5EPFA

Crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
153
Chain Sequence
HMKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVKQAKFAEVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin
publication title Crystal structure of Peroxidoxin BcpB from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Oxidoreductase
total genus 51
structure length 153
sequence length 154
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5epfA00
1GUMA 4PGTA 5GAPD 1GSFA 4ZILA 3NZNA 3ZFLA 4KNDA 2H8LA 1Z3EA 3HVSA 3RPNA 2YJHA 5J3RA 2C3NA 2DJ3A 5IMAA 2GZZA 5B6MA 3G9BA 2PBJA 3DD3A 2XPEA 3WYWA 2X8CA 3CMIA 5F05A 1OC3A 3L0HA 1GLQA 4ID0A 3U6VA 1MD4A 3UARA 3GL3A 4Q5FA 2YWMA 3IC4A 2VM2A 2P31A 3IK9A 3DRNA 4EKZA 5LD0A 1T3BA 1KEBA 2MMOA 4POMA 1EZKA 4HJ2A 2RLIA 1DE1A 1HD2A 4KSOA 1OKTA 5G2ZA 5B8BA 2HSYA 2LSTA 2DIZA 1GTUA 1TRSA 2E0QA 2F9SA 4V1Ag 5CRHA 3TKQA 1GSQA 2GQKA 3QAWA 1THOA 3GN3A 1F3AA 2DJ2A 1GTBA 4OO5A 3IOSA 2YNXA 3F4TA 5J9BA 4POKA 5B6NA 4X1UA 5J4UA 2XBIA 4O5RA 1J08A 3EURA 1G6YA 3ZZXA 2H0IA 4F2IA 1YZXA 2E2MA 9GSSA 3GA4A 4MJCA 4XS4A 1TJDA 1VGLA 4KDXA 2L6DA 1F3BA 4G2EA 4PQHA 3LJRA 3GHAA 3ZVJA 4AJ8A 2WZ9A 1GL8A 2VIMA 3VURA 4GTUA 1XOBA 2HT9A 3GX8A 2LJAA 3PH9A 5ECHB 3HDCA 2FA4A 3ZRDA 2FWEA 4ISDA 4YQMA 1ZGNA 3TB2A 1Z6MA 5KN0A 3D4MA 3GUSA 2CAQA 2CV4A 3VWUA 13GSA 1XIYA 1O8XA 2JU5A 1N8JA 3AY8A 3M8NA 3GYKA 3FZAA 1VF1A 4FIWA 2JZSA 1TDIA 3ISOA 5G1KA 3SBCA 1PMTA 4O32A 4Q5RA 1TOFA 2X64A 5D93A 3IAS2 2BJXA 4V1Ap 3GV1A 1OE7A 1ZOFA 2DIYA 4WBRD 2P5RA 3N5OA 2C3TA 3CSJA 1PL2A 1U88A 3HJMA 3ZTLA 1GSSA 2K9FA 4HJMA 2L59A 2H70A 2ON5A 3VWVA 4HU9A 1VF2A 5DVBA 1QFNA 4K0GA 3HJOA 2YV7A 1ABAA 3DMLA 4MDCA 2AAWA 1USBA 16GSA 3M1GA 3KEBA 4G9HA 2MMAA 3QPMA 3IBHA 2C0EA 2HFDA 3ZMKA 4ILFA 4OMVA 4HI7A 1TU8A 3LXTA 3C8EA 4IHUA 5ELAA 4WBJA 4MF6A 4DEJA 3IE3A 1G7EA 2OKAA 3LQ7A 4Q5NA 1Z9HA 2PVOC 1SKRB 3L9VA 4I2TA 5CRGA 1T00A 4AF2A 5IO2A 4GQFA 2JSYA 3IAM2 2VL3A 2M46A 2CVDA 2B7KA 2JZTA 4GCIA 3IHQA 3TJGA 2C0FA 3IXRA 1XWGA 1VRSD 3KZQA 1BJXA 4IJIA 2LJKA 3CBUA 1U87A 2YWOA 2R5GA 3PGTA 4BVXA 4NPBA 1ERVA 1X5CA 3I9V2 3DKSA 1MEKA 2JADA 2QGVA 1XVWA 1TK0B 4MZBA 3RPPA 1SKSB 1HNBA 3D5JA 3LGCA 4ZL8A 4YAPA 2VM1A 4JRRA 2L6CA 2FA8A 1TU7A 1K0OA 3LYKA 4QQ7A 3C1RA 2K8VA 1GSUA 2KP2A 1KNGA 3TKPA 4TXOA 4MJBA 7GSSA 1JHBA 2G0FA 4N10A 1XW5A 2KLXA 2V6KA 3J7Yb 1WJKA 3P7XA 2PPTA 2FWFA 3F6DA 5JCGA 3UBLA 3RAZA 3GH9A 2PWJA 1T4YA 1RW1A 4V2NA 1K0NA 5CP1A 3P8WA 1YY7A 2VL9A 4BWSA 4KDYA 1XZOA 4TW5A 1B9XC 4MZCA 5ECKB 6GSXA 1EOGA 4HQSA 4I2UA 4HQZA 4ZL9A 4ECIA 4DSSA 5L71A 1GRXA 5EY6A 2H66A 2TIRA 3TKRA 3A2XA 10GSA 1FO5A 2I81A 3FZ5A 2IFQB 3GH6A 4OFNA 4I8BA 1GSEA 2DBCA 4QL9A 2A4VA 2IN3A 1SJ6A 1MDJA 3LWAA 5INYA 3EU3A 2XHFA 4L0WA 4IP1A 4OFMA 2R4VA 1DUGA 1JFUA 2QKEA 4V2LA 1NHYA 4EDYA 1VF4A 1NSWA 4GSNA 4MPFA 4HEA2 2Z9SA 3HD5A 3TJBA 1OE8A 4KCAA 1TRUA 1NHOA 1FB0A 3UMAA 5ECPB 3UVTA 5J41A 2PERA 2DJ1A 4K2DA 2WRTA 1K3LA 2NBSA 4KCEA 1Z6NA 2JSZA 1X9WB 5D8IA 1Q98A 2GDRA 3FRCA 4JR4A 2F51A 3ZL5A 4I6XA 1PKWA 3DXBA 4WR5A 2H75A 2MMNA 2IPAA 3Q74A 2L4CA 3O3TA 4IN0A 4HZ2A 3ME7A 5HR2A 3W8JA 4F9ZA 4G10A 5ECMB 18GSA 2YP6A 2YN1A 3GL5A 2PGTA 2AHEA 2R6KA 1B48A 1GTIA 5C04A 3I43A 12GSA 1TKDB 1F6MC 6GSSA 1K0DA 4CHSA 2KHPA 4GSTA 1PL1A 1K0MA 4RI6A 3D21A 1EEMA 1PA3A 1M9AA 1A8YA 2VL2C 4K1FA 1XVQA 1WWJA 1LU4A 2AB6A 1IYHA 2LRCA 2V32A 2ALBA 3WT2A 1HQOA 5IMFA 4KX4A 2KP1A 3QDNA 4TKYA 1A8LA 5CAXA 5CRDA 4EDZA 3ZITA 1TI3A 4L8EA 4PNFA 2WFCA 2EIRA 2MBTA 3BBYA 2H73A 5ENUA 5G30A 3PINA 1XWBA 2FY6A 3F3RA 2P5QA 2YPMA 3DYRA 1GP1A 5DAKA 3HHVA 2CZ2A 5DCHA 1MTCA 3CRUA 1W4VA 1E2YA 1SL1B 4EE0A 5A5KA 2B1LA 1SJZA 1F2EA 4O92A 4N11A 2TRCP 3TRXA 1X9SB 2N5BA 1T8EB 5AIVA 3NOFA 2C0GA 4KE3A 3GIXA 3US3A 5E4WA 2IFQA 2L57A 2R2JA 4TR0A 5KEJA 1X5EA 1M2AA 1YF0A 2LRTA 4KH7A 2H1BA 2M80A 4NHZA 2NPBA 4NXIA 3EU4A 4IGJA 3GTUA 1TRWA 1GTAA 2BTOT 3H1NA 1S3AA 3QR6A 3ERWA 4I97A 4MLYA 1QGVA 1M99A 4PQIA 2OJLA 1T1VA 1SL2B 3ZFBA 4OFTA 3F6FA 2VUPA 3ZMLA 2HI7A 5HFIA 2FCHA 2LEGA 4ZIJA 3VLNA 2EIOA 17GSA 4OCEA 3VFIA 2LS5A 1O7UA 3IRAA 2L4QA 3GX0A 4CW9A 3EYTA 1ST9A 1I5GA 2ES7A 5DJLA 5EPFA 2CAIA 2WCIA 3EE2A 3MNGA 4BVYA 1X5DA 1A24A 3KM6A 2VLTA 1ACVA 5DDLA 3QD9A 1V9WA 3O6TA 2ON7A 4MF7A 4EUYA 1C72A 3CSIA 2B7JA 3HXSA 4POLA 2GZYA 4ECCA 2LQOA 1JZWA 3VWXA 1SYXA 1TI1A 2YOIA 1ZCPA 1AUCA 5ABRA 1XW9A 4OO4A 1M2DA 1FB6A 1R5PA 1K3OA 4DSRA 1EP8A 3LYPA 2H0HA 5ID2B 3GURA 1GWCA 4PUFC 1ZL9A 4HS1A 1EEJA 4FYBA 5G5EA 2H6YA 20GSA 3FR3A 3APQA 1V57A 1SD9A 4Q5QA 1XWCA 4TN8A 3SWLA 3KMOA 1FG4A 3D22A 2H74A 3FR6A 3GNJA 3H93A 1ML6A 1FAAA 5D9VA 2V41A 4PUAA 3KIJA 2FHEA 4FYUA 1FHEA 1R5AA 4XRDA 1XBSA 2IWTA 3QCPA 5F0GA 3PR8A 4EO3A 1QXHA 3KMNA 1ZYQB 1NM3A 4AJ7A 2LTKA 3GKXA 3IR4A 5LNKe 2JL4A 3FKFA 5ELGA 2VO4A 3Q18A 5JCWA 3RHCA 3F8UA 2H1GA 4ZBDA 4QL7A 1U3AA 1CQHA 4LMVA 2O89A 2R37A 2QSIA 3HZ8A 3IA1A 4HU7A 1OYJA 2R3XA 5ECSA 3TRPA 4EC0A 2IMKA 1TRVA 1URMA 3H8QA 5EVOA 4EVMA 2ZUPA 4K8MA 3VI7A 2VD0A 2MBSA 3VI5A 2IL3A 2XC2A 2NVLA 5HR0A 4TVEA 2C1YA 5COHA 2V1MA 19GSA 1U6TA 4KDUA 4MZWA 2VD1A 1ERUA 4XS6A 1AAZA 3A3TA 2FWHA 11GSA 1DBYA 2D2ZA 3LXZA 4E8HA 3M9KA 4D73B 5G5FA 3FK8A 4XTSA 1BAYA 3LSZA 4KW6A 1MDKA 4ZXGA 3MDKA 3TDGA 3KH9A 2VCZA 1AIUA 1GSYA 4ACSA 4XHMA 5A4VA 5CNWA 5DALB 1M2BA 5J9CA 1R4WA 3L9SA 3KP9A 3JCML 1YEXA 1XW6A 2B1KA 2RUFA 2PU9C 4J56E 3MAKA 2RIIA 2OBKA 1B4QA 2GTUA 3H4KA 2I4AA 4O7HA 2CZ3A 2H1DA 3KTLA 3ZYWA 1QUWA 2AYTA 2GS3A 3HYPA 3K8NA 1S3CA 1NW2A 5IIZA 5D9TA 1XFLA 1BYEA 4X0XA 1OC9B 3J7Yk 3L9UA 4HZ4A 2A2SA 1G0TA 2ZNMA 3UIWA 22GSA 4TR3A 4ECJA 2VLUA 4H86A 1T7PB 5D9XA 5AGYA 5CREA 4PX1A 5H5RA 3M3MA 5F06A 4V2MA 4ML6A 1K0CA 4N0ZA 1THXA 2RM6A 1TTZA 1A23A 5ID2A 1UC7A 4GXZA 3L78A 1AQXA 3TJJA 2OE3A 1VF3A 2IMDA 2CT6A 2KOKA 2GSRA 4NWYA 1TW9A 3G7YA 1M7TA 4MJAA 1GLPA 5A4WA 4HDEA 3QOUA 2K18A 1AC1A 1A0RP 3WGDA 1QQ2A 4KAEA 2K8SA 4WETA 1K0AA 5KN2A 4TRXA 1WIKA 5JWRB 4FO5A 2A2RA 2YJ7A 5CO3A 2J23A 1BG5A 3O76A 2AV4A 3NIVA 4MH3A 3APSA 4PQ1A 5IMZA 2G2QA 2MYGA 1M9BA 2TRXA 2ZCTA 4IBPA 5F07A 3H79A 3ED3A 2DJKA 4X43A 4XCSA 4ML1A 3P90A 1BX9A 2RUEA 4K9ZA 3TKSC 1SU9A 2LRNA 1JLWA 3U5RE 3W6GA 3QMXA 4LLRA 3FZ4A 5B7CA 5DQYA 4LMWA 2GQLA 4YQVA 1TXXA 1BQ7A 2XPDA 3FYGA 2H6XA 3UVHA 4EXJA 2DSAA 1ON4A 2WS2A 2VCVA 3MSZA 4E8EA 4XRAA 3EINA 3FR9A 3HVVA 1JZOA 1PX7A 2YV9A 1DE2A 1YEPA 4TR4A 2O8VB 4I5QA 2LKUA 3WGEA 3HCZA 3A2VA 5ECIB 2FD3A 2CVBA 4K7IA 5G31A 1GULA 14GSA 1SYRA 3FEUA 5G1LA 4J57E 4XS1A 6GSYA 2IMIA 2GSQA 1HYUA 4MABA 3TJFA 4XS4B 2LJRA 4OD7A 1TP9A 1UN2A 5KN1A 3WT1A 3RBTA 2WB9A 3KGKA 1FW1A 5C00A 1RQMA 2VL2A 1PGTA 4TOPA 2WJUA 5D9WA 2B5EA 4MK3A 3E9JB 5HR1A 1KTEA 4JU5A 4BA7A 2H0GA 3P2AA 2HRFA 2EC4A 4IW9A 1MDIA 3HVXA 3IDVA 3G7IA 3BJ5A 5A4UA 4ECBA 3CSHA 4BL7A 3EWLA 3ZIVA 2YCDA 2LNSA 2M72A 1AXDA 1DSBA 2B5XA 2HNLA 1EGOA 2LV3A 4ZB8A 3BD2A 3HA9A 3APOA 2JACA 1EGRA 1F37A 1YDKA 4WXTA 1SK2A 2PMTA 4WF5A 3Q19A 3CRTA 5EL8A 2YWNA 2FGXA 2N5AA 1LJRA 3HZ4A 2OE0A 3KTBA 1AW9A 8GSSA 1A2LA 5ECNB 1V98A 1BEDA 4MF5A 3ZLPA 4BWQA 3WD6A 2E2GA 3D6IA 4GQCA 3UEMA 5F8BA 3VK9A 4KB3A 4RQRA 4XIHA 2IMEA 2RM5A 3RHBA 4IS0A 5AISA 3ME8A 1PSQA 3V1WA 4MMMA 1J9BA 1WRYA 3VWWA 2C3QA 1GUHA 5AN1A 4LL1B 6GSTA 4IVFA 2F8FA 1G7OA 1YJ6A 4KGIA 3FZ9A 5IOXA 1XWKA 3D4TA 2LQQA 5DCGA 2V6OA 2VCXA 2MZCA 4N0VA 5CRWA 2HSHA 2YANA 5FWGA 4F0BA 3GFKA 3DIEA 1HNCA 3CXGA 3E3EA 1SJIA 2X99A 1EOHA 3I6AA 1O73A 2H1AA 2L5LA 3TOTA 2DMMA 4KSMA 1J0FA 1XPVA 1OC8A 4K7NA 1YKCA 1K0BA 3KXOA 4DSQA 2XBQA 1B8XA 2DC5A 4BPYA 1GH2A 3IV4A 1S3DA 2AUVA 5JWQB 4TXOB 1SD8A 4GF0A 2REMA 3LG6A 5ECLB 2YZHA 1V2AA 3GKMA 3GSTA 5DBQA 4GRFA 2PVQA 2WGRA 1A2JA 3C73A 4GWRA 4RI7A 1Y25A 4JR6A 2CVKA 4TR1B 1MD3A 1V58A 2HYXA 1YF1A 1JZRA 2LNTA 3UAPA 3EMPA 2HLSA 5ECQB 3R2QA 4L5OA 4TXVA 3N9JA 1WOUA 1EV4A 4GSSA 2HZFA 2HZEB 2BMXA 1OVNA 2O7KA 4DSSB 5AIXA 1YKAA 5J5NA 3CTFA 2H6ZA 2IIYA 5GZZB 4ZBBA 5IO0A 3UBKA 1B4PA 2HRNA 3MWHA 2IJYA 3G7JA 4NAXA 2GZPA 1O81A 2C80A 2H71A 5IPGA 2WULA 1WE0A 2X8HA 2GLRA 2JZRA 5H5SA 2L5OA 1X9MB 5D73A 2NTOA 1HNAA 3QAVA 2KUCA 3GSSA 2O87A 1ZMAA 4JZQA 1Y6EA 2PN8A 4WEYA 3VPQA 4YQUA 1T4ZA 3ZVJD 1ZZYA 3HJPA 5D96A 1OAZA 2OE1A 4YAVA 2WDUA 2I9HA 2YZUA 5FT3A 3C1SA 4YH2A 3W8SA 2F8AA 1SL0B 1EV9A 2K6VA 5GSTA 4HUAA 3UJ1A 3KCMA 4K6XA 3F3QA 2DLXA 4RUVA 2QC7A 2DMLA 1XCCA 2VOCA 4MPGA 4MA9A 3DEXA 5HFKA 4NHWA 3KP8A 3HKRA 4PNGA 1E6BA 3LEFA 3L4NA 3KH7A 3D0ZA 1U3IA 3UL3A 1QK8A 2FNOA 2FUG2 3ERGA 1Z5YE 2DJJA 5E59A 5GSSA 5IMDA 2NDOA 4EL1A 5IOWA 3OR5A 1OKDA 5KN3A 4K7OA 3GRXA 2GT5A 2X8GA 5IQYA 5HR3A 4IKHA 1ZYEA 5JWOB 4KUNA 2V2GA 1JLVA 2OACA 3F4SA 3A5WA 3GKKA 1XWAA 4WF4A 2GQMA 2FLSA 3DVXA 4KA0A 1GSDA 4AJ6A 2AJQB 4ZB9A 1G6WA 3KD0A 5IMVA 3TUEA 2DJ0A 5DJMA 1N2AA 4MH2A 3GMFA 1ILOA 4IQAA 3ERFA 3CYNA 4HOJA 1O6JA 3F0IA 1ERWA 1B9YC 5IM9A 5IPHA 2J9HA 3S9FA 2OA7A 2C0DA 5DAKB 1TK5B 1XOAA 1IYIA 4JEDA 1SK0A 3DWVA 3QAGA 2F3MA 4IP6A 1PQNA 1X0RA 2LUSA 4TR1A 2VLVA 4POBA 1AQWA 1PRXA 1WPIA 1Q4JA 2GSSA 3FHKA 2VCTA 4Z7XA 1R26A 2H01A 3RDWA 3DGQA 3LORA 1A2MA 2GVPA 1WMJA 1UVZA 3FW2A 5GAND 2HZEA 5ECRB 3BCIA 4MCUA 5FHIA 1H75A 1UA5A 1YQ1A 4LL4B 2MMZA 3Q6OA 2O85A 4CDOA 2B3SA 4G19A 2VAFA 3IK7A 3A2WA 3EMXA 2CQ9A 3CTGA 2HE3A 3IPZA 3WGXA 1EP7A 3F9UA 4MP4A 4AGSA 3GTUB 1QMVA 4F03A 2IMFA 2HXKA 1K3YA 1W89A 5HFGA 1GUKA 1RK4A 2GGTA 4NMUA 4WR4A 2YWIA 3TCOA 1O8WA 3LFLA 1FVJA 4RQXA 2H76A 2GSTA 1O85A 3HY2A 5JCUA 2OBIA 4L0UA 4WKWA 4NV5A 4OCFA 4L5LA 1PX6A 5ECOB 1CQGA 1ERTA 3I69A 2C8UA 3TKSA 4PXOA 4NV2A 2VCWA 1FOVA 4OWYA 3ZIJA 4LA1A 2C4JA 1H4OA 2PUKC 3ZREA 4ZL7A 4J2FA 3E0UA 3TKSE 1FVKA 3TOUA 2CX4A 1PN9A 4IJ3A 1Z7PA 1A0FA 1EWXA 3TJKA 3TRQA 3QFBC 3UOMA 1TK8B 4ZBAA 1SENA 5CYYA 6GSUA 6GSWA 4D73A 4PURA 2FWGA 4N30A 1LBKA 3M0FA 2EIQA 2B5YA 3TGZA 4IQ1A 2CX3A 3C7MA 4F0CA 1KBNA 5DALA 3VPTA 1V40A 1WP0A 3BCKA 4P3YB 3F63A 3GKNA 4EF0A 1I9DA 4GLTA 5H5QA 2VCQA 4K0NA 3EVIA 1GNEA 2B6MA 1AQVA 6GSVA 5HQPA 2OADA 4JE1A 1F9MA 2I3YA 3F4RA 1PKZA 1XXUA 2N5FA 3QFAC 4F82A 2CA8A 1PD21 4MJEA 2H19A 4ZB6A 1SK1A 5B8AA 2P0GA 3FY7A 4IELA 5IMCA 1OC9A 3KJYA 3C71A 2H30A 1Z7RA 5LCZA 1GNWA 3M9JA 5DQSA 3BOAA 1R7HA 4JBBA 1JZDA 2E7PA 3DVWA 1M0UA 4FH8A 4ULXA 4DVCA 3EC3A 1SKWB 2I1UA 4FYCA 2GT6A 2H72A
