW A;  1FVK A;  1DBY A;  3MAK A;  20GS A;  1PQN A;  1GNE A;  3QAV A;  1AAZ A;  1OKD A;  1V2A A;  3QR6 A;  4GTU A;  2IMI A;  11GS A;  1GLP A;  2OE0 A;  4KX4 A;  2FLS A;  12GS A;  1EOH A;  2LS5 A;  4XIH A;  3TOT A;  1TI3 A;  1TW9 A;  4ZL7 A;  4EXJ A;  3EWL A;  2I9H A;  4TXV A;  1MD3 A;  1ERV A;  5HR0 A;  4LA1 A;  2KOK A;  3DXB A;  4EUY A;  4TXO A;  1PKW A;  7GSS A;  4JU5 A;  1PL2 A;  1Z6N A;  2B6M A;  3APS A;  3IHQ A;  4BVX A;  1XW5 A;  3IC4 A;  2EC4 A;  4KSM A;  5J4U A;  1WMJ A;  3CSH A;  1T3B A;  2A4V A;  1PSQ A;  4NV5 A;  16GS A;  3KIJ A;  1ERT A;  2R0C A;  1WWJ A;  4PUR A;  5DBQ A;  2R0P A;  1ZOF A;  1HNC A;  2JZS A;  2GZZ A;  5IIZ A;  2GQK A;  3CXG A;  4MJB A;  2GQL A;  1CQG A;  3M1G A;  1IYI A;  3PPU A;  4L0U A;  2RUF A;  4JR6 A;  5D93 A;  3ZIJ A;  1G7O A;  2RII A;  3JCM L;  1DE1 A;  1PL1 A;  1GLQ A;  3TKQ A;  4NXI A;  1NSW A;  4ULX A;  2GGT A;  2JL4 A;  3KJY A;  1M0U A;  2GVP A;  1EEJ A;  4ZIJ A;  4MF7 A;  3O6T A;  4IS0 A;  4I8B A;  3F4T A;  1T00 A;  3W8S A;  3MDK A;  3IXR A;  5AN1 A;  4MCU A;  4NMU A;  1S3A A;  5ECP B;  4D73 A;  1X9S B;  4MP4 A;  4POB A;  3ZZX A;  4FH8 A;  4ZBA A;  2E7P A;  1A0R P;  1FHE A;  4WET A;  4WEY A;  1TRS A;  2OJL A;  2LRC A;  2H66 A;  2PUK C;  2WZ9 A;  4QQ7 A;  1WE0 A;  5ENU A;  17GS A;  3KD0 A;  1SL2 B;  2ALB A;  4Q5R A;  3H8Q A;  3DEX A;  3M3M A;  3FY7 A;  1WP0 A;  2VUP A;  2CV4 A;  3LQ7 A;  2WB9 A;  5ECO B;  3C7M A;  6GSU A;  3FRC A;  1WPI A;  2FGX A;  3L78 A;  4K0N A;  2VAF A;  2H1D A;  4LMW A;  2L4C A;  2VO4 A;  4TRX A;  1M7T A;  2L5L A;  1S3D A;  5A4U A;  3E0U A;  3DYR A;  4FIW A;  1URM A;  4AJ6 A;  2V41 A;  2H70 A;  1K3L A;  4HI7 A;  5ID2 A;  2M80 A;  2YCD A;  1HNB A;  3FZ4 A;  1K0O A;  1SYR A;  5IOX A;  5DAK A;  2GQM A;  1XWG A;  10GS A;  1JLW A;  4IVF A;  1GTU A;  2X99 A;  1MTC A;  3I6A A;  1K3O A;  1FO5 A;  3CTG A;  4MH3 A;  3VFI A;  2H76 A;  1LJR A;  2HRA A;  5LNK e;  1TK0 B;  3ERW A;  3V1W A;  3HCZ A;  2R4V A;  3LFL A;  4HQS A;  1R5P A;  4GST A;  4MZC A;  1TRW A;  3UVT A;  5G5F A;  4PGT A;  4TVE A;  2NDO A;  2WGR A;  4OCF A;  5ECL B;  4EIQ A;  4GSS A;  3FKF A;  2DJ2 A;  2QGV A;  1VGL A;  3LGC A;  3FW2 A;  1I5G A;  3I43 A;  2O87 A;  5IM9 A;  4NPB A;  4GLT A;  3D21 A;  4WBJ A;  1GUM A;  1FVJ A;  4IJ3 A;  3RHC A;  5COH A;  5IO2 A;  4GRF A;  4I6X A;  3KXO A;  1Z7P A;  2YPM A;  2VL3 A;  1B9X C;  2C1Y A;  4KB3 A;  4WF4 A;  3TRX A;  3DKS A;  1X9W B;  1U88 A;  1MD4 A;  1OC9 B;  2E2G A;  2C3T A;  1V58 A;  1A23 A;  4AGS A;  4HZ2 A;  3LG6 A;  4Q5N A;  1EOG A;  2PU9 C;  4Z7X A;  5G5E A;  5JWR B;  1SKW B;  4N0V A;  4L5L A;  1F6M C;  2OBI A;  5B6M A;  1E6B A;  3QFB C;  4EO3 A;  3TKS C;  1FB0 A;  2N5F A;  5KOX A;  1YY7 A;  1NHY A;  5CAX A;  2DJ1 A;  2XBQ A;  2YZH A;  5E59 A;  1ILO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...