chains in the Genus database with same CATH superfamily
1GUMA 4PGTA 5GAPD 1GSFA 4ZILA 3A5IA 3NZNA 3ZFLA 4KNDA 2H8LA 1Z3EA 3HVSA 3RPNA 2YJHA 5J3RA 2C3NA 4K2XA 2DJ3A 5IMAA 2GZZA 5B6MA 3G9BA 2PBJA 3DD3A 2XPEA 3WYWA 2X8CA 3CMIA 5F05A 1OC3A 3L0HA 1GLQA 4ID0A 3U6VA 1MD4A 3UARA 3GL3A 4Q5FA 2YWMA 3IC4A 2VM2A 2P31A 3IK9A 3DRNA 4EKZA 5LD0A 1T3BA 1KEBA 2MMOA 4POMA 1EZKA 4HJ2A 2RLIA 1DE1A 1HD2A 4KSOA 1OKTA 5G2ZA 5B8BA 2HSYA 2LSTA 2DIZA 1GTUA 1TRSA 2E0QA 2F9SA 4V1Ag 5CRHA 3TKQA 1GSQA 2GQKA 3QAWA 1THOA 3GN3A 1F3AA 2DJ2A 1GTBA 4OO5A 3IOSA 2YNXA 3F4TA 4KF9A 5J9BA 3IC8A 4POKA 5B6NA 4X1UA 5J4UA 2XBIA 4O5RA 1J08A 3EURA 1G6YA 3ZZXA 2H0IA 4F2IA 1YZXA 2E2MA 9GSSA 3GA4A 4MJCA 4XS4A 1TJDA 4A5PA 1VGLA 4KDXA 2L6DA 1F3BA 4G2EA 4PQHA 3LJRA 3GHAA 3ZVJA 4AJ8A 2WZ9A 1GL8A 2VIMA 3VURA 4GTUA 1XOBA 3MYDA 2HT9A 3GX8A 2LJAA 4YKGA 3PH9A 5ECHB 3HDCA 2FA4A 3ZRDA 2FWEA 4ISDA 4YQMA 1ZGNA 3TB2A 1Z6MA 5KN0A 3D4MA 3GUSA 2CAQA 2CV4A 3VWUA 13GSA 1XIYA 1O8XA 2JU5A 1N8JA 3AY8A 3M8NA 3GYKA 3FZAA 1VF1A 4FIWA 2JZSA 1TDIA 3ISOA 5G1KA 3SBCA 1PMTA 4O32A 4Q5RA 1TOFA 2X64A 5D93A 1PN0A 3IAS2 2BJXA 4V1Ap 3GV1A 1OE7A 1ZOFA 2DIYA 4WBRD 2P5RA 3N5OA 2C3TA 3CSJA 1PL2A 4G0KA 1U88A 3HJMA 3ZTLA 1GSSA 2K9FA 4HJMA 2L59A 2H70A 2ON5A 3VWVA 4HU9A 1VF2A 5DVBA 1QFNA 4K0GA 3HJOA 2YV7A 1ABAA 3DMLA 4MDCA 2AAWA 1USBA 16GSA 3M1GA 3KEBA 4G9HA 2MMAA 3QPMA 3IBHA 2C0EA 2HFDA 3ZMKA 4ILFA 4OMVA 4HI7A 1TU8A 3LXTA 3C8EA 4IHUA 5ELAA 4WBJA 4MF6A 4DEJA 3IE3A 1G7EA 2OKAA 3LQ7A 4Q5NA 1Z9HA 2PVOC 1SKRB 3L9VA 4I2TA 5CRGA 1T00A 4AF2A 5IO2A 4GQFA 2JSYA 3IAM2 2VL3A 2M46A 2CVDA 2B7KA 2JZTA 4GCIA 3IHQA 3TJGA 2C0FA 2R0PA 3IXRA 1XWGA 1VRSD 3KZQA 1BJXA 4IJIA 2LJKA 3CBUA 1U87A 2YWOA 2R5GA 4K5RA 3PGTA 4X4JA 4BVXA 4NPBA 1ERVA 1X5CA 3I9V2 3DKSA 1MEKA 2JADA 2QGVA 1XVWA 1TK0B 4MZBA 3RPPA 1SKSB 1HNBA 3D5JA 3LGCA 4ZL8A 4YAPA 2VM1A 4JRRA 2L6CA 2FA8A 1TU7A 1K0OA 3LYKA 4QQ7A 3C1RA 2K8VA 1GSUA 2KP2A 1KNGA 3TKPA 4TXOA 4MJBA 7GSSA 1JHBA 2G0FA 4N10A 1XW5A 2KLXA 2V6KA 3J7Yb 4O5QA 1WJKA 3P7XA 2PPTA 2FWFA 3F6DA 5JCGA 3UBLA 3RAZA 3GH9A 2PWJA 1T4YA 1RW1A 4V2NA 1K0NA 4K5SA 5CP1A 3P8WA 1YY7A 2VL9A 4BWSA 4KDYA 1XZOA 4TW5A 1B9XC 4MZCA 5ECKB 6GSXA 1EOGA 4HQSA 4I2UA 4HQZA 4ZL9A 4ECIA 4DSSA 5L71A 1GRXA 5EY6A 2H66A 2TIRA 3TKRA 3A2XA 10GSA 1FO5A 2I81A 3FZ5A 2IFQB 3GH6A 4OFNA 4I8BA 1GSEA 2DBCA 4QL9A 2A4VA 2IN3A 1SJ6A 1MDJA 3LWAA 5INYA 3EU3A 2XHFA 4L0WA 4IP1A 4OFMA 2R4VA 1DUGA 1JFUA 2QKEA 4V2LA 1NHYA 4EDYA 1VF4A 1NSWA 4GSNA 4MPFA 4HEA2 2Z9SA 3HD5A 3TJBA 1OE8A 4KCAA 1TRUA 1NHOA 1FB0A 3UMAA 5ECPB 3UVTA 5J41A 2PERA 2DJ1A 4K2DA 2WRTA 1K3LA 2NBSA 4KCEA 1Z6NA 2JSZA 1X9WB 5D8IA 1Q98A 2GDRA 3FRCA 4JR4A 2F51A 3ZL5A 4I6XA 1PKWA 3DXBA 4WR5A 2H75A 2MMNA 2IPAA 3Q74A 2L4CA 4BVYB 3O3TA 4IN0A 4EIQA 4HZ2A 3ME7A 5HR2A 3W8JA 4F9ZA 4G10A 5ECMB 18GSA 2YP6A 2YN1A 3GL5A 2PGTA 2AHEA 2R6KA 1B48A 1GTIA 5C04A 3I43A 12GSA 1TKDB 1F6MC 6GSSA 1K0DA 4CHSA 2KHPA 4GSTA 1PL1A 1K0MA 4RI6A 3D21A 1EEMA 3CQFA 1PA3A 1M9AA 1A8YA 2VL2C 4K1FA 1XVQA 1WWJA 1LU4A 2AB6A 1IYHA 2LRCA 2V32A 2ALBA 3WT2A 1HQOA 5IMFA 4KX4A 2KP1A 3QDNA 4TKYA 4ICYA 1A8LA 5CAXA 1ZYNA 5CRDA 4EDZA 3ZITA 1TI3A 4L8EA 4PNFA 2WFCA 2EIRA 2MBTA 3BBYA 2H73A 5ENUA 5G30A 3PINA 1XWBA 2FY6A 2HRKA 3F3RA 2P5QA 2YPMA 3DYRA 1GP1A 5DAKA 3HHVA 2CZ2A 5DCHA 1MTCA 3CRUA 1W4VA 1E2YA 1SL1B 4EE0A 5A5KA 2B1LA 1SJZA 1F2EA 4O92A 4N11A 2TRCP 3TRXA 1X9SB 2N5BA 1T8EB 5AIVA 3NOFA 2C0GA 4KE3A 3GIXA 3US3A 5E4WA 2IFQA 2L57A 2R2JA 4TR0A 5KEJA 1X5EA 1M2AA 2A4HA 1YF0A 2LRTA 4KH7A 2H1BA 2M80A 4NHZA 2NPBA 4NXIA 4O5UA 3EU4A 4IGJA 5KOWA 3GTUA 1TRWA 1GTAA 2BTOT 3H1NA 2X4AA 1S3AA 3QR6A 3ERWA 4I97A 4MLYA 1QGVA 1M99A 4PQIA 2OJLA 1T1VA 4G0IA 1SL2B 3ZFBA 4OFTA 3F6FA 2VUPA 3ZMLA 2HI7A 5HFIA 3LW9A 2FCHA 2LEGA 4ZIJA 3VLNA 2EIOA 17GSA 4PTSA 4OCEA 3VFIA 2LS5A 1O7UA 3IRAA 2L4QA 3GX0A 4CW9A 3EYTA 1ST9A 1I5GA 4USSA 2ES7A 5DJLA 3MIXA 5EPFA 2CAIA 2WCIA 3EE2A 3MNGA 4BVYA 1X5DA 1A24A 3KM6A 2VLTA 1ACVA 5DDLA 3QD9A 1V9WA 3O6TA 2ON7A 4MF7A 4EUYA 1C72A 3CSIA 2B7JA 3HXSA 4POLA 2GZYA 4ECCA 2LQOA 1JZWA 3VWXA 1SYXA 1TI1A 2YOIA 1ZCPA 1AUCA 2X49A 5ABRA 1XW9A 4OO4A 1M2DA 1FB6A 1R5PA 1K3OA 4DSRA 1EP8A 3LYPA 2H0HA 5ID2B 3GURA 1GWCA 4PUFC 1S3RA 1ZL9A 4HS1A 1EEJA 4FYBA 5G5EA 2H6YA 20GSA 3FR3A 3APQA 1V57A 1SD9A 4Q5QA 1XWCA 4TN8A 3SWLA 3KMOA 1FG4A 3D22A 2H74A 3FR6A 3GNJA 3H93A 1ML6A 1FAAA 1M3JA 2V41A 5D9VA 4PUAA 3KIJA 2FHEA 4FYUA 1FHEA 1R5AA 4XRDA 1XBSA 2IWTA 3QCPA 5F0GA 3PR8A 4EO3A 1QXHA 3KMNA 1ZYQB 1NM3A 4AJ7A 2A2PA 2LTKA 3GKXA 3IR4A 5LNKe 2JL4A 3FKFA 5ELGA 2VO4A 3Q18A 5JCWA 3RHCA 3F8UA 2H1GA 4ZBDA 4QL7A 1U3AA 1CQHA 4LMVA 2O89A 2R37A 2QSIA 3HZ8A 3IA1A 4HU7A 1OYJA 2R3XA 5ECSA 3TRPA 4EC0A 2IMKA 1TRVA 1URMA 3H8QA 5EVOA 4EVMA 2ZUPA 4K8MA 3VI7A 2VD0A 2MBSA 3VI5A 2IL3A 2XC2A 2NVLA 5HR0A 4TVEA 2C1YA 5COHA 2V1MA 19GSA 1U6TA 4KDUA 4MZWA 2VD1A 1ERUA 4XS6A 1AAZA 3A3TA 2FWHA 11GSA 1DBYA 2D2ZA 3LXZA 4E8HA 3M9KA 4D73B 5G5FA 3FK8A 4XTSA 1BAYA 3LSZA 4KW6A 1MDKA 4ZXGA 3MDKA 3TDGA 3KH9A 4MNNA 2VCZA 1AIUA 1GSYA 4ACSA 4XHMA 5A4VA 5CNWA 5DALB 1M2BA 5J9CA 1R4WA 3L9SA 3KP9A 3JCML 1YEXA 1XW6A 2B1KA 2RUFA 2PU9C 4J56E 3MAKA 2RIIA 2OBKA 1B4QA 2GTUA 3H4KA 2I4AA 4O7HA 2CZ3A 2H1DA 3KTLA 3ZYWA 1QUWA 2AYTA 2GS3A 3HYPA 3K8NA 4BL7B 1S3CA 1NW2A 5IIZA 5D9TA 1XFLA 1BYEA 4X0XA 1OC9B 3J7Yk 3L9UA 4HZ4A 2A2SA 1G0TA 2ZNMA 3UIWA 22GSA 4TR3A 4ECJA 2VLUA 4H86A 1T7PB 5D9XA 5AGYA 5CREA 4Z2TA 4PX1A 5H5RA 3M3MA 5F06A 4V2MA 4ML6A 1K0CA 4N0ZA 1THXA 2RM6A 4Z2RA 1TTZA 1A23A 5ID2A 1UC7A 4GXZA 3L78A 1AQXA 3TJJA 2OE3A 1VF3A 2IMDA 2CT6A 2KOKA 2GSRA 4NWYA 1TW9A 3G7YA 1M7TA 4MJAA 1GLPA 5A4WA 4HDEA 3QOUA 2K18A 1AC1A 1A0RP 3WGDA 1QQ2A 4KAEA 2K8SA 4WETA 1K0AA 5KN2A 4TRXA 1WIKA 5JWRB 4FO5A 2A2RA 2YJ7A 3PPUA 5CO3A 2J23A 1BG5A 3O76A 2AV4A 3NIVA 4MH3A 2DKIA 3APSA 4PQ1A 5IMZA 2G2QA 2MYGA 1M9BA 4Z2UA 2TRXA 2ZCTA 4IBPA 5F07A 3H79A 3ED3A 1XG8A 2DJKA 4X43A 4XCSA 4ML1A 3P90A 1BX9A 2RUEA 4K9ZA 3TKSC 1SU9A 2LRNA 1JLWA 3U5RE 3W6GA 3QMXA 4LLRA 3FZ4A 5B7CA 5DQYA 4LMWA 2GQLA 4YQVA 1TXXA 1BQ7A 2XPDA 3FYGA 4YKFA 2H6XA 3UVHA 4EXJA 2DSAA 1ON4A 2WS2A 2VCVA 4HSCX 3MSZA 4E8EA 4XRAA 3EINA 3FR9A 3HVVA 1JZOA 1PX7A 2YV9A 1DE2A 1YEPA 4TR4A 2O8VB 4I5QA 2LKUA 3WGEA 3HCZA 3A2VA 5ECIB 2FD3A 2CVBA 4K7IA 5G31A 1GULA 14GSA 1SYRA 3FEUA 5G1LA 4J57E 4XS1A 6GSYA 2IMIA 2GSQA 2UZ8A 1HYUA 4MABA 3TJFA 4XS4B 2LJRA 4OD7A 1TP9A 1UN2A 5KN1A 3WT1A 3RBTA 2WB9A 3KGKA 1FW1A 5C00A 1RQMA 2VL2A 1PGTA 4TOPA 2WJUA 5D9WA 2B5EA 4MK3A 3E9JB 5HR1A 1KTEA 4JU5A 4BA7A 2H0GA 3P2AA 2HRFA 2EC4A 4IW9A 1MDIA 3HVXA 3IDVA 3G7IA 3BJ5A 5A4UA 4ECBA 3CSHA 4BL7A 3EWLA 3ZIVA 2YCDA 2LNSA 2M72A 1AXDA 1DSBA 2B5XA 2HNLA 1EGOA 2LV3A 4ZB8A 3BD2A 3HA9A 3APOA 2JACA 1EGRA 1F37A 1YDKA 4WXTA 1SK2A 2PMTA 4WF5A 3Q19A 3CRTA 5EL8A 2YWNA 2FGXA 2N5AA 4FQUA 1FOHA 1LJRA 3HZ4A 2OE0A 3KTBA 1AW9A 8GSSA 1A2LA 5ECNB 1V98A 1BEDA 4MF5A 3ZLPA 4BWQA 3WD6A 2E2GA 3D6IA 4GQCA 3UEMA 5F8BA 3VK9A 4KB3A 4RQRA 4XIHA 2IMEA 2RM5A 3RHBA 4IS0A 5AISA 3ME8A 1PSQA 1ZYPA 3V1WA 4MMMA 1J9BA 1WRYA 3VWWA 2C3QA 1GUHA 5AN1A 4LL1B 6GSTA 4IVFA 2F8FA 1G7OA 1YJ6A 4KGIA 3FZ9A 5IOXA 1XWKA 3D4TA 2LQQA 5DCGA 2V6OA 2VCXA 2MZCA 4N0VA 5CRWA 2HSHA 2YANA 5FWGA 4F0BA 3GFKA 3DIEA 1HNCA 3CXGA 3E3EA 1SJIA 4BVXB 2X99A 1EOHA 3I6AA 1O73A 2H1AA 2L5LA 3TOTA 2DMMA 4KSMA 1J0FA 1XPVA 1OC8A 4K7NA 1YKCA 1K0BA 3KXOA 1M3IA 4DSQA 2XBQA 1B8XA 2DC5A 4BPYA 1GH2A 3IV4A 1S3DA 2AUVA 5JWQB 4TXOB 1SD8A 4GF0A 2REMA 3LG6A 5ECLB 2YZHA 1V2AA 3GKMA 3GSTA 5DBQA 4GRFA 2PVQA 2WGRA 1A2JA 3C73A 3EPTA 4GWRA 4RI7A 1Y25A 4JR6A 2CVKA 4TR1B 1MD3A 1V58A 2HYXA 4BIKA 1YF1A 1JZRA 2LNTA 3UAPA 3EMPA 2HLSA 3R2QA 5ECQB 4L5OA 4TXVA 3N9JA 1WOUA 1EV4A 4GSSA 2HZFA 2HZEB 2BMXA 1OVNA 2O7KA 4DSSB 5AIXA 1YKAA 5J5NA 3CTFA 2H6ZA 2IIYA 2QA1A 5GZZB 4ZBBA 5IO0A 3UBKA 1B4PA 2HRNA 3MWHA 4G0LA 2IJYA 3G7JA 4NAXA 2GZPA 1O81A 2C80A 2H71A 5IPGA 2WULA 1WE0A 2X8HA 2GLRA 2JZRA 5H5SA 2L5OA 1X9MB 5D73A 2NTOA 1HNAA 3QAVA 2KUCA 3GSSA 2O87A 1ZMAA 4JZQA 1Y6EA 2PN8A 4WEYA 3VPQA 4YQUA 4CY8A 1T4ZA 3ZVJD 1ZZYA 3HJPA 5D96A 1OAZA 2OE1A 4YAVA 2WDUA 2I9HA 2YZUA 5FT3A 3C1SA 4YH2A 3W8SA 2F8AA 1SL0B 1EV9A 2K6VA 5GSTA 4HUAA 3UJ1A 3FMWA 3KCMA 4K6XA 3F3QA 4CY6A 2DLXA 4RUVA 2QC7A 2DMLA 1XCCA 2VOCA 4MPGA 4MA9A 3DEXA 5HFKA 4NHWA 3KP8A 3HKRA 4PNGA 1E6BA 3LEFA 3L4NA 3KH7A 3D0ZA 1U3IA 3UL3A 1QK8A 2FNOA 5BMUA 2FUG2 3ERGA 1Z5YE 2DJJA 5E59A 5GSSA 5IMDA 2NDOA 4EL1A 5IOWA 3OR5A 1OKDA 5KN3A 4K7OA 3GRXA 2GT5A 2X8GA 5IQYA 5HR3A 4IKHA 1ZYEA 5JWOB 4KUNA 2V2GA 1JLVA 2OACA 4EIPA 3F4SA 3A5WA 3GKKA 1XWAA 2HSMA 4WF4A 2GQMA 2FLSA 3DVXA 4KA0A 1GSDA 4AJ6A 2AJQB 4ZB9A 1G6WA 3KD0A 5IMVA 2QA2A 3TUEA 2DJ0A 5DJMA 1N2AA 4MH2A 3GMFA 1ILOA 4IQAA 3ERFA 3CYNA 4HOJA 1O6JA 3F0IA 1ERWA 1B9YC 5IM9A 5IPHA 2J9HA 3S9FA 2OA7A 2C0DA 5DAKB 1TK5B 1XOAA 1IYIA 4JEDA 1SK0A 3DWVA 3QAGA 2F3MA 4IP6A 1PQNA 1X0RA 2LUSA 4TR1A 2VLVA 4POBA 1AQWA 1PRXA 1WPIA 1Q4JA 2GSSA 3FHKA 2VCTA 4Z7XA 1R26A 2H01A 3RDWA 3DGQA 3LORA 1A2MA 2GVPA 1WMJA 1UVZA 3FW2A 5GAND 2HZEA 5ECRB 3BCIA 4MCUA 5FHIA 1H75A 1UA5A 1YQ1A 4LL4B 2MMZA 3Q6OA 2O85A 4CDOA 2B3SA 4G19A 2VAFA 3IK7A 3A2WA 3EMXA 2CQ9A 3CTGA 2HE3A 3IPZA 3WGXA 1EP7A 3F9UA 4MP4A 2R0GA 4AGSA 3GTUB 1QMVA 4F03A 2IMFA 2HXKA 2DKHA 1K3YA 1W89A 5HFGA 1GUKA 1RK4A 2GGTA 4NMUA 4WR4A 2YWIA 3TCOA 1O8WA 3LFLA 1FVJA 4RQXA 2H76A 2GSTA 1O85A 3HY2A 5JCUA 2OBIA 4L0UA 4WKWA 4NV5A 4OCFA 4L5LA 1PX6A 5ECOB 1CQGA 1ERTA 3I69A 2C8UA 3TKSA 4PXOA 4NV2A 2VCWA 1FOVA 4OWYA 3ZIJA 4LA1A 2C4JA 1H4OA 2PUKC 3ZREA 4ZL7A 4J2FA 3E0UA 3TKSE 1FVKA 3TOUA 2CX4A 1PN9A 4IJ3A 1Z7PA 1A0FA 1EWXA 3TJKA 3TRQA 3QFBC 3UOMA 1TK8B 4ZBAA 1SENA 5CYYA 6GSUA 6GSWA 4D73A 4PURA 2FWGA 4N30A 1LBKA 3M0FA 2EIQA 2B5YA 3TGZA 4IQ1A 2CX3A 1PFOA 3HVNA 3C7MA 4F0CA 1KBNA 5DALA 3VPTA 3R3EA 1V40A 1WP0A 2HRAA 3BCKA 4P3YB 3F63A 3GKNA 4EF0A 2R0CA 1I9DA 4GLTA 5H5QA 2VCQA 4K0NA 3EVIA 1GNEA 2B6MA 1AQVA 6GSVA 5HQPA 2OADA 4JE1A 1F9MA 2I3YA 3F4RA 1PKZA 1XXUA 2N5FA 3QFAC 4F82A 2CA8A 1PD21 4MJEA 2H19A 4ZB6A 1SK1A 5B8AA 2P0GA 3FY7A 4IELA 5IMCA 1OC9A 5BRTA 3KJYA 3C71A 2H30A 1Z7RA 5LCZA 1GNWA 5KOXA 3M9JA 5DQSA 3BOAA 3IHGA 1R7HA 4JBBA 1JZDA 2E7PA 3DVWA 1M0UA 4FH8A 4ULXA 4DVCA 3EC3A 1SKWB 2I1UA 4FYCA 2GT6A 2H72A
chains in the Genus database with same CATH topology
1GUMA 4PGTA 5GAPD 1GSFA 4ZILA 3A5IA 3NZNA 3ZFLA 4KNDA 2H8LA 1Z3EA 3HVSA 3RPNA 2YJHA 5J3RA 2C3NA 4K2XA 2DJ3A 5IMAA 2GZZA 5B6MA 3G9BA 2PBJA 3DD3A 2XPEA 3WYWA 2X8CA 3CMIA 5F05A 1OC3A 3L0HA 1GLQA 4ID0A 3U6VA 1MD4A 3UARA 3GL3A 4Q5FA 2YWMA 3IC4A 2VM2A 2P31A 3IK9A 3DRNA 4EKZA 5LD0A 1T3BA 1KEBA 2MMOA 4POMA 1EZKA 4HJ2A 2RLIA 1DE1A 1HD2A 4KSOA 1OKTA 5G2ZA 5B8BA 2HSYA 2LSTA 2DIZA 1GTUA 1TRSA 2E0QA 2F9SA 4V1Ag 5CRHA 3TKQA 1GSQA 2GQKA 3QAWA 1THOA 3GN3A 1F3AA 2DJ2A 1GTBA 4OO5A 3IOSA 2YNXA 3F4TA 4KF9A 5J9BA 3IC8A 4POKA 5B6NA 4X1UA 5J4UA 2XBIA 4O5RA 1J08A 3EURA 1G6YA 3ZZXA 2H0IA 4F2IA 1YZXA 2E2MA 9GSSA 3GA4A 4MJCA 4XS4A 1TJDA 4A5PA 1VGLA 4KDXA 2L6DA 1F3BA 4G2EA 4PQHA 3LJRA 3GHAA 3ZVJA 4AJ8A 2WZ9A 1GL8A 2VIMA 3VURA 4GTUA 1XOBA 3MYDA 2HT9A 3GX8A 2LJAA 4YKGA 3PH9A 5ECHB 3HDCA 2FA4A 3ZRDA 2FWEA 4ISDA 4YQMA 1ZGNA 3TB2A 1Z6MA 5KN0A 3D4MA 3GUSA 2CAQA 2CV4A 3VWUA 13GSA 1XIYA 1O8XA 2JU5A 1N8JA 3AY8A 3M8NA 3GYKA 3FZAA 1VF1A 4FIWA 2JZSA 1TDIA 3ISOA 5G1KA 3SBCA 1PMTA 4O32A 4Q5RA 1TOFA 2X64A 5D93A 1PN0A 3IAS2 2BJXA 4V1Ap 3GV1A 1OE7A 1ZOFA 2DIYA 4WBRD 2P5RA 3N5OA 2C3TA 3CSJA 1PL2A 4G0KA 1U88A 3HJMA 3ZTLA 1GSSA 2K9FA 4HJMA 2L59A 2H70A 2ON5A 3VWVA 4HU9A 1VF2A 5DVBA 1QFNA 4K0GA 3HJOA 2YV7A 1ABAA 3DMLA 4MDCA 2AAWA 1USBA 16GSA 3M1GA 3KEBA 4G9HA 2MMAA 3QPMA 3IBHA 2C0EA 2HFDA 3ZMKA 4ILFA 4OMVA 4HI7A 1TU8A 3LXTA 3C8EA 4IHUA 5ELAA 4WBJA 4MF6A 4DEJA 3IE3A 1G7EA 2OKAA 3LQ7A 4Q5NA 1Z9HA 2PVOC 1SKRB 3L9VA 4I2TA 5CRGA 1T00A 4AF2A 5IO2A 4GQFA 2JSYA 3IAM2 2VL3A 2M46A 2CVDA 2B7KA 2JZTA 4GCIA 3IHQA 3TJGA 2C0FA 2R0PA 3IXRA 1XWGA 1VRSD 3KZQA 1BJXA 4IJIA 2LJKA 3CBUA 1U87A 2YWOA 2R5GA 4K5RA 3PGTA 4X4JA 4BVXA 4NPBA 1ERVA 1X5CA 3I9V2 3DKSA 1MEKA 2JADA 2QGVA 1XVWA 1TK0B 4MZBA 3RPPA 1SKSB 1HNBA 3D5JA 3LGCA 4ZL8A 4YAPA 2VM1A 4JRRA 2L6CA 2FA8A 1TU7A 1K0OA 3LYKA 4QQ7A 3C1RA 2K8VA 1GSUA 2KP2A 1KNGA 3TKPA 4TXOA 4MJBA 7GSSA 1JHBA 2G0FA 4N10A 1XW5A 2KLXA 2V6KA 3J7Yb 4O5QA 1WJKA 3P7XA 2PPTA 2FWFA 3F6DA 5JCGA 3UBLA 3RAZA 3GH9A 2PWJA 1T4YA 1RW1A 4V2NA 1K0NA 4K5SA 5CP1A 3P8WA 1YY7A 2VL9A 4BWSA 4KDYA 1XZOA 4TW5A 1B9XC 4MZCA 5ECKB 6GSXA 1EOGA 4HQSA 4I2UA 4HQZA 4ZL9A 4ECIA 4DSSA 5L71A 1GRXA 5EY6A 2H66A 2TIRA 3TKRA 3A2XA 10GSA 1FO5A 2I81A 3FZ5A 2IFQB 3GH6A 4OFNA 4I8BA 1GSEA 2DBCA 4QL9A 2A4VA 2IN3A 1SJ6A 1MDJA 3LWAA 5INYA 3EU3A 2XHFA 4L0WA 4IP1A 4OFMA 2R4VA 1DUGA 1JFUA 2QKEA 4V2LA 1NHYA 4EDYA 1VF4A 1NSWA 4GSNA 4MPFA 4HEA2 2Z9SA 3HD5A 3TJBA 1OE8A 4KCAA 1TRUA 1NHOA 1FB0A 3UMAA 5ECPB 3UVTA 5J41A 2PERA 2DJ1A 4K2DA 2WRTA 1K3LA 2NBSA 4KCEA 1Z6NA 2JSZA 1X9WB 5D8IA 1Q98A 2GDRA 3FRCA 4JR4A 2F51A 3ZL5A 4I6XA 1PKWA 3DXBA 4WR5A 2H75A 2MMNA 2IPAA 3Q74A 2L4CA 4BVYB 3O3TA 4IN0A 4EIQA 4HZ2A 3ME7A 5HR2A 3W8JA 4F9ZA 4G10A 5ECMB 18GSA 2YP6A 2YN1A 3GL5A 2PGTA 2AHEA 2R6KA 1B48A 1GTIA 5C04A 3I43A 12GSA 1TKDB 1F6MC 6GSSA 1K0DA 4CHSA 2KHPA 4GSTA 1PL1A 1K0MA 4RI6A 3D21A 1EEMA 1PA3A 1M9AA 1A8YA 2VL2C 4K1FA 1XVQA 1WWJA 1LU4A 2AB6A 1IYHA 2LRCA 2V32A 2ALBA 3WT2A 1HQOA 5IMFA 4KX4A 2KP1A 3QDNA 4TKYA 4ICYA 1A8LA 5CAXA 1ZYNA 5CRDA 4EDZA 3ZITA 1TI3A 4L8EA 4PNFA 2WFCA 2EIRA 2MBTA 3BBYA 2H73A 5ENUA 5G30A 3PINA 1XWBA 2FY6A 2HRKA 3F3RA 2P5QA 2YPMA 3DYRA 1GP1A 5DAKA 3HHVA 2CZ2A 5DCHA 1MTCA 3CRUA 1W4VA 1E2YA 1SL1B 4EE0A 5A5KA 2B1LA 1SJZA 1F2EA 4O92A 4N11A 2TRCP 3TRXA 1X9SB 2N5BA 1T8EB 5AIVA 3NOFA 2C0GA 4KE3A 3GIXA 3US3A 5E4WA 2IFQA 2L57A 2R2JA 4TR0A 5KEJA 1X5EA 1M2AA 2A4HA 1YF0A 2LRTA 4KH7A 2H1BA 2M80A 4NHZA 2NPBA 4NXIA 4O5UA 3EU4A 4IGJA 5KOWA 3GTUA 1TRWA 1GTAA 2BTOT 3H1NA 2X4AA 1S3AA 3QR6A 3ERWA 4I97A 4MLYA 1QGVA 1M99A 4PQIA 2OJLA 1T1VA 4G0IA 1SL2B 3ZFBA 4OFTA 3F6FA 2VUPA 3ZMLA 2HI7A 5HFIA 3LW9A 2FCHA 2LEGA 4ZIJA 3VLNA 2EIOA 17GSA 4PTSA 4OCEA 3VFIA 2LS5A 1O7UA 3IRAA 2L4QA 3GX0A 4CW9A 3EYTA 1ST9A 1I5GA 4USSA 2ES7A 5DJLA 3MIXA 5EPFA 2CAIA 2WCIA 3EE2A 3MNGA 4BVYA 1X5DA 1A24A 3KM6A 2VLTA 1ACVA 5DDLA 3QD9A 1V9WA 3O6TA 2ON7A 4MF7A 4EUYA 1C72A 3CSIA 2B7JA 3HXSA 4POLA 2GZYA 4ECCA 2LQOA 1JZWA 3VWXA 1SYXA 1TI1A 2YOIA 1ZCPA 1AUCA 2X49A 5ABRA 1XW9A 4OO4A 1M2DA 1FB6A 1R5PA 1K3OA 4DSRA 1EP8A 3LYPA 2H0HA 5ID2B 3GURA 1GWCA 4PUFC 1ZL9A 4HS1A 1EEJA 4FYBA 5G5EA 2H6YA 20GSA 3FR3A 3APQA 1V57A 1SD9A 4Q5QA 1XWCA 4TN8A 3SWLA 3KMOA 1FG4A 3D22A 2H74A 3FR6A 3GNJA 3H93A 1ML6A 1FAAA 5D9VA 2V41A 4PUAA 3KIJA 2FHEA 4FYUA 1FHEA 1R5AA 4XRDA 1XBSA 2IWTA 3QCPA 5F0GA 3PR8A 4EO3A 1QXHA 3KMNA 1ZYQB 1NM3A 4AJ7A 2A2PA 2LTKA 3GKXA 3IR4A 5LNKe 2JL4A 3FKFA 5ELGA 2VO4A 3Q18A 5JCWA 3RHCA 3F8UA 2H1GA 4ZBDA 4QL7A 1U3AA 1CQHA 4LMVA 2O89A 2R37A 2QSIA 3HZ8A 3IA1A 4HU7A 1OYJA 2R3XA 5ECSA 3TRPA 4EC0A 2IMKA 1TRVA 1URMA 3H8QA 5EVOA 4EVMA 2ZUPA 4K8MA 3VI7A 2VD0A 2MBSA 3VI5A 2IL3A 2XC2A 2NVLA 5HR0A 4TVEA 2C1YA 5COHA 2V1MA 19GSA 1U6TA 4KDUA 4MZWA 2VD1A 1ERUA 4XS6A 1AAZA 3A3TA 2FWHA 11GSA 1DBYA 2D2ZA 3LXZA 4E8HA 3M9KA 4D73B 5G5FA 3FK8A 4XTSA 1BAYA 3LSZA 4KW6A 1MDKA 4ZXGA 3MDKA 3TDGA 3KH9A 4MNNA 2VCZA 1AIUA 1GSYA 4ACSA 4XHMA 5A4VA 5CNWA 5DALB 1M2BA 5J9CA 1R4WA 3L9SA 3KP9A 3JCML 1YEXA 1XW6A 2B1KA 2RUFA 2PU9C 4J56E 3MAKA 2RIIA 2OBKA 1B4QA 2GTUA 3H4KA 2I4AA 4O7HA 2CZ3A 2H1DA 3KTLA 3ZYWA 1QUWA 2AYTA 2GS3A 3HYPA 3K8NA 4BL7B 1S3CA 1NW2A 5IIZA 5D9TA 1XFLA 1BYEA 4X0XA 1OC9B 3J7Yk 3L9UA 4HZ4A 2A2SA 1G0TA 2ZNMA 3UIWA 22GSA 4TR3A 4ECJA 2VLUA 4H86A 1T7PB 5D9XA 5AGYA 5CREA 4Z2TA 4PX1A 5H5RA 3M3MA 5F06A 4V2MA 4ML6A 1K0CA 4N0ZA 1THXA 2RM6A 4Z2RA 1TTZA 1A23A 5ID2A 1UC7A 4GXZA 3L78A 1AQXA 3TJJA 2OE3A 1VF3A 2IMDA 2CT6A 2KOKA 2GSRA 4NWYA 1TW9A 3G7YA 1M7TA 4MJAA 1GLPA 5A4WA 4HDEA 3QOUA 2K18A 1AC1A 1A0RP 3WGDA 1QQ2A 4KAEA 2K8SA 4WETA 1K0AA 5KN2A 4TRXA 1WIKA 5JWRB 4FO5A 2A2RA 2YJ7A 3PPUA 5CO3A 2J23A 1BG5A 3O76A 2AV4A 3NIVA 4MH3A 2DKIA 3APSA 4PQ1A 5IMZA 2G2QA 2MYGA 1M9BA 4Z2UA 2TRXA 2ZCTA 4IBPA 5F07A 3H79A 3ED3A 2DJKA 4X43A 4XCSA 4ML1A 3P90A 1BX9A 2RUEA 4K9ZA 3TKSC 1SU9A 2LRNA 1JLWA 3U5RE 3W6GA 3QMXA 4LLRA 3FZ4A 5B7CA 5DQYA 4LMWA 2GQLA 4YQVA 1TXXA 1BQ7A 2XPDA 3FYGA 4YKFA 2H6XA 3UVHA 4EXJA 2DSAA 1ON4A 2WS2A 2VCVA 3MSZA 4E8EA 4XRAA 3EINA 3FR9A 3HVVA 1JZOA 1PX7A 2YV9A 1DE2A 1YEPA 4TR4A 2O8VB 4I5QA 2LKUA 3WGEA 3HCZA 3A2VA 5ECIB 2FD3A 2CVBA 4K7IA 5G31A 1GULA 14GSA 1SYRA 3FEUA 5G1LA 4J57E 4XS1A 6GSYA 2IMIA 2GSQA 2UZ8A 1HYUA 4MABA 3TJFA 4XS4B 2LJRA 4OD7A 1TP9A 1UN2A 5KN1A 3WT1A 3RBTA 2WB9A 3KGKA 1FW1A 5C00A 1RQMA 2VL2A 1PGTA 4TOPA 2WJUA 5D9WA 2B5EA 4MK3A 3E9JB 5HR1A 1KTEA 4JU5A 4BA7A 2H0GA 3P2AA 2HRFA 2EC4A 4IW9A 1MDIA 3HVXA 3IDVA 3G7IA 3BJ5A 5A4UA 4ECBA 3CSHA 4BL7A 3EWLA 3ZIVA 2YCDA 2LNSA 2M72A 1AXDA 1DSBA 2B5XA 2HNLA 1EGOA 2LV3A 4ZB8A 3BD2A 3HA9A 3APOA 2JACA 1EGRA 1F37A 1YDKA 4WXTA 1SK2A 2PMTA 4WF5A 3Q19A 3CRTA 5EL8A 2YWNA 2FGXA 2N5AA 4FQUA 1FOHA 1LJRA 3HZ4A 2OE0A 3KTBA 1AW9A 8GSSA 1A2LA 5ECNB 1V98A 1BEDA 4MF5A 3ZLPA 4BWQA 3WD6A 2E2GA 3D6IA 4GQCA 3UEMA 5F8BA 3VK9A 4KB3A 4RQRA 4XIHA 2IMEA 2RM5A 3RHBA 4IS0A 5AISA 3ME8A 1PSQA 1ZYPA 3V1WA 4MMMA 1J9BA 1WRYA 3VWWA 2C3QA 1GUHA 5AN1A 4LL1B 6GSTA 4IVFA 2F8FA 1G7OA 1YJ6A 4KGIA 3FZ9A 5IOXA 1XWKA 3D4TA 2LQQA 5DCGA 2V6OA 2VCXA 2MZCA 4N0VA 5CRWA 2HSHA 2YANA 5FWGA 4F0BA 3GFKA 3DIEA 1HNCA 3CXGA 3E3EA 1SJIA 4BVXB 2X99A 1EOHA 3I6AA 1O73A 2H1AA 2L5LA 3TOTA 2DMMA 4KSMA 1J0FA 1XPVA 1OC8A 4K7NA 1YKCA 1K0BA 3KXOA 4DSQA 2XBQA 1B8XA 2DC5A 4BPYA 1GH2A 3IV4A 1S3DA 2AUVA 5JWQB 4TXOB 1SD8A 4GF0A 2REMA 3LG6A 5ECLB 2YZHA 1V2AA 3GKMA 3GSTA 5DBQA 4GRFA 2PVQA 2WGRA 1A2JA 3C73A 3EPTA 4GWRA 4RI7A 1Y25A 4JR6A 2CVKA 4TR1B 1MD3A 1V58A 2HYXA 1YF1A 1JZRA 2LNTA 3UAPA 3EMPA 2HLSA 3R2QA 5ECQB 4L5OA 4TXVA 3N9JA 1WOUA 1EV4A 4GSSA 2HZFA 2HZEB 2BMXA 1OVNA 2O7KA 4DSSB 5AIXA 1YKAA 5J5NA 3CTFA 2H6ZA 2IIYA 2QA1A 5GZZB 4ZBBA 5IO0A 3UBKA 1B4PA 2HRNA 3MWHA 4G0LA 2IJYA 3G7JA 4NAXA 2GZPA 1O81A 2C80A 2H71A 5IPGA 2WULA 1WE0A 2X8HA 2GLRA 2JZRA 5H5SA 2L5OA 1X9MB 5D73A 2NTOA 1HNAA 3QAVA 2KUCA 3GSSA 2O87A 1ZMAA 4JZQA 1Y6EA 2PN8A 4WEYA 3VPQA 4YQUA 4CY8A 1T4ZA 3ZVJD 1ZZYA 3HJPA 5D96A 1OAZA 2OE1A 4YAVA 2WDUA 2I9HA 2YZUA 5FT3A 3C1SA 4YH2A 3W8SA 2F8AA 1SL0B 1EV9A 2K6VA 5GSTA 4HUAA 3UJ1A 3FMWA 3KCMA 4K6XA 3F3QA 4CY6A 2DLXA 4RUVA 2QC7A 2DMLA 1XCCA 2VOCA 4MPGA 4MA9A 3DEXA 5HFKA 4NHWA 3KP8A 3HKRA 4PNGA 1E6BA 3LEFA 3L4NA 3KH7A 3D0ZA 1U3IA 3UL3A 1QK8A 2FNOA 5BMUA 2FUG2 3ERGA 1Z5YE 2DJJA 5E59A 5GSSA 5IMDA 2NDOA 4EL1A 5IOWA 3OR5A 1OKDA 5KN3A 4K7OA 3GRXA 2GT5A 2X8GA 5IQYA 5HR3A 4IKHA 1ZYEA 5JWOB 4KUNA 2V2GA 1JLVA 2OACA 4EIPA 3F4SA 3A5WA 3GKKA 1XWAA 2HSMA 4WF4A 2GQMA 2FLSA 3DVXA 4KA0A 1GSDA 4AJ6A 2AJQB 4ZB9A 1G6WA 3KD0A 5IMVA 2QA2A 3TUEA 2DJ0A 5DJMA 1N2AA 4MH2A 3GMFA 1ILOA 4IQAA 3ERFA 3CYNA 4HOJA 1O6JA 3F0IA 1ERWA 1B9YC 5IM9A 5IPHA 2J9HA 3S9FA 2OA7A 2C0DA 5DAKB 1TK5B 1XOAA 1IYIA 4JEDA 1SK0A 3DWVA 3QAGA 2F3MA 4IP6A 1PQNA 1X0RA 2LUSA 4TR1A 2VLVA 4POBA 1AQWA 1PRXA 1WPIA 1Q4JA 2GSSA 3FHKA 2VCTA 4Z7XA 1R26A 2H01A 3RDWA 3DGQA 3LORA 1A2MA 2GVPA 1WMJA 1UVZA 3FW2A 5GAND 2HZEA 5ECRB 3BCIA 4MCUA 5FHIA 1H75A 1UA5A 1YQ1A 4LL4B 2MMZA 3Q6OA 2O85A 4CDOA 2B3SA 4G19A 2VAFA 3IK7A 3A2WA 3EMXA 2CQ9A 3CTGA 2HE3A 3IPZA 3WGXA 1EP7A 3F9UA 4MP4A 2R0GA 4AGSA 3GTUB 1QMVA 4F03A 2IMFA 2HXKA 2DKHA 1K3YA 1W89A 5HFGA 1GUKA 1RK4A 2GGTA 4NMUA 4WR4A 2YWIA 3TCOA 1O8WA 3LFLA 1FVJA 4RQXA 2H76A 2GSTA 1O85A 3HY2A 5JCUA 2OBIA 4L0UA 4WKWA 4NV5A 4OCFA 4L5LA 1PX6A 5ECOB 1CQGA 1ERTA 3I69A 2C8UA 3TKSA 4PXOA 4NV2A 2VCWA 1FOVA 4OWYA 3ZIJA 4LA1A 2C4JA 1H4OA 2PUKC 3ZREA 4ZL7A 4J2FA 3E0UA 3TKSE 1FVKA 3TOUA 2CX4A 1PN9A 4IJ3A 1Z7PA 1A0FA 1EWXA 3TJKA 3TRQA 3QFBC 3UOMA 1TK8B 4ZBAA 1SENA 5CYYA 6GSUA 6GSWA 4D73A 4PURA 2FWGA 4N30A 1LBKA 3M0FA 2EIQA 2B5YA 3TGZA 4IQ1A 2CX3A 3C7MA 4F0CA 1KBNA 5DALA 3VPTA 3R3EA 1V40A 1WP0A 2HRAA 3BCKA 4P3YB 3F63A 3GKNA 4EF0A 2R0CA 1I9DA 4GLTA 5H5QA 2VCQA 4K0NA 3EVIA 1GNEA 2B6MA 1AQVA 6GSVA 5HQPA 2OADA 4JE1A 1F9MA 2I3YA 3F4RA 1PKZA 1XXUA 2N5FA 3QFAC 4F82A 2CA8A 1PD21 4MJEA 2H19A 4ZB6A 1SK1A 5B8AA 2P0GA 3FY7A 4IELA 5IMCA 1OC9A 5BRTA 3KJYA 3C71A 2H30A 1Z7RA 5LCZA 1GNWA 5KOXA 3M9JA 5DQSA 3BOAA 3IHGA 1R7HA 4JBBA 1JZDA 2E7PA 3DVWA 1M0UA 4FH8A 4ULXA 4DVCA 3EC3A 1SKWB 2I1UA 4FYCA 2GT6A 2H72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUM A;  4PGT A;  5GAP D;  1GSF A;  4ZIL A;  3NZN A;  3ZFL A;  4KND A;  2H8L A;  1Z3E A;  3HVS A;  3RPN A;  2YJH A;  5J3R A;  2C3N A;  2DJ3 A;  5IMA A;  2GZZ A;  5B6M A;  3G9B A;  2PBJ A;  3DD3 A;  2XPE A;  3WYW A;  2X8C A;  3CMI A;  5F05 A;  1OC3 A;  3L0H A;  1GLQ A;  4ID0 A;  3U6V A;  1MD4 A;  3UAR A;  3GL3 A;  4Q5F A;  2YWM A;  3IC4 A;  2VM2 A;  2P31 A;  3IK9 A;  3DRN A;  4EKZ A;  5LD0 A;  1T3B A;  1KEB A;  2MMO A;  4POM A;  1EZK A;  4HJ2 A;  2RLI A;  1DE1 A;  1HD2 A;  4KSO A;  1OKT A;  5G2Z A;  5B8B A;  2HSY A;  2LST A;  2DIZ A;  1GTU A;  1TRS A;  2E0Q A;  2F9S A;  4V1A g;  5CRH A;  3TKQ A;  1GSQ A;  2GQK A;  3QAW A;  1THO A;  3GN3 A;  1F3A A;  2DJ2 A;  1GTB A;  4OO5 A;  3IOS A;  2YNX A;  3F4T A;  5J9B A;  4POK A;  5B6N A;  4X1U A;  5J4U A;  2XBI A;  4O5R A;  1J08 A;  3EUR A;  1G6Y A;  3ZZX A;  2H0I A;  4F2I A;  1YZX A;  2E2M A;  9GSS A;  3GA4 A;  4MJC A;  4XS4 A;  1TJD A;  1VGL A;  4KDX A;  2L6D A;  1F3B A;  4G2E A;  4PQH A;  3LJR A;  3GHA A;  3ZVJ A;  4AJ8 A;  2WZ9 A;  1GL8 A;  2VIM A;  3VUR A;  4GTU A;  1XOB A;  2HT9 A;  3GX8 A;  2LJA A;  3PH9 A;  5ECH B;  3HDC A;  2FA4 A;  3ZRD A;  2FWE A;  4ISD A;  4YQM A;  1ZGN A;  3TB2 A;  1Z6M A;  5KN0 A;  3D4M A;  3GUS A;  2CAQ A;  2CV4 A;  3VWU A;  13GS A;  1XIY A;  1O8X A;  2JU5 A;  1N8J A;  3AY8 A;  3M8N A;  3GYK A;  3FZA A;  1VF1 A;  4FIW A;  2JZS A;  1TDI A;  3ISO A;  5G1K A;  3SBC A;  1PMT A;  4O32 A;  4Q5R A;  1TOF A;  2X64 A;  5D93 A;  3IAS 2;  2BJX A;  4V1A p;  3GV1 A;  1OE7 A;  1ZOF A;  2DIY A;  4WBR D;  2P5R A;  3N5O A;  2C3T A;  3CSJ A;  1PL2 A;  1U88 A;  3HJM A;  3ZTL A;  1GSS A;  2K9F A;  4HJM A;  2L59 A;  2H70 A;  2ON5 A;  3VWV A;  4HU9 A;  1VF2 A;  5DVB A;  1QFN A;  4K0G A;  3HJO A;  2YV7 A;  1ABA A;  3DML A;  4MDC A;  2AAW A;  1USB A;  16GS A;  3M1G A;  3KEB A;  4G9H A;  2MMA A;  3QPM A;  3IBH A;  2C0E A;  2HFD A;  3ZMK A;  4ILF A;  4OMV A;  4HI7 A;  1TU8 A;  3LXT A;  3C8E A;  4IHU A;  5ELA A;  4WBJ A;  4MF6 A;  4DEJ A;  3IE3 A;  1G7E A;  2OKA A;  3LQ7 A;  4Q5N A;  1Z9H A;  2PVO C;  1SKR B;  3L9V A;  4I2T A;  5CRG A;  1T00 A;  4AF2 A;  5IO2 A;  4GQF A;  2JSY A;  3IAM 2;  2VL3 A;  2M46 A;  2CVD A;  2B7K A;  2JZT A;  4GCI A;  3IHQ A;  3TJG A;  2C0F A;  3IXR A;  1XWG A;  1VRS D;  3KZQ A;  1BJX A;  4IJI A;  2LJK A;  3CBU A;  1U87 A;  2YWO A;  2R5G A;  3PGT A;  4BVX A;  4NPB A;  1ERV A;  1X5C A;  3I9V 2;  3DKS A;  1MEK A;  2JAD A;  2QGV A;  1XVW A;  1TK0 B;  4MZB A;  3RPP A;  1SKS B;  1HNB A;  3D5J A;  3LGC A;  4ZL8 A;  4YAP A;  2VM1 A;  4JRR A;  2L6C A;  2FA8 A;  1TU7 A;  1K0O A;  3LYK A;  4QQ7 A;  3C1R A;  2K8V A;  1GSU A;  2KP2 A;  1KNG A;  3TKP A;  4TXO A;  4MJB A;  7GSS A;  1JHB A;  2G0F A;  4N10 A;  1XW5 A;  2KLX A;  2V6K A;  3J7Y b;  1WJK A;  3P7X A;  2PPT A;  2FWF A;  3F6D A;  5JCG A;  3UBL A;  3RAZ A;  3GH9 A;  2PWJ A;  1T4Y A;  1RW1 A;  4V2N A;  1K0N A;  5CP1 A;  3P8W A;  1YY7 A;  2VL9 A;  4BWS A;  4KDY A;  1XZO A;  4TW5 A;  1B9X C;  4MZC A;  5ECK B;  6GSX A;  1EOG A;  4HQS A;  4I2U A;  4HQZ A;  4ZL9 A;  4ECI A;  4DSS A;  5L71 A;  1GRX A;  5EY6 A;  2H66 A;  2TIR A;  3TKR A;  3A2X A;  10GS A;  1FO5 A;  2I81 A;  3FZ5 A;  2IFQ B;  3GH6 A;  4OFN A;  4I8B A;  1GSE A;  2DBC A;  4QL9 A;  2A4V A;  2IN3 A;  1SJ6 A;  1MDJ A;  3LWA A;  5INY A;  3EU3 A;  2XHF A;  4L0W A;  4IP1 A;  4OFM A;  2R4V A;  1DUG A;  1JFU A;  2QKE A;  4V2L A;  1NHY A;  4EDY A;  1VF4 A;  1NSW A;  4GSN A;  4MPF A;  4HEA 2;  2Z9S A;  3HD5 A;  3TJB A;  1OE8 A;  4KCA A;  1TRU A;  1NHO A;  1FB0 A;  3UMA A;  5ECP B;  3UVT A;  5J41 A;  2PER A;  2DJ1 A;  4K2D A;  2WRT A;  1K3L A;  2NBS A;  4KCE A;  1Z6N A;  2JSZ A;  1X9W B;  5D8I A;  1Q98 A;  2GDR A;  3FRC A;  4JR4 A;  2F51 A;  3ZL5 A;  4I6X A;  1PKW A;  3DXB A;  4WR5 A;  2H75 A;  2MMN A;  2IPA A;  3Q74 A;  2L4C A;  3O3T A;  4IN0 A;  4HZ2 A;  3ME7 A;  5HR2 A;  3W8J A;  4F9Z A;  4G10 A;  5ECM B;  18GS A;  2YP6 A;  2YN1 A;  3GL5 A;  2PGT A;  2AHE A;  2R6K A;  1B48 A;  1GTI A;  5C04 A;  3I43 A;  12GS A;  1TKD B;  1F6M C;  6GSS A;  1K0D A;  4CHS A;  2KHP A;  4GST A;  1PL1 A;  1K0M A;  4RI6 A;  3D21 A;  1EEM A;  1PA3 A;  1M9A A;  1A8Y A;  2VL2 C;  4K1F A;  1XVQ A;  1WWJ A;  1LU4 A;  2AB6 A;  1IYH A;  2LRC A;  2V32 A;  2ALB A;  3WT2 A;  1HQO A;  5IMF A;  4KX4 A;  2KP1 A;  3QDN A;  4TKY A;  1A8L A;  5CAX A;  5CRD A;  4EDZ A;  3ZIT A;  1TI3 A;  4L8E A;  4PNF A;  2WFC A;  2EIR A;  2MBT A;  3BBY A;  2H73 A;  5ENU A;  5G30 A;  3PIN A;  1XWB A;  2FY6 A;  3F3R A;  2P5Q A;  2YPM A;  3DYR A;  1GP1 A;  5DAK A;  3HHV A;  2CZ2 A;  5DCH A;  1MTC A;  3CRU A;  1W4V A;  1E2Y A;  1SL1 B;  4EE0 A;  5A5K A;  2B1L A;  1SJZ A;  1F2E A;  4O92 A;  4N11 A;  2TRC P;  3TRX A;  1X9S B;  2N5B A;  1T8E B;  5AIV A;  3NOF A;  2C0G A;  4KE3 A;  3GIX A;  3US3 A;  5E4W A;  2IFQ A;  2L57 A;  2R2J A;  4TR0 A;  5KEJ A;  1X5E A;  1M2A A;  1YF0 A;  2LRT A;  4KH7 A;  2H1B A;  2M80 A;  4NHZ A;  2NPB A;  4NXI A;  3EU4 A;  4IGJ A;  3GTU A;  1TRW A;  1GTA A;  2BTO T;  3H1N A;  1S3A A;  3QR6 A;  3ERW A;  4I97 A;  4MLY A;  1QGV A;  1M99 A;  4PQI A;  2OJL A;  1T1V A;  1SL2 B;  3ZFB A;  4OFT A;  3F6F A;  2VUP A;  3ZML A;  2HI7 A;  5HFI A;  2FCH A;  2LEG A;  4ZIJ A;  3VLN A;  2EIO A;  17GS A;  4OCE A;  3VFI A;  2LS5 A;  1O7U A;  3IRA A;  2L4Q A;  3GX0 A;  4CW9 A;  3EYT A;  1ST9 A;  1I5G A;  2ES7 A;  5DJL A;  5EPF A;  2CAI A;  2WCI A;  3EE2 A;  3MNG A;  4BVY A;  1X5D A;  1A24 A;  3KM6 A;  2VLT A;  1ACV A;  5DDL A;  3QD9 A;  1V9W A;  3O6T A;  2ON7 A;  4MF7 A;  4EUY A;  1C72 A;  3CSI A;  2B7J A;  3HXS A;  4POL A;  2GZY A;  4ECC A;  2LQO A;  1JZW A;  3VWX A;  1SYX A;  1TI1 A;  2YOI A;  1ZCP A;  1AUC A;  5ABR A;  1XW9 A;  4OO4 A;  1M2D A;  1FB6 A;  1R5P A;  1K3O A;  4DSR A;  1EP8 A;  3LYP A;  2H0H A;  5ID2 B;  3GUR A;  1GWC A;  4PUF C;  1ZL9 A;  4HS1 A;  1EEJ A;  4FYB A;  5G5E A;  2H6Y A;  20GS A;  3FR3 A;  3APQ A;  1V57 A;  1SD9 A;  4Q5Q A;  1XWC A;  4TN8 A;  3SWL A;  3KMO A;  1FG4 A;  3D22 A;  2H74 A;  3FR6 A;  3GNJ A;  3H93 A;  1ML6 A;  1FAA A;  5D9V A;  2V41 A;  4PUA A;  3KIJ A;  2FHE A;  4FYU A;  1FHE A;  1R5A A;  4XRD A;  1XBS A;  2IWT A;  3QCP A;  5F0G A;  3PR8 A;  4EO3 A;  1QXH A;  3KMN A;  1ZYQ B;  1NM3 A;  4AJ7 A;  2LTK A;  3GKX A;  3IR4 A;  5LNK e;  2JL4 A;  3FKF A;  5ELG A;  2VO4 A;  3Q18 A;  5JCW A;  3RHC A;  3F8U A;  2H1G A;  4ZBD A;  4QL7 A;  1U3A A;  1CQH A;  4LMV A;  2O89 A;  2R37 A;  2QSI A;  3HZ8 A;  3IA1 A;  4HU7 A;  1OYJ A;  2R3X A;  5ECS A;  3TRP A;  4EC0 A;  2IMK A;  1TRV A;  1URM A;  3H8Q A;  5EVO A;  4EVM A;  2ZUP A;  4K8M A;  3VI7 A;  2VD0 A;  2MBS A;  3VI5 A;  2IL3 A;  2XC2 A;  2NVL A;  5HR0 A;  4TVE A;  2C1Y A;  5COH A;  2V1M A;  19GS A;  1U6T A;  4KDU A;  4MZW A;  2VD1 A;  1ERU A;  4XS6 A;  1AAZ A;  3A3T A;  2FWH A;  11GS A;  1DBY A;  2D2Z A;  3LXZ A;  4E8H A;  3M9K A;  4D73 B;  5G5F A;  3FK8 A;  4XTS A;  1BAY A;  3LSZ A;  4KW6 A;  1MDK A;  4ZXG A;  3MDK A;  3TDG A;  3KH9 A;  2VCZ A;  1AIU A;  1GSY A;  4ACS A;  4XHM A;  5A4V A;  5CNW A;  5DAL B;  1M2B A;  5J9C A;  1R4W A;  3L9S A;  3KP9 A;  3JCM L;  1YEX A;  1XW6 A;  2B1K A;  2RUF A;  2PU9 C;  4J56 E;  3MAK A;  2RII A;  2OBK A;  1B4Q A;  2GTU A;  3H4K A;  2I4A A;  4O7H A;  2CZ3 A;  2H1D A;  3KTL A;  3ZYW A;  1QUW A;  2AYT A;  2GS3 A;  3HYP A;  3K8N A;  1S3C A;  1NW2 A;  5IIZ A;  5D9T A;  1XFL A;  1BYE A;  4X0X A;  1OC9 B;  3J7Y k;  3L9U A;  4HZ4 A;  2A2S A;  1G0T A;  2ZNM A;  3UIW A;  22GS A;  4TR3 A;  4ECJ A;  2VLU A;  4H86 A;  1T7P B;  5D9X A;  5AGY A;  5CRE A;  4PX1 A;  5H5R A;  3M3M A;  5F06 A;  4V2M A;  4ML6 A;  1K0C A;  4N0Z A;  1THX A;  2RM6 A;  1TTZ A;  1A23 A;  5ID2 A;  1UC7 A;  4GXZ A;  3L78 A;  1AQX A;  3TJJ A;  2OE3 A;  1VF3 A;  2IMD A;  2CT6 A;  2KOK A;  2GSR A;  4NWY A;  1TW9 A;  3G7Y A;  1M7T A;  4MJA A;  1GLP A;  5A4W A;  4HDE A;  3QOU A;  2K18 A;  1AC1 A;  1A0R P;  3WGD A;  1QQ2 A;  4KAE A;  2K8S A;  4WET A;  1K0A A;  5KN2 A;  4TRX A;  1WIK A;  5JWR B;  4FO5 A;  2A2R A;  2YJ7 A;  5CO3 A;  2J23 A;  1BG5 A;  3O76 A;  2AV4 A;  3NIV A;  4MH3 A;  3APS A;  4PQ1 A;  5IMZ A;  2G2Q A;  2MYG A;  1M9B A;  2TRX A;  2ZCT A;  4IBP A;  5F07 A;  3H79 A;  3ED3 A;  2DJK A;  4X43 A;  4XCS A;  4ML1 A;  3P90 A;  1BX9 A;  2RUE A;  4K9Z A;  3TKS C;  1SU9 A;  2LRN A;  1JLW A;  3U5R E;  3W6G A;  3QMX A;  4LLR A;  3FZ4 A;  5B7C A;  5DQY A;  4LMW A;  2GQL A;  4YQV A;  1TXX A;  1BQ7 A;  2XPD A;  3FYG A;  2H6X A;  3UVH A;  4EXJ A;  2DSA A;  1ON4 A;  2WS2 A;  2VCV A;  3MSZ A;  4E8E A;  4XRA A;  3EIN A;  3FR9 A;  3HVV A;  1JZO A;  1PX7 A;  2YV9 A;  1DE2 A;  1YEP A;  4TR4 A;  2O8V B;  4I5Q A;  2LKU A;  3WGE A;  3HCZ A;  3A2V A;  5ECI B;  2FD3 A;  2CVB A;  4K7I A;  5G31 A;  1GUL A;  14GS A;  1SYR A;  3FEU A;  5G1L A;  4J57 E;  4XS1 A;  6GSY A;  2IMI A;  2GSQ A;  1HYU A;  4MAB A;  3TJF A;  4XS4 B;  2LJR A;  4OD7 A;  1TP9 A;  1UN2 A;  5KN1 A;  3WT1 A;  3RBT A;  2WB9 A;  3KGK A;  1FW1 A;  5C00 A;  1RQM A;  2VL2 A;  1PGT A;  4TOP A;  2WJU A;  5D9W A;  2B5E A;  4MK3 A;  3E9J B;  5HR1 A;  1KTE A;  4JU5 A;  4BA7 A;  2H0G A;  3P2A A;  2HRF A;  2EC4 A;  4IW9 A;  1MDI A;  3HVX A;  3IDV A;  3G7I A;  3BJ5 A;  5A4U A;  4ECB A;  3CSH A;  4BL7 A;  3EWL A;  3ZIV A;  2YCD A;  2LNS A;  2M72 A;  1AXD A;  1DSB A;  2B5X A;  2HNL A;  1EGO A;  2LV3 A;  4ZB8 A;  3BD2 A;  3HA9 A;  3APO A;  2JAC A;  1EGR A;  1F37 A;  1YDK A;  4WXT A;  1SK2 A;  2PMT A;  4WF5 A;  3Q19 A;  3CRT A;  5EL8 A;  2YWN A;  2FGX A;  2N5A A;  1LJR A;  3HZ4 A;  2OE0 A;  3KTB A;  1AW9 A;  8GSS A;  1A2L A;  5ECN B;  1V98 A;  1BED A;  4MF5 A;  3ZLP A;  4BWQ A;  3WD6 A;  2E2G A;  3D6I A;  4GQC A;  3UEM A;  5F8B A;  3VK9 A;  4KB3 A;  4RQR A;  4XIH A;  2IME A;  2RM5 A;  3RHB A;  4IS0 A;  5AIS A;  3ME8 A;  1PSQ A;  3V1W A;  4MMM A;  1J9B A;  1WRY A;  3VWW A;  2C3Q A;  1GUH A;  5AN1 A;  4LL1 B;  6GST A;  4IVF A;  2F8F A;  1G7O A;  1YJ6 A;  4KGI A;  3FZ9 A;  5IOX A;  1XWK A;  3D4T A;  2LQQ A;  5DCG A;  2V6O A;  2VCX A;  2MZC A;  4N0V A;  5CRW A;  2HSH A;  2YAN A;  5FWG A;  4F0B A;  3GFK A;  3DIE A;  1HNC A;  3CXG A;  3E3E A;  1SJI A;  2X99 A;  1EOH A;  3I6A A;  1O73 A;  2H1A A;  2L5L A;  3TOT A;  2DMM A;  4KSM A;  1J0F A;  1XPV A;  1OC8 A;  4K7N A;  1YKC A;  1K0B A;  3KXO A;  4DSQ A;  2XBQ A;  1B8X A;  2DC5 A;  4BPY A;  1GH2 A;  3IV4 A;  1S3D A;  2AUV A;  5JWQ B;  4TXO B;  1SD8 A;  4GF0 A;  2REM A;  3LG6 A;  5ECL B;  2YZH A;  1V2A A;  3GKM A;  3GST A;  5DBQ A;  4GRF A;  2PVQ A;  2WGR A;  1A2J A;  3C73 A;  4GWR A;  4RI7 A;  1Y25 A;  4JR6 A;  2CVK A;  4TR1 B;  1MD3 A;  1V58 A;  2HYX A;  1YF1 A;  1JZR A;  2LNT A;  3UAP A;  3EMP A;  2HLS A;  5ECQ B;  3R2Q A;  4L5O A;  4TXV A;  3N9J A;  1WOU A;  1EV4 A;  4GSS A;  2HZF A;  2HZE B;  2BMX A;  1OVN A;  2O7K A;  4DSS B;  5AIX A;  1YKA A;  5J5N A;  3CTF A;  2H6Z A;  2IIY A;  5GZZ B;  4ZBB A;  5IO0 A;  3UBK A;  1B4P A;  2HRN A;  3MWH A;  2IJY A;  3G7J A;  4NAX A;  2GZP A;  1O81 A;  2C80 A;  2H71 A;  5IPG A;  2WUL A;  1WE0 A;  2X8H A;  2GLR A;  2JZR A;  5H5S A;  2L5O A;  1X9M B;  5D73 A;  2NTO A;  1HNA A;  3QAV A;  2KUC A;  3GSS A;  2O87 A;  1ZMA A;  4JZQ A;  1Y6E A;  2PN8 A;  4WEY A;  3VPQ A;  4YQU A;  1T4Z A;  3ZVJ D;  1ZZY A;  3HJP A;  5D96 A;  1OAZ A;  2OE1 A;  4YAV A;  2WDU A;  2I9H A;  2YZU A;  5FT3 A;  3C1S A;  4YH2 A;  3W8S A;  2F8A A;  1SL0 B;  1EV9 A;  2K6V A;  5GST A;  4HUA A;  3UJ1 A;  3KCM A;  4K6X A;  3F3Q A;  2DLX A;  4RUV A;  2QC7 A;  2DML A;  1XCC A;  2VOC A;  4MPG A;  4MA9 A;  3DEX A;  5HFK A;  4NHW A;  3KP8 A;  3HKR A;  4PNG A;  1E6B A;  3LEF A;  3L4N A;  3KH7 A;  3D0Z A;  1U3I A;  3UL3 A;  1QK8 A;  2FNO A;  2FUG 2;  3ERG A;  1Z5Y E;  2DJJ A;  5E59 A;  5GSS A;  5IMD A;  2NDO A;  4EL1 A;  5IOW A;  3OR5 A;  1OKD A;  5KN3 A;  4K7O A;  3GRX A;  2GT5 A;  2X8G A;  5IQY A;  5HR3 A;  4IKH A;  1ZYE A;  5JWO B;  4KUN A;  2V2G A;  1JLV A;  2OAC A;  3F4S A;  3A5W A;  3GKK A;  1XWA A;  4WF4 A;  2GQM A;  2FLS A;  3DVX A;  4KA0 A;  1GSD A;  4AJ6 A;  2AJQ B;  4ZB9 A;  1G6W A;  3KD0 A;  5IMV A;  3TUE A;  2DJ0 A;  5DJM A;  1N2A A;  4MH2 A;  3GMF A;  1ILO A;  4IQA A;  3ERF A;  3CYN A;  4HOJ A;  1O6J A;  3F0I A;  1ERW A;  1B9Y C;  5IM9 A;  5IPH A;  2J9H A;  3S9F A;  2OA7 A;  2C0D A;  5DAK B;  1TK5 B;  1XOA A;  1IYI A;  4JED A;  1SK0 A;  3DWV A;  3QAG A;  2F3M A;  4IP6 A;  1PQN A;  1X0R A;  2LUS A;  4TR1 A;  2VLV A;  4POB A;  1AQW A;  1PRX A;  1WPI A;  1Q4J A;  2GSS A;  3FHK A;  2VCT A;  4Z7X A;  1R26 A;  2H01 A;  3RDW A;  3DGQ A;  3LOR A;  1A2M A;  2GVP A;  1WMJ A;  1UVZ A;  3FW2 A;  5GAN D;  2HZE A;  5ECR B;  3BCI A;  4MCU A;  5FHI A;  1H75 A;  1UA5 A;  1YQ1 A;  4LL4 B;  2MMZ A;  3Q6O A;  2O85 A;  4CDO A;  2B3S A;  4G19 A;  2VAF A;  3IK7 A;  3A2W A;  3EMX A;  2CQ9 A;  3CTG A;  2HE3 A;  3IPZ A;  3WGX A;  1EP7 A;  3F9U A;  4MP4 A;  4AGS A;  3GTU B;  1QMV A;  4F03 A;  2IMF A;  2HXK A;  1K3Y A;  1W89 A;  5HFG A;  1GUK A;  1RK4 A;  2GGT A;  4NMU A;  4WR4 A;  2YWI A;  3TCO A;  1O8W A;  3LFL A;  1FVJ A;  4RQX A;  2H76 A;  2GST A;  1O85 A;  3HY2 A;  5JCU A;  2OBI A;  4L0U A;  4WKW A;  4NV5 A;  4OCF A;  4L5L A;  1PX6 A;  5ECO B;  1CQG A;  1ERT A;  3I69 A;  2C8U A;  3TKS A;  4PXO A;  4NV2 A;  2VCW A;  1FOV A;  4OWY A;  3ZIJ A;  4LA1 A;  2C4J A;  1H4O A;  2PUK C;  3ZRE A;  4ZL7 A;  4J2F A;  3E0U A;  3TKS E;  1FVK A;  3TOU A;  2CX4 A;  1PN9 A;  4IJ3 A;  1Z7P A;  1A0F A;  1EWX A;  3TJK A;  3TRQ A;  3QFB C;  3UOM A;  1TK8 B;  4ZBA A;  1SEN A;  5CYY A;  6GSU A;  6GSW A;  4D73 A;  4PUR A;  2FWG A;  4N30 A;  1LBK A;  3M0F A;  2EIQ A;  2B5Y A;  3TGZ A;  4IQ1 A;  2CX3 A;  3C7M A;  4F0C A;  1KBN A;  5DAL A;  3VPT A;  1V40 A;  1WP0 A;  3BCK A;  4P3Y B;  3F63 A;  3GKN A;  4EF0 A;  1I9D A;  4GLT A;  5H5Q A;  2VCQ A;  4K0N A;  3EVI A;  1GNE A;  2B6M A;  1AQV A;  6GSV A;  5HQP A;  2OAD A;  4JE1 A;  1F9M A;  2I3Y A;  3F4R A;  1PKZ A;  1XXU A;  2N5F A;  3QFA C;  4F82 A;  2CA8 A;  1PD2 1;  4MJE A;  2H19 A;  4ZB6 A;  1SK1 A;  5B8A A;  2P0G A;  3FY7 A;  4IEL A;  5IMC A;  1OC9 A;  3KJY A;  3C71 A;  2H30 A;  1Z7R A;  5LCZ A;  1GNW A;  3M9J A;  5DQS A;  3BOA A;  1R7H A;  4JBB A;  1JZD A;  2E7P A;  3DVW A;  1M0U A;  4FH8 A;  4ULX A;  4DVC A;  3EC3 A;  1SKW B;  2I1U A;  4FYC A;  2GT6 A;  2H72 A; 
#chains in the Genus database with same CATH topology
 1GUM A;  4PGT A;  5GAP D;  1GSF A;  4ZIL A;  3A5I A;  3NZN A;  3ZFL A;  4KND A;  2H8L A;  1Z3E A;  3HVS A;  3RPN A;  2YJH A;  5J3R A;  2C3N A;  4K2X A;  2DJ3 A;  5IMA A;  2GZZ A;  5B6M A;  3G9B A;  2PBJ A;  3DD3 A;  2XPE A;  3WYW A;  2X8C A;  3CMI A;  5F05 A;  1OC3 A;  3L0H A;  1GLQ A;  4ID0 A;  3U6V A;  1MD4 A;  3UAR A;  3GL3 A;  4Q5F A;  2YWM A;  3IC4 A;  2VM2 A;  2P31 A;  3IK9 A;  3DRN A;  4EKZ A;  5LD0 A;  1T3B A;  1KEB A;  2MMO A;  4POM A;  1EZK A;  4HJ2 A;  2RLI A;  1DE1 A;  1HD2 A;  4KSO A;  1OKT A;  5G2Z A;  5B8B A;  2HSY A;  2LST A;  2DIZ A;  1GTU A;  1TRS A;  2E0Q A;  2F9S A;  4V1A g;  5CRH A;  3TKQ A;  1GSQ A;  2GQK A;  3QAW A;  1THO A;  3GN3 A;  1F3A A;  2DJ2 A;  1GTB A;  4OO5 A;  3IOS A;  2YNX A;  3F4T A;  4KF9 A;  5J9B A;  3IC8 A;  4POK A;  5B6N A;  4X1U A;  5J4U A;  2XBI A;  4O5R A;  1J08 A;  3EUR A;  1G6Y A;  3ZZX A;  2H0I A;  4F2I A;  1YZX A;  2E2M A;  9GSS A;  3GA4 A;  4MJC A;  4XS4 A;  1TJD A;  4A5P A;  1VGL A;  4KDX A;  2L6D A;  1F3B A;  4G2E A;  4PQH A;  3LJR A;  3GHA A;  3ZVJ A;  4AJ8 A;  2WZ9 A;  1GL8 A;  2VIM A;  3VUR A;  4GTU A;  1XOB A;  3MYD A;  2HT9 A;  3GX8 A;  2LJA A;  4YKG A;  3PH9 A;  5ECH B;  3HDC A;  2FA4 A;  3ZRD A;  2FWE A;  4ISD A;  4YQM A;  1ZGN A;  3TB2 A;  1Z6M A;  5KN0 A;  3D4M A;  3GUS A;  2CAQ A;  2CV4 A;  3VWU A;  13GS A;  1XIY A;  1O8X A;  2JU5 A;  1N8J A;  3AY8 A;  3M8N A;  3GYK A;  3FZA A;  1VF1 A;  4FIW A;  2JZS A;  1TDI A;  3ISO A;  5G1K A;  3SBC A;  1PMT A;  4O32 A;  4Q5R A;  1TOF A;  2X64 A;  5D93 A;  1PN0 A;  3IAS 2;  2BJX A;  4V1A p;  3GV1 A;  1OE7 A;  1ZOF A;  2DIY A;  4WBR D;  2P5R A;  3N5O A;  2C3T A;  3CSJ A;  1PL2 A;  4G0K A;  1U88 A;  3HJM A;  3ZTL A;  1GSS A;  2K9F A;  4HJM A;  2L59 A;  2H70 A;  2ON5 A;  3VWV A;  4HU9 A;  1VF2 A;  5DVB A;  1QFN A;  4K0G A;  3HJO A;  2YV7 A;  1ABA A;  3DML A;  4MDC A;  2AAW A;  1USB A;  16GS A;  3M1G A;  3KEB A;  4G9H A;  2MMA A;  3QPM A;  3IBH A;  2C0E A;  2HFD A;  3ZMK A;  4ILF A;  4OMV A;  4HI7 A;  1TU8 A;  3LXT A;  3C8E A;  4IHU A;  5ELA A;  4WBJ A;  4MF6 A;  4DEJ A;  3IE3 A;  1G7E A;  2OKA A;  3LQ7 A;  4Q5N A;  1Z9H A;  2PVO C;  1SKR B;  3L9V A;  4I2T A;  5CRG A;  1T00 A;  4AF2 A;  5IO2 A;  4GQF A;  2JSY A;  3IAM 2;  2VL3 A;  2M46 A;  2CVD A;  2B7K A;  2JZT A;  4GCI A;  3IHQ A;  3TJG A;  2C0F A;  2R0P A;  3IXR A;  1XWG A;  1VRS D;  3KZQ A;  1BJX A;  4IJI A;  2LJK A;  3CBU A;  1U87 A;  2YWO A;  2R5G A;  4K5R A;  3PGT A;  4X4J A;  4BVX A;  4NPB A;  1ERV A;  1X5C A;  3I9V 2;  3DKS A;  1MEK A;  2JAD A;  2QGV A;  1XVW A;  1TK0 B;  4MZB A;  3RPP A;  1SKS B;  1HNB A;  3D5J A;  3LGC A;  4ZL8 A;  4YAP A;  2VM1 A;  4JRR A;  2L6C A;  2FA8 A;  1TU7 A;  1K0O A;  3LYK A;  4QQ7 A;  3C1R A;  2K8V A;  1GSU A;  2KP2 A;  1KNG A;  3TKP A;  4TXO A;  4MJB A;  7GSS A;  1JHB A;  2G0F A;  4N10 A;  1XW5 A;  2KLX A;  2V6K A;  3J7Y b;  4O5Q A;  1WJK A;  3P7X A;  2PPT A;  2FWF A;  3F6D A;  5JCG A;  3UBL A;  3RAZ A;  3GH9 A;  2PWJ A;  1T4Y A;  1RW1 A;  4V2N A;  1K0N A;  4K5S A;  5CP1 A;  3P8W A;  1YY7 A;  2VL9 A;  4BWS A;  4KDY A;  1XZO A;  4TW5 A;  1B9X C;  4MZC A;  5ECK B;  6GSX A;  1EOG A;  4HQS A;  4I2U A;  4HQZ A;  4ZL9 A;  4ECI A;  4DSS A;  5L71 A;  1GRX A;  5EY6 A;  2H66 A;  2TIR A;  3TKR A;  3A2X A;  10GS A;  1FO5 A;  2I81 A;  3FZ5 A;  2IFQ B;  3GH6 A;  4OFN A;  4I8B A;  1GSE A;  2DBC A;  4QL9 A;  2A4V A;  2IN3 A;  1SJ6 A;  1MDJ A;  3LWA A;  5INY A;  3EU3 A;  2XHF A;  4L0W A;  4IP1 A;  4OFM A;  2R4V A;  1DUG A;  1JFU A;  2QKE A;  4V2L A;  1NHY A;  4EDY A;  1VF4 A;  1NSW A;  4GSN A;  4MPF A;  4HEA 2;  2Z9S A;  3HD5 A;  3TJB A;  1OE8 A;  4KCA A;  1TRU A;  1NHO A;  1FB0 A;  3UMA A;  5ECP B;  3UVT A;  5J41 A;  2PER A;  2DJ1 A;  4K2D A;  2WRT A;  1K3L A;  2NBS A;  4KCE A;  1Z6N A;  2JSZ A;  1X9W B;  5D8I A;  1Q98 A;  2GDR A;  3FRC A;  4JR4 A;  2F51 A;  3ZL5 A;  4I6X A;  1PKW A;  3DXB A;  4WR5 A;  2H75 A;  2MMN A;  2IPA A;  3Q74 A;  2L4C A;  4BVY B;  3O3T A;  4IN0 A;  4EIQ A;  4HZ2 A;  3ME7 A;  5HR2 A;  3W8J A;  4F9Z A;  4G10 A;  5ECM B;  18GS A;  2YP6 A;  2YN1 A;  3GL5 A;  2PGT A;  2AHE A;  2R6K A;  1B48 A;  1GTI A;  5C04 A;  3I43 A;  12GS A;  1TKD B;  1F6M C;  6GSS A;  1K0D A;  4CHS A;  2KHP A;  4GST A;  1PL1 A;  1K0M A;  4RI6 A;  3D21 A;  1EEM A;  3CQF A;  1PA3 A;  1M9A A;  1A8Y A;  2VL2 C;  4K1F A;  1XVQ A;  1WWJ A;  1LU4 A;  2AB6 A;  1IYH A;  2LRC A;  2V32 A;  2ALB A;  3WT2 A;  1HQO A;  5IMF A;  4KX4 A;  2KP1 A;  3QDN A;  4TKY A;  4ICY A;  1A8L A;  5CAX A;  1ZYN A;  5CRD A;  4EDZ A;  3ZIT A;  1TI3 A;  4L8E A;  4PNF A;  2WFC A;  2EIR A;  2MBT A;  3BBY A;  2H73 A;  5ENU A;  5G30 A;  3PIN A;  1XWB A;  2FY6 A;  2HRK A;  3F3R A;  2P5Q A;  2YPM A;  3DYR A;  1GP1 A;  5DAK A;  3HHV A;  2CZ2 A;  5DCH A;  1MTC A;  3CRU A;  1W4V A;  1E2Y A;  1SL1 B;  4EE0 A;  5A5K A;  2B1L A;  1SJZ A;  1F2E A;  4O92 A;  4N11 A;  2TRC P;  3TRX A;  1X9S B;  2N5B A;  1T8E B;  5AIV A;  3NOF A;  2C0G A;  4KE3 A;  3GIX A;  3US3 A;  5E4W A;  2IFQ A;  2L57 A;  2R2J A;  4TR0 A;  5KEJ A;  1X5E A;  1M2A A;  2A4H A;  1YF0 A;  2LRT A;  4KH7 A;  2H1B A;  2M80 A;  4NHZ A;  2NPB A;  4NXI A;  4O5U A;  3EU4 A;  4IGJ A;  5KOW A;  3GTU A;  1TRW A;  1GTA A;  2BTO T;  3H1N A;  2X4A A;  1S3A A;  3QR6 A;  3ERW A;  4I97 A;  4MLY A;  1QGV A;  1M99 A;  4PQI A;  2OJL A;  1T1V A;  4G0I A;  1SL2 B;  3ZFB A;  4OFT A;  3F6F A;  2VUP A;  3ZML A;  2HI7 A;  5HFI A;  3LW9 A;  2FCH A;  2LEG A;  4ZIJ A;  3VLN A;  2EIO A;  17GS A;  4PTS A;  4OCE A;  3VFI A;  2LS5 A;  1O7U A;  3IRA A;  2L4Q A;  3GX0 A;  4CW9 A;  3EYT A;  1ST9 A;  1I5G A;  4USS A;  2ES7 A;  5DJL A;  3MIX A;  5EPF A;  2CAI A;  2WCI A;  3EE2 A;  3MNG A;  4BVY A;  1X5D A;  1A24 A;  3KM6 A;  2VLT A;  1ACV A;  5DDL A;  3QD9 A;  1V9W A;  3O6T A;  2ON7 A;  4MF7 A;  4EUY A;  1C72 A;  3CSI A;  2B7J A;  3HXS A;  4POL A;  2GZY A;  4ECC A;  2LQO A;  1JZW A;  3VWX A;  1SYX A;  1TI1 A;  2YOI A;  1ZCP A;  1AUC A;  2X49 A;  5ABR A;  1XW9 A;  4OO4 A;  1M2D A;  1FB6 A;  1R5P A;  1K3O A;  4DSR A;  1EP8 A;  3LYP A;  2H0H A;  5ID2 B;  3GUR A;  1GWC A;  4PUF C;  1S3R A;  1ZL9 A;  4HS1 A;  1EEJ A;  4FYB A;  5G5E A;  2H6Y A;  20GS A;  3FR3 A;  3APQ A;  1V57 A;  1SD9 A;  4Q5Q A;  1XWC A;  4TN8 A;  3SWL A;  3KMO A;  1FG4 A;  3D22 A;  2H74 A;  3FR6 A;  3GNJ A;  3H93 A;  1ML6 A;  1FAA A;  1M3J A;  2V41 A;  5D9V A;  4PUA A;  3KIJ A;  2FHE A;  4FYU A;  1FHE A;  1R5A A;  4XRD A;  1XBS A;  2IWT A;  3QCP A;  5F0G A;  3PR8 A;  4EO3 A;  1QXH A;  3KMN A;  1ZYQ B;  1NM3 A;  4AJ7 A;  2A2P A;  2LTK A;  3GKX A;  3IR4 A;  5LNK e;  2JL4 A;  3FKF A;  5ELG A;  2VO4 A;  3Q18 A;  5JCW A;  3RHC A;  3F8U A;  2H1G A;  4ZBD A;  4QL7 A;  1U3A A;  1CQH A;  4LMV A;  2O89 A;  2R37 A;  2QSI A;  3HZ8 A;  3IA1 A;  4HU7 A;  1OYJ A;  2R3X A;  5ECS A;  3TRP A;  4EC0 A;  2IMK A;  1TRV A;  1URM A;  3H8Q A;  5EVO A;  4EVM A;  2ZUP A;  4K8M A;  3VI7 A;  2VD0 A;  2MBS A;  3VI5 A;  2IL3 A;  2XC2 A;  2NVL A;  5HR0 A;  4TVE A;  2C1Y A;  5COH A;  2V1M A;  19GS A;  1U6T A;  4KDU A;  4MZW A;  2VD1 A;  1ERU A;  4XS6 A;  1AAZ A;  3A3T A;  2FWH A;  11GS A;  1DBY A;  2D2Z A;  3LXZ A;  4E8H A;  3M9K A;  4D73 B;  5G5F A;  3FK8 A;  4XTS A;  1BAY A;  3LSZ A;  4KW6 A;  1MDK A;  4ZXG A;  3MDK A;  3TDG A;  3KH9 A;  4MNN A;  2VCZ A;  1AIU A;  1GSY A;  4ACS A;  4XHM A;  5A4V A;  5CNW A;  5DAL B;  1M2B A;  5J9C A;  1R4W A;  3L9S A;  3KP9 A;  3JCM L;  1YEX A;  1XW6 A;  2B1K A;  2RUF A;  2PU9 C;  4J56 E;  3MAK A;  2RII A;  2OBK A;  1B4Q A;  2GTU A;  3H4K A;  2I4A A;  4O7H A;  2CZ3 A;  2H1D A;  3KTL A;  3ZYW A;  1QUW A;  2AYT A;  2GS3 A;  3HYP A;  3K8N A;  4BL7 B;  1S3C A;  1NW2 A;  5IIZ A;  5D9T A;  1XFL A;  1BYE A;  4X0X A;  1OC9 B;  3J7Y k;  3L9U A;  4HZ4 A;  2A2S A;  1G0T A;  2ZNM A;  3UIW A;  22GS A;  4TR3 A;  4ECJ A;  2VLU A;  4H86 A;  1T7P B;  5D9X A;  5AGY A;  5CRE A;  4Z2T A;  4PX1 A;  5H5R A;  3M3M A;  5F06 A;  4V2M A;  4ML6 A;  1K0C A;  4N0Z A;  1THX A;  2RM6 A;  4Z2R A;  1TTZ A;  1A23 A;  5ID2 A;  1UC7 A;  4GXZ A;  3L78 A;  1AQX A;  3TJJ A;  2OE3 A;  1VF3 A;  2IMD A;  2CT6 A;  2KOK A;  2GSR A;  4NWY A;  1TW9 A;  3G7Y A;  1M7T A;  4MJA A;  1GLP A;  5A4W A;  4HDE A;  3QOU A;  2K18 A;  1AC1 A;  1A0R P;  3WGD A;  1QQ2 A;  4KAE A;  2K8S A;  4WET A;  1K0A A;  5KN2 A;  4TRX A;  1WIK A;  5JWR B;  4FO5 A;  2A2R A;  2YJ7 A;  3PPU A;  5CO3 A;  2J23 A;  1BG5 A;  3O76 A;  2AV4 A;  3NIV A;  4MH3 A;  2DKI A;  3APS A;  4PQ1 A;  5IMZ A;  2G2Q A;  2MYG A;  1M9B A;  4Z2U A;  2TRX A;  2ZCT A;  4IBP A;  5F07 A;  3H79 A;  3ED3 A;  1XG8 A;  2DJK A;  4X43 A;  4XCS A;  4ML1 A;  3P90 A;  1BX9 A;  2RUE A;  4K9Z A;  3TKS C;  1SU9 A;  2LRN A;  1JLW A;  3U5R E;  3W6G A;  3QMX A;  4LLR A;  3FZ4 A;  5B7C A;  5DQY A;  4LMW A;  2GQL A;  4YQV A;  1TXX A;  1BQ7 A;  2XPD A;  3FYG A;  4YKF A;  2H6X A;  3UVH A;  4EXJ A;  2DSA A;  1ON4 A;  2WS2 A;  2VCV A;  4HSC X;  3MSZ A;  4E8E A;  4XRA A;  3EIN A;  3FR9 A;  3HVV A;  1JZO A;  1PX7 A;  2YV9 A;  1DE2 A;  1YEP A;  4TR4 A;  2O8V B;  4I5Q A;  2LKU A;  3WGE A;  3HCZ A;  3A2V A;  5ECI B;  2FD3 A;  2CVB A;  4K7I A;  5G31 A;  1GUL A;  14GS A;  1SYR A;  3FEU A;  5G1L A;  4J57 E;  4XS1 A;  6GSY A;  2IMI A;  2GSQ A;  2UZ8 A;  1HYU A;  4MAB A;  3TJF A;  4XS4 B;  2LJR A;  4OD7 A;  1TP9 A;  1UN2 A;  5KN1 A;  3WT1 A;  3RBT A;  2WB9 A;  3KGK A;  1FW1 A;  5C00 A;  1RQM A;  2VL2 A;  1PGT A;  4TOP A;  2WJU A;  5D9W A;  2B5E A;  4MK3 A;  3E9J B;  5HR1 A;  1KTE A;  4JU5 A;  4BA7 A;  2H0G A;  3P2A A;  2HRF A;  2EC4 A;  4IW9 A;  1MDI A;  3HVX A;  3IDV A;  3G7I A;  3BJ5 A;  5A4U A;  4ECB A;  3CSH A;  4BL7 A;  3EWL A;  3ZIV A;  2YCD A;  2LNS A;  2M72 A;  1AXD A;  1DSB A;  2B5X A;  2HNL A;  1EGO A;  2LV3 A;  4ZB8 A;  3BD2 A;  3HA9 A;  3APO A;  2JAC A;  1EGR A;  1F37 A;  1YDK A;  4WXT A;  1SK2 A;  2PMT A;  4WF5 A;  3Q19 A;  3CRT A;  5EL8 A;  2YWN A;  2FGX A;  2N5A A;  4FQU A;  1FOH A;  1LJR A;  3HZ4 A;  2OE0 A;  3KTB A;  1AW9 A;  8GSS A;  1A2L A;  5ECN B;  1V98 A;  1BED A;  4MF5 A;  3ZLP A;  4BWQ A;  3WD6 A;  2E2G A;  3D6I A;  4GQC A;  3UEM A;  5F8B A;  3VK9 A;  4KB3 A;  4RQR A;  4XIH A;  2IME A;  2RM5 A;  3RHB A;  4IS0 A;  5AIS A;  3ME8 A;  1PSQ A;  1ZYP A;  3V1W A;  4MMM A;  1J9B A;  1WRY A;  3VWW A;  2C3Q A;  1GUH A;  5AN1 A;  4LL1 B;  6GST A;  4IVF A;  2F8F A;  1G7O A;  1YJ6 A;  4KGI A;  3FZ9 A;  5IOX A;  1XWK A;  3D4T A;  2LQQ A;  5DCG A;  2V6O A;  2VCX A;  2MZC A;  4N0V A;  5CRW A;  2HSH A;  2YAN A;  5FWG A;  4F0B A;  3GFK A;  3DIE A;  1HNC A;  3CXG A;  3E3E A;  1SJI A;  4BVX B;  2X99 A;  1EOH A;  3I6A A;  1O73 A;  2H1A A;  2L5L A;  3TOT A;  2DMM A;  4KSM A;  1J0F A;  1XPV A;  1OC8 A;  4K7N A;  1YKC A;  1K0B A;  3KXO A;  1M3I A;  4DSQ A;  2XBQ A;  1B8X A;  2DC5 A;  4BPY A;  1GH2 A;  3IV4 A;  1S3D A;  2AUV A;  5JWQ B;  4TXO B;  1SD8 A;  4GF0 A;  2REM A;  3LG6 A;  5ECL B;  2YZH A;  1V2A A;  3GKM A;  3GST A;  5DBQ A;  4GRF A;  2PVQ A;  2WGR A;  1A2J A;  3C73 A;  3EPT A;  4GWR A;  4RI7 A;  1Y25 A;  4JR6 A;  2CVK A;  4TR1 B;  1MD3 A;  1V58 A;  2HYX A;  4BIK A;  1YF1 A;  1JZR A;  2LNT A;  3UAP A;  3EMP A;  2HLS A;  3R2Q A;  5ECQ B;  4L5O A;  4TXV A;  3N9J A;  1WOU A;  1EV4 A;  4GSS A;  2HZF A;  2HZE B;  2BMX A;  1OVN A;  2O7K A;  4DSS B;  5AIX A;  1YKA A;  5J5N A;  3CTF A;  2H6Z A;  2IIY A;  2QA1 A;  5GZZ B;  4ZBB A;  5IO0 A;  3UBK A;  1B4P A;  2HRN A;  3MWH A;  4G0L A;  2IJY A;  3G7J A;  4NAX A;  2GZP A;  1O81 A;  2C80 A;  2H71 A;  5IPG A;  2WUL A;  1WE0 A;  2X8H A;  2GLR A;  2JZR A;  5H5S A;  2L5O A;  1X9M B;  5D73 A;  2NTO A;  1HNA A;  3QAV A;  2KUC A;  3GSS A;  2O87 A;  1ZMA A;  4JZQ A;  1Y6E A;  2PN8 A;  4WEY A;  3VPQ A;  4YQU A;  4CY8 A;  1T4Z A;  3ZVJ D;  1ZZY A;  3HJP A;  5D96 A;  1OAZ A;  2OE1 A;  4YAV A;  2WDU A;  2I9H A;  2YZU A;  5FT3 A;  3C1S A;  4YH2 A;  3W8S A;  2F8A A;  1SL0 B;  1EV9 A;  2K6V A;  5GST A;  4HUA A;  3UJ1 A;  3FMW A;  3KCM A;  4K6X A;  3F3Q A;  4CY6 A;  2DLX A;  4RUV A;  2QC7 A;  2DML A;  1XCC A;  2VOC A;  4MPG A;  4MA9 A;  3DEX A;  5HFK A;  4NHW A;  3KP8 A;  3HKR A;  4PNG A;  1E6B A;  3LEF A;  3L4N A;  3KH7 A;  3D0Z A;  1U3I A;  3UL3 A;  1QK8 A;  2FNO A;  5BMU A;  2FUG 2;  3ERG A;  1Z5Y E;  2DJJ A;  5E59 A;  5GSS A;  5IMD A;  2NDO A;  4EL1 A;  5IOW A;  3OR5 A;  1OKD A;  5KN3 A;  4K7O A;  3GRX A;  2GT5 A;  2X8G A;  5IQY A;  5HR3 A;  4IKH A;  1ZYE A;  5JWO B;  4KUN A;  2V2G A;  1JLV A;  2OAC A;  4EIP A;  3F4S A;  3A5W A;  3GKK A;  1XWA A;  2HSM A;  4WF4 A;  2GQM A;  2FLS A;  3DVX A;  4KA0 A;  1GSD A;  4AJ6 A;  2AJQ B;  4ZB9 A;  1G6W A;  3KD0 A;  5IMV A;  2QA2 A;  3TUE A;  2DJ0 A;  5DJM A;  1N2A A;  4MH2 A;  3GMF A;  1ILO A;  4IQA A;  3ERF A;  3CYN A;  4HOJ A;  1O6J A;  3F0I A;  1ERW A;  1B9Y C;  5IM9 A;  5IPH A;  2J9H A;  3S9F A;  2OA7 A;  2C0D A;  5DAK B;  1TK5 B;  1XOA A;  1IYI A;  4JED A;  1SK0 A;  3DWV A;  3QAG A;  2F3M A;  4IP6 A;  1PQN A;  1X0R A;  2LUS A;  4TR1 A;  2VLV A;  4POB A;  1AQW A;  1PRX A;  1WPI A;  1Q4J A;  2GSS A;  3FHK A;  2VCT A;  4Z7X A;  1R26 A;  2H01 A;  3RDW A;  3DGQ A;  3LOR A;  1A2M A;  2GVP A;  1WMJ A;  1UVZ A;  3FW2 A;  5GAN D;  2HZE A;  5ECR B;  3BCI A;  4MCU A;  5FHI A;  1H75 A;  1UA5 A;  1YQ1 A;  4LL4 B;  2MMZ A;  3Q6O A;  2O85 A;  4CDO A;  2B3S A;  4G19 A;  2VAF A;  3IK7 A;  3A2W A;  3EMX A;  2CQ9 A;  3CTG A;  2HE3 A;  3IPZ A;  3WGX A;  1EP7 A;  3F9U A;  4MP4 A;  2R0G A;  4AGS A;  3GTU B;  1QMV A;  4F03 A;  2IMF A;  2HXK A;  2DKH A;  1K3Y A;  1W89 A;  5HFG A;  1GUK A;  1RK4 A;  2GGT A;  4NMU A;  4WR4 A;  2YWI A;  3TCO A;  1O8W A;  3LFL A;  1FVJ A;  4RQX A;  2H76 A;  2GST A;  1O85 A;  3HY2 A;  5JCU A;  2OBI A;  4L0U A;  4WKW A;  4NV5 A;  4OCF A;  4L5L A;  1PX6 A;  5ECO B;  1CQG A;  1ERT A;  3I69 A;  2C8U A;  3TKS A;  4PXO A;  4NV2 A;  2VCW A;  1FOV A;  4OWY A;  3ZIJ A;  4LA1 A;  2C4J A;  1H4O A;  2PUK C;  3ZRE A;  4ZL7 A;  4J2F A;  3E0U A;  3TKS E;  1FVK A;  3TOU A;  2CX4 A;  1PN9 A;  4IJ3 A;  1Z7P A;  1A0F A;  1EWX A;  3TJK A;  3TRQ A;  3QFB C;  3UOM A;  1TK8 B;  4ZBA A;  1SEN A;  5CYY A;  6GSU A;  6GSW A;  4D73 A;  4PUR A;  2FWG A;  4N30 A;  1LBK A;  3M0F A;  2EIQ A;  2B5Y A;  3TGZ A;  4IQ1 A;  2CX3 A;  1PFO A;  3HVN A;  3C7M A;  4F0C A;  1KBN A;  5DAL A;  3VPT A;  3R3E A;  1V40 A;  1WP0 A;  2HRA A;  3BCK A;  4P3Y B;  3F63 A;  3GKN A;  4EF0 A;  2R0C A;  1I9D A;  4GLT A;  5H5Q A;  2VCQ A;  4K0N A;  3EVI A;  1GNE A;  2B6M A;  1AQV A;  6GSV A;  5HQP A;  2OAD A;  4JE1 A;  1F9M A;  2I3Y A;  3F4R A;  1PKZ A;  1XXU A;  2N5F A;  3QFA C;  4F82 A;  2CA8 A;  1PD2 1;  4MJE A;  2H19 A;  4ZB6 A;  1SK1 A;  5B8A A;  2P0G A;  3FY7 A;  4IEL A;  5IMC A;  1OC9 A;  5BRT A;  3KJY A;  3C71 A;  2H30 A;  1Z7R A;  5LCZ A;  1GNW A;  5KOX A;  3M9J A;  5DQS A;  3BOA A;  3IHG A;  1R7H A;  4JBB A;  1JZD A;  2E7P A;  3DVW A;  1M0U A;  4FH8 A;  4ULX A;  4DVC A;  3EC3 A;  1SKW B;  2I1U A;  4FYC A;  2GT6 A;  2H72 A; 
#chains in the Genus database with same CATH homology
 1GUM A;  4PGT A;  5GAP D;  1GSF A;  4ZIL A;  3A5I A;  3NZN A;  3ZFL A;  4KND A;  2H8L A;  1Z3E A;  3HVS A;  3RPN A;  2YJH A;  5J3R A;  2C3N A;  4K2X A;  2DJ3 A;  5IMA A;  2GZZ A;  5B6M A;  3G9B A;  2PBJ A;  3DD3 A;  2XPE A;  3WYW A;  2X8C A;  3CMI A;  5F05 A;  1OC3 A;  3L0H A;  1GLQ A;  4ID0 A;  3U6V A;  1MD4 A;  3UAR A;  3GL3 A;  4Q5F A;  2YWM A;  3IC4 A;  2VM2 A;  2P31 A;  3IK9 A;  3DRN A;  4EKZ A;  5LD0 A;  1T3B A;  1KEB A;  2MMO A;  4POM A;  1EZK A;  4HJ2 A;  2RLI A;  1DE1 A;  1HD2 A;  4KSO A;  1OKT A;  5G2Z A;  5B8B A;  2HSY A;  2LST A;  2DIZ A;  1GTU A;  1TRS A;  2E0Q A;  2F9S A;  4V1A g;  5CRH A;  3TKQ A;  1GSQ A;  2GQK A;  3QAW A;  1THO A;  3GN3 A;  1F3A A;  2DJ2 A;  1GTB A;  4OO5 A;  3IOS A;  2YNX A;  3F4T A;  4KF9 A;  5J9B A;  3IC8 A;  4POK A;  5B6N A;  4X1U A;  5J4U A;  2XBI A;  4O5R A;  1J08 A;  3EUR A;  1G6Y A;  3ZZX A;  2H0I A;  4F2I A;  1YZX A;  2E2M A;  9GSS A;  3GA4 A;  4MJC A;  4XS4 A;  1TJD A;  4A5P A;  1VGL A;  4KDX A;  2L6D A;  1F3B A;  4G2E A;  4PQH A;  3LJR A;  3GHA A;  3ZVJ A;  4AJ8 A;  2WZ9 A;  1GL8 A;  2VIM A;  3VUR A;  4GTU A;  1XOB A;  3MYD A;  2HT9 A;  3GX8 A;  2LJA A;  4YKG A;  3PH9 A;  5ECH B;  3HDC A;  2FA4 A;  3ZRD A;  2FWE A;  4ISD A;  4YQM A;  1ZGN A;  3TB2 A;  1Z6M A;  5KN0 A;  3D4M A;  3GUS A;  2CAQ A;  2CV4 A;  3VWU A;  13GS A;  1XIY A;  1O8X A;  2JU5 A;  1N8J A;  3AY8 A;  3M8N A;  3GYK A;  3FZA A;  1VF1 A;  4FIW A;  2JZS A;  1TDI A;  3ISO A;  5G1K A;  3SBC A;  1PMT A;  4O32 A;  4Q5R A;  1TOF A;  2X64 A;  5D93 A;  1PN0 A;  3IAS 2;  2BJX A;  4V1A p;  3GV1 A;  1OE7 A;  1ZOF A;  2DIY A;  4WBR D;  2P5R A;  3N5O A;  2C3T A;  3CSJ A;  1PL2 A;  4G0K A;  1U88 A;  3HJM A;  3ZTL A;  1GSS A;  2K9F A;  4HJM A;  2L59 A;  2H70 A;  2ON5 A;  3VWV A;  4HU9 A;  1VF2 A;  5DVB A;  1QFN A;  4K0G A;  3HJO A;  2YV7 A;  1ABA A;  3DML A;  4MDC A;  2AAW A;  1USB A;  16GS A;  3M1G A;  3KEB A;  4G9H A;  2MMA A;  3QPM A;  3IBH A;  2C0E A;  2HFD A;  3ZMK A;  4ILF A;  4OMV A;  4HI7 A;  1TU8 A;  3LXT A;  3C8E A;  4IHU A;  5ELA A;  4WBJ A;  4MF6 A;  4DEJ A;  3IE3 A;  1G7E A;  2OKA A;  3LQ7 A;  4Q5N A;  1Z9H A;  2PVO C;  1SKR B;  3L9V A;  4I2T A;  5CRG A;  1T00 A;  4AF2 A;  5IO2 A;  4GQF A;  2JSY A;  3IAM 2;  2VL3 A;  2M46 A;  2CVD A;  2B7K A;  2JZT A;  4GCI A;  3IHQ A;  3TJG A;  2C0F A;  2R0P A;  3IXR A;  1XWG A;  1VRS D;  3KZQ A;  1BJX A;  4IJI A;  2LJK A;  3CBU A;  1U87 A;  2YWO A;  2R5G A;  4K5R A;  3PGT A;  4X4J A;  4BVX A;  4NPB A;  1ERV A;  1X5C A;  3I9V 2;  3DKS A;  1MEK A;  2JAD A;  2QGV A;  1XVW A;  1TK0 B;  4MZB A;  3RPP A;  1SKS B;  1HNB A;  3D5J A;  3LGC A;  4ZL8 A;  4YAP A;  2VM1 A;  4JRR A;  2L6C A;  2FA8 A;  1TU7 A;  1K0O A;  3LYK A;  4QQ7 A;  3C1R A;  2K8V A;  1GSU A;  2KP2 A;  1KNG A;  3TKP A;  4TXO A;  4MJB A;  7GSS A;  1JHB A;  2G0F A;  4N10 A;  1XW5 A;  2KLX A;  2V6K A;  3J7Y b;  4O5Q A;  1WJK A;  3P7X A;  2PPT A;  2FWF A;  3F6D A;  5JCG A;  3UBL A;  3RAZ A;  3GH9 A;  2PWJ A;  1T4Y A;  1RW1 A;  4V2N A;  1K0N A;  4K5S A;  5CP1 A;  3P8W A;  1YY7 A;  2VL9 A;  4BWS A;  4KDY A;  1XZO A;  4TW5 A;  1B9X C;  4MZC A;  5ECK B;  6GSX A;  1EOG A;  4HQS A;  4I2U A;  4HQZ A;  4ZL9 A;  4ECI A;  4DSS A;  5L71 A;  1GRX A;  5EY6 A;  2H66 A;  2TIR A;  3TKR A;  3A2X A;  10GS A;  1FO5 A;  2I81 A;  3FZ5 A;  2IFQ B;  3GH6 A;  4OFN A;  4I8B A;  1GSE A;  2DBC A;  4QL9 A;  2A4V A;  2IN3 A;  1SJ6 A;  1MDJ A;  3LWA A;  5INY A;  3EU3 A;  2XHF A;  4L0W A;  4IP1 A;  4OFM A;  2R4V A;  1DUG A;  1JFU A;  2QKE A;  4V2L A;  1NHY A;  4EDY A;  1VF4 A;  1NSW A;  4GSN A;  4MPF A;  4HEA 2;  2Z9S A;  3HD5 A;  3TJB A;  1OE8 A;  4KCA A;  1TRU A;  1NHO A;  1FB0 A;  3UMA A;  5ECP B;  3UVT A;  5J41 A;  2PER A;  2DJ1 A;  4K2D A;  2WRT A;  1K3L A;  2NBS A;  4KCE A;  1Z6N A;  2JSZ A;  1X9W B;  5D8I A;  1Q98 A;  2GDR A;  3FRC A;  4JR4 A;  2F51 A;  3ZL5 A;  4I6X A;  1PKW A;  3DXB A;  4WR5 A;  2H75 A;  2MMN A;  2IPA A;  3Q74 A;  2L4C A;  4BVY B;  3O3T A;  4IN0 A;  4EIQ A;  4HZ2 A;  3ME7 A;  5HR2 A;  3W8J A;  4F9Z A;  4G10 A;  5ECM B;  18GS A;  2YP6 A;  2YN1 A;  3GL5 A;  2PGT A;  2AHE A;  2R6K A;  1B48 A;  1GTI A;  5C04 A;  3I43 A;  12GS A;  1TKD B;  1F6M C;  6GSS A;  1K0D A;  4CHS A;  2KHP A;  4GST A;  1PL1 A;  1K0M A;  4RI6 A;  3D21 A;  1EEM A;  1PA3 A;  1M9A A;  1A8Y A;  2VL2 C;  4K1F A;  1XVQ A;  1WWJ A;  1LU4 A;  2AB6 A;  1IYH A;  2LRC A;  2V32 A;  2ALB A;  3WT2 A;  1HQO A;  5IMF A;  4KX4 A;  2KP1 A;  3QDN A;  4TKY A;  4ICY A;  1A8L A;  5CAX A;  1ZYN A;  5CRD A;  4EDZ A;  3ZIT A;  1TI3 A;  4L8E A;  4PNF A;  2WFC A;  2EIR A;  2MBT A;  3BBY A;  2H73 A;  5ENU A;  5G30 A;  3PIN A;  1XWB A;  2FY6 A;  2HRK A;  3F3R A;  2P5Q A;  2YPM A;  3DYR A;  1GP1 A;  5DAK A;  3HHV A;  2CZ2 A;  5DCH A;  1MTC A;  3CRU A;  1W4V A;  1E2Y A;  1SL1 B;  4EE0 A;  5A5K A;  2B1L A;  1SJZ A;  1F2E A;  4O92 A;  4N11 A;  2TRC P;  3TRX A;  1X9S B;  2N5B A;  1T8E B;  5AIV A;  3NOF A;  2C0G A;  4KE3 A;  3GIX A;  3US3 A;  5E4W A;  2IFQ A;  2L57 A;  2R2J A;  4TR0 A;  5KEJ A;  1X5E A;  1M2A A;  2A4H A;  1YF0 A;  2LRT A;  4KH7 A;  2H1B A;  2M80 A;  4NHZ A;  2NPB A;  4NXI A;  4O5U A;  3EU4 A;  4IGJ A;  5KOW A;  3GTU A;  1TRW A;  1GTA A;  2BTO T;  3H1N A;  2X4A A;  1S3A A;  3QR6 A;  3ERW A;  4I97 A;  4MLY A;  1QGV A;  1M99 A;  4PQI A;  2OJL A;  1T1V A;  4G0I A;  1SL2 B;  3ZFB A;  4OFT A;  3F6F A;  2VUP A;  3ZML A;  2HI7 A;  5HFI A;  3LW9 A;  2FCH A;  2LEG A;  4ZIJ A;  3VLN A;  2EIO A;  17GS A;  4PTS A;  4OCE A;  3VFI A;  2LS5 A;  1O7U A;  3IRA A;  2L4Q A;  3GX0 A;  4CW9 A;  3EYT A;  1ST9 A;  1I5G A;  4USS A;  2ES7 A;  5DJL A;  3MIX A;  5EPF A;  2CAI A;  2WCI A;  3EE2 A;  3MNG A;  4BVY A;  1X5D A;  1A24 A;  3KM6 A;  2VLT A;  1ACV A;  5DDL A;  3QD9 A;  1V9W A;  3O6T A;  2ON7 A;  4MF7 A;  4EUY A;  1C72 A;  3CSI A;  2B7J A;  3HXS A;  4POL A;  2GZY A;  4ECC A;  2LQO A;  1JZW A;  3VWX A;  1SYX A;  1TI1 A;  2YOI A;  1ZCP A;  1AUC A;  2X49 A;  5ABR A;  1XW9 A;  4OO4 A;  1M2D A;  1FB6 A;  1R5P A;  1K3O A;  4DSR A;  1EP8 A;  3LYP A;  2H0H A;  5ID2 B;  3GUR A;  1GWC A;  4PUF C;  1ZL9 A;  4HS1 A;  1EEJ A;  4FYB A;  5G5E A;  2H6Y A;  20GS A;  3FR3 A;  3APQ A;  1V57 A;  1SD9 A;  4Q5Q A;  1XWC A;  4TN8 A;  3SWL A;  3KMO A;  1FG4 A;  3D22 A;  2H74 A;  3FR6 A;  3GNJ A;  3H93 A;  1ML6 A;  1FAA A;  5D9V A;  2V41 A;  4PUA A;  3KIJ A;  2FHE A;  4FYU A;  1FHE A;  1R5A A;  4XRD A;  1XBS A;  2IWT A;  3QCP A;  5F0G A;  3PR8 A;  4EO3 A;  1QXH A;  3KMN A;  1ZYQ B;  1NM3 A;  4AJ7 A;  2A2P A;  2LTK A;  3GKX A;  3IR4 A;  5LNK e;  2JL4 A;  3FKF A;  5ELG A;  2VO4 A;  3Q18 A;  5JCW A;  3RHC A;  3F8U A;  2H1G A;  4ZBD A;  4QL7 A;  1U3A A;  1CQH A;  4LMV A;  2O89 A;  2R37 A;  2QSI A;  3HZ8 A;  3IA1 A;  4HU7 A;  1OYJ A;  2R3X A;  5ECS A;  3TRP A;  4EC0 A;  2IMK A;  1TRV A;  1URM A;  3H8Q A;  5EVO A;  4EVM A;  2ZUP A;  4K8M A;  3VI7 A;  2VD0 A;  2MBS A;  3VI5 A;  2IL3 A;  2XC2 A;  2NVL A;  5HR0 A;  4TVE A;  2C1Y A;  5COH A;  2V1M A;  19GS A;  1U6T A;  4KDU A;  4MZW A;  2VD1 A;  1ERU A;  4XS6 A;  1AAZ A;  3A3T A;  2FWH A;  11GS A;  1DBY A;  2D2Z A;  3LXZ A;  4E8H A;  3M9K A;  4D73 B;  5G5F A;  3FK8 A;  4XTS A;  1BAY A;  3LSZ A;  4KW6 A;  1MDK A;  4ZXG A;  3MDK A;  3TDG A;  3KH9 A;  4MNN A;  2VCZ A;  1AIU A;  1GSY A;  4ACS A;  4XHM A;  5A4V A;  5CNW A;  5DAL B;  1M2B A;  5J9C A;  1R4W A;  3L9S A;  3KP9 A;  3JCM L;  1YEX A;  1XW6 A;  2B1K A;  2RUF A;  2PU9 C;  4J56 E;  3MAK A;  2RII A;  2OBK A;  1B4Q A;  2GTU A;  3H4K A;  2I4A A;  4O7H A;  2CZ3 A;  2H1D A;  3KTL A;  3ZYW A;  1QUW A;  2AYT A;  2GS3 A;  3HYP A;  3K8N A;  4BL7 B;  1S3C A;  1NW2 A;  5IIZ A;  5D9T A;  1XFL A;  1BYE A;  4X0X A;  1OC9 B;  3J7Y k;  3L9U A;  4HZ4 A;  2A2S A;  1G0T A;  2ZNM A;  3UIW A;  22GS A;  4TR3 A;  4ECJ A;  2VLU A;  4H86 A;  1T7P B;  5D9X A;  5AGY A;  5CRE A;  4Z2T A;  4PX1 A;  5H5R A;  3M3M A;  5F06 A;  4V2M A;  4ML6 A;  1K0C A;  4N0Z A;  1THX A;  2RM6 A;  4Z2R A;  1TTZ A;  1A23 A;  5ID2 A;  1UC7 A;  4GXZ A;  3L78 A;  1AQX A;  3TJJ A;  2OE3 A;  1VF3 A;  2IMD A;  2CT6 A;  2KOK A;  2GSR A;  4NWY A;  1TW9 A;  3G7Y A;  1M7T A;  4MJA A;  1GLP A;  5A4W A;  4HDE A;  3QOU A;  2K18 A;  1AC1 A;  1A0R P;  3WGD A;  1QQ2 A;  4KAE A;  2K8S A;  4WET A;  1K0A A;  5KN2 A;  4TRX A;  1WIK A;  5JWR B;  4FO5 A;  2A2R A;  2YJ7 A;  3PPU A;  5CO3 A;  2J23 A;  1BG5 A;  3O76 A;  2AV4 A;  3NIV A;  4MH3 A;  2DKI A;  3APS A;  4PQ1 A;  5IMZ A;  2G2Q A;  2MYG A;  1M9B A;  4Z2U A;  2TRX A;  2ZCT A;  4IBP A;  5F07 A;  3H79 A;  3ED3 A;  2DJK A;  4X43 A;  4XCS A;  4ML1 A;  3P90 A;  1BX9 A;  2RUE A;  4K9Z A;  3TKS C;  1SU9 A;  2LRN A;  1JLW A;  3U5R E;  3W6G A;  3QMX A;  4LLR A;  3FZ4 A;  5B7C A;  5DQY A;  4LMW A;  2GQL A;  4YQV A;  1TXX A;  1BQ7 A;  2XPD A;  3FYG A;  4YKF A;  2H6X A;  3UVH A;  4EXJ A;  2DSA A;  1ON4 A;  2WS2 A;  2VCV A;  3MSZ A;  4E8E A;  4XRA A;  3EIN A;  3FR9 A;  3HVV A;  1JZO A;  1PX7 A;  2YV9 A;  1DE2 A;  1YEP A;  4TR4 A;  2O8V B;  4I5Q A;  2LKU A;  3WGE A;  3HCZ A;  3A2V A;  5ECI B;  2FD3 A;  2CVB A;  4K7I A;  5G31 A;  1GUL A;  14GS A;  1SYR A;  3FEU A;  5G1L A;  4J57 E;  4XS1 A;  6GSY A;  2IMI A;  2GSQ A;  2UZ8 A;  1HYU A;  4MAB A;  3TJF A;  4XS4 B;  2LJR A;  4OD7 A;  1TP9 A;  1UN2 A;  5KN1 A;  3WT1 A;  3RBT A;  2WB9 A;  3KGK A;  1FW1 A;  5C00 A;  1RQM A;  2VL2 A;  1PGT A;  4TOP A;  2WJU A;  5D9W A;  2B5E A;  4MK3 A;  3E9J B;  5HR1 A;  1KTE A;  4JU5 A;  4BA7 A;  2H0G A;  3P2A A;  2HRF A;  2EC4 A;  4IW9 A;  1MDI A;  3HVX A;  3IDV A;  3G7I A;  3BJ5 A;  5A4U A;  4ECB A;  3CSH A;  4BL7 A;  3EWL A;  3ZIV A;  2YCD A;  2LNS A;  2M72 A;  1AXD A;  1DSB A;  2B5X A;  2HNL A;  1EGO A;  2LV3 A;  4ZB8 A;  3BD2 A;  3HA9 A;  3APO A;  2JAC A;  1EGR A;  1F37 A;  1YDK A;  4WXT A;  1SK2 A;  2PMT A;  4WF5 A;  3Q19 A;  3CRT A;  5EL8 A;  2YWN A;  2FGX A;  2N5A A;  4FQU A;  1FOH A;  1LJR A;  3HZ4 A;  2OE0 A;  3KTB A;  1AW9 A;  8GSS A;  1A2L A;  5ECN B;  1V98 A;  1BED A;  4MF5 A;  3ZLP A;  4BWQ A;  3WD6 A;  2E2G A;  3D6I A;  4GQC A;  3UEM A;  5F8B A;  3VK9 A;  4KB3 A;  4RQR A;  4XIH A;  2IME A;  2RM5 A;  3RHB A;  4IS0 A;  5AIS A;  3ME8 A;  1PSQ A;  1ZYP A;  3V1W A;  4MMM A;  1J9B A;  1WRY A;  3VWW A;  2C3Q A;  1GUH A;  5AN1 A;  4LL1 B;  6GST A;  4IVF A;  2F8F A;  1G7O A;  1YJ6 A;  4KGI A;  3FZ9 A;  5IOX A;  1XWK A;  3D4T A;  2LQQ A;  5DCG A;  2V6O A;  2VCX A;  2MZC A;  4N0V A;  5CRW A;  2HSH A;  2YAN A;  5FWG A;  4F0B A;  3GFK A;  3DIE A;  1HNC A;  3CXG A;  3E3E A;  1SJI A;  4BVX B;  2X99 A;  1EOH A;  3I6A A;  1O73 A;  2H1A A;  2L5L A;  3TOT A;  2DMM A;  4KSM A;  1J0F A;  1XPV A;  1OC8 A;  4K7N A;  1YKC A;  1K0B A;  3KXO A;  4DSQ A;  2XBQ A;  1B8X A;  2DC5 A;  4BPY A;  1GH2 A;  3IV4 A;  1S3D A;  2AUV A;  5JWQ B;  4TXO B;  1SD8 A;  4GF0 A;  2REM A;  3LG6 A;  5ECL B;  2YZH A;  1V2A A;  3GKM A;  3GST A;  5DBQ A;  4GRF A;  2PVQ A;  2WGR A;  1A2J A;  3C73 A;  3EPT A;  4GWR A;  4RI7 A;  1Y25 A;  4JR6 A;  2CVK A;  4TR1 B;  1MD3 A;  1V58 A;  2HYX A;  1YF1 A;  1JZR A;  2LNT A;  3UAP A;  3EMP A;  2HLS A;  3R2Q A;  5ECQ B;  4L5O A;  4TXV A;  3N9J A;  1WOU A;  1EV4 A;  4GSS A;  2HZF A;  2HZE B;  2BMX A;  1OVN A;  2O7K A;  4DSS B;  5AIX A;  1YKA A;  5J5N A;  3CTF A;  2H6Z A;  2IIY A;  2QA1 A;  5GZZ B;  4ZBB A;  5IO0 A;  3UBK A;  1B4P A;  2HRN A;  3MWH A;  4G0L A;  2IJY A;  3G7J A;  4NAX A;  2GZP A;  1O81 A;  2C80 A;  2H71 A;  5IPG A;  2WUL A;  1WE0 A;  2X8H A;  2GLR A;  2JZR A;  5H5S A;  2L5O A;  1X9M B;  5D73 A;  2NTO A;  1HNA A;  3QAV A;  2KUC A;  3GSS A;  2O87 A;  1ZMA A;  4JZQ A;  1Y6E A;  2PN8 A;  4WEY A;  3VPQ A;  4YQU A;  4CY8 A;  1T4Z A;  3ZVJ D;  1ZZY A;  3HJP A;  5D96 A;  1OAZ A;  2OE1 A;  4YAV A;  2WDU A;  2I9H A;  2YZU A;  5FT3 A;  3C1S A;  4YH2 A;  3W8S A;  2F8A A;  1SL0 B;  1EV9 A;  2K6V A;  5GST A;  4HUA A;  3UJ1 A;  3FMW A;  3KCM A;  4K6X A;  3F3Q A;  4CY6 A;  2DLX A;  4RUV A;  2QC7 A;  2DML A;  1XCC A;  2VOC A;  4MPG A;  4MA9 A;  3DEX A;  5HFK A;  4NHW A;  3KP8 A;  3HKR A;  4PNG A;  1E6B A;  3LEF A;  3L4N A;  3KH7 A;  3D0Z A;  1U3I A;  3UL3 A;  1QK8 A;  2FNO A;  5BMU A;  2FUG 2;  3ERG A;  1Z5Y E;  2DJJ A;  5E59 A;  5GSS A;  5IMD A;  2NDO A;  4EL1 A;  5IOW A;  3OR5 A;  1OKD A;  5KN3 A;  4K7O A;  3GRX A;  2GT5 A;  2X8G A;  5IQY A;  5HR3 A;  4IKH A;  1ZYE A;  5JWO B;  4KUN A;  2V2G A;  1JLV A;  2OAC A;  4EIP A;  3F4S A;  3A5W A;  3GKK A;  1XWA A;  2HSM A;  4WF4 A;  2GQM A;  2FLS A;  3DVX A;  4KA0 A;  1GSD A;  4AJ6 A;  2AJQ B;  4ZB9 A;  1G6W A;  3KD0 A;  5IMV A;  2QA2 A;  3TUE A;  2DJ0 A;  5DJM A;  1N2A A;  4MH2 A;  3GMF A;  1ILO A;  4IQA A;  3ERF A;  3CYN A;  4HOJ A;  1O6J A;  3F0I A;  1ERW A;  1B9Y C;  5IM9 A;  5IPH A;  2J9H A;  3S9F A;  2OA7 A;  2C0D A;  5DAK B;  1TK5 B;  1XOA A;  1IYI A;  4JED A;  1SK0 A;  3DWV A;  3QAG A;  2F3M A;  4IP6 A;  1PQN A;  1X0R A;  2LUS A;  4TR1 A;  2VLV A;  4POB A;  1AQW A;  1PRX A;  1WPI A;  1Q4J A;  2GSS A;  3FHK A;  2VCT A;  4Z7X A;  1R26 A;  2H01 A;  3RDW A;  3DGQ A;  3LOR A;  1A2M A;  2GVP A;  1WMJ A;  1UVZ A;  3FW2 A;  5GAN D;  2HZE A;  5ECR B;  3BCI A;  4MCU A;  5FHI A;  1H75 A;  1UA5 A;  1YQ1 A;  4LL4 B;  2MMZ A;  3Q6O A;  2O85 A;  4CDO A;  2B3S A;  4G19 A;  2VAF A;  3IK7 A;  3A2W A;  3EMX A;  2CQ9 A;  3CTG A;  2HE3 A;  3IPZ A;  3WGX A;  1EP7 A;  3F9U A;  4MP4 A;  2R0G A;  4AGS A;  3GTU B;  1QMV A;  4F03 A;  2IMF A;  2HXK A;  2DKH A;  1K3Y A;  1W89 A;  5HFG A;  1GUK A;  1RK4 A;  2GGT A;  4NMU A;  4WR4 A;  2YWI A;  3TCO A;  1O8W A;  3LFL A;  1FVJ A;  4RQX A;  2H76 A;  2GST A;  1O85 A;  3HY2 A;  5JCU A;  2OBI A;  4L0U A;  4WKW A;  4NV5 A;  4OCF A;  4L5L A;  1PX6 A;  5ECO B;  1CQG A;  1ERT A;  3I69 A;  2C8U A;  3TKS A;  4PXO A;  4NV2 A;  2VCW A;  1FOV A;  4OWY A;  3ZIJ A;  4LA1 A;  2C4J A;  1H4O A;  2PUK C;  3ZRE A;  4ZL7 A;  4J2F A;  3E0U A;  3TKS E;  1FVK A;  3TOU A;  2CX4 A;  1PN9 A;  4IJ3 A;  1Z7P A;  1A0F A;  1EWX A;  3TJK A;  3TRQ A;  3QFB C;  3UOM A;  1TK8 B;  4ZBA A;  1SEN A;  5CYY A;  6GSU A;  6GSW A;  4D73 A;  4PUR A;  2FWG A;  4N30 A;  1LBK A;  3M0F A;  2EIQ A;  2B5Y A;  3TGZ A;  4IQ1 A;  2CX3 A;  3C7M A;  4F0C A;  1KBN A;  5DAL A;  3VPT A;  3R3E A;  1V40 A;  1WP0 A;  2HRA A;  3BCK A;  4P3Y B;  3F63 A;  3GKN A;  4EF0 A;  2R0C A;  1I9D A;  4GLT A;  5H5Q A;  2VCQ A;  4K0N A;  3EVI A;  1GNE A;  2B6M A;  1AQV A;  6GSV A;  5HQP A;  2OAD A;  4JE1 A;  1F9M A;  2I3Y A;  3F4R A;  1PKZ A;  1XXU A;  2N5F A;  3QFA C;  4F82 A;  2CA8 A;  1PD2 1;  4MJE A;  2H19 A;  4ZB6 A;  1SK1 A;  5B8A A;  2P0G A;  3FY7 A;  4IEL A;  5IMC A;  1OC9 A;  5BRT A;  3KJY A;  3C71 A;  2H30 A;  1Z7R A;  5LCZ A;  1GNW A;  5KOX A;  3M9J A;  5DQS A;  3BOA A;  3IHG A;  1R7H A;  4JBB A;  1JZD A;  2E7P A;  3DVW A;  1M0U A;  4FH8 A;  4ULX A;  4DVC A;  3EC3 A;  1SKW B;  2I1U A;  4FYC A;  2GT6 A;  2H72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...