5EPFA

Crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
153
Chain Sequence
HMKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVKQAKFAEVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Peroxidoxin BcpB from Mycobacterium tuberculosis
rcsb
molecule keywords Peroxiredoxin
molecule tags Oxidoreductase
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 51
structure length 153
sequence length 154
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5epfA00
1OYJA 2C80A 3BOAA 6GSVA 3ZTLA 1F2EA 1O7UA 2DJ0A 1F37A 2J9HA 1X5DA 3TUEA 3RDWA 3H93A 3HXSA 3EU4A 2AHEA 5HFGA 4FYBA 1ML6A 2QGVA 2PUKC 1VGLA 4ZB6A 2GSQA 1YJ6A 3P90A 3W8SA 1THXA 4MPGA 2P0GA 5DCGA 2L6CA 2YNXA 3V1WA 2LUSA 3S9FA 1X5EA 1GTIA 1T00A 3D4MA 1TJDA 5DJMA 1XPVA 4ID0A 3C73A 2V1MA 5CO3A 2O85A 2HNLA 4MJEA 1O8WA 3H4KA 2B1KA 2X8HA 2XBQA 2XBIA 3UL3A 4MPFA 1BQ7A 1GSFA 2O7KA 1A2JA 3IXRA 3GL5A 1EGRA 1ERTA 4F9ZA 5DALA 1OE7A 5CRGA 3AY8A 3LORA 1G6YA 3FRCA 5DJLA 3UARA 1EOHA 3APQA 4JU5A 5GZZB 1FVKA 2JADA 3LSZA 1Z6NA 2H71A 5F07A 3IHQA 1EWXA 4GSSA 2HZEB 5DDLA 1Z7PA 1HD2A 2OBKA 3GH9A 2B6MA 3N9JA 3Q18A 2H1AA 2KOKA 4LL1B 4NHZA 4GSTA 4JEDA 5DAKA 5G1LA 4K1FA 4MZWA 1ZCPA 3K8NA 1MD4A 1NHYA 4D73B 3LEFA 1M2DA 2FA8A 2G2QA 5IOXA 4YQVA 3JCML 4MJBA 2WB9A 2WS2A 1U3IA 4TR1B 4KB3A 3MAKA 4PURA 2VCXA 3KIJA 1G6WA 4IS0A 2VCZA 2YWNA 4LLRA 2HRNA 3NOFA 2GZPA 1AW9A 1K0NA 2JL4A 4WKWA 4YQMA 1F6MC 3D22A 4TN8A 1EP8A 3VLNA 4PUAA 2HFDA 3P2AA 2I9HA 2CT6A 4NWYA 1YKCA 4KCEA 5AISA 4NXIA 4EVMA 4F0BA 1EOGA 3CRTA 1YF0A 4MMMA 2XPEA 1FVJA 4K2DA 1ERUA 4NMUA 3BD2A 4RI6A 1TU8A 3KP9A 1ZMAA 5KN2A 4EF0A 3TCOA 3I43A 3VPTA 1F3AA 2MMNA 3UIWA 3LG6A 3RPPA 2F3MA 1ZGNA 1PGTA 2M46A 4OWYA 4PUFC 1Y6EA 1QQ2A 1TTZA 1V40A 5EY6A 2A2SA 5H5SA 1QK8A 2RM5A 4P3YB 4HDEA 3GA4A 2VM2A 3GL3A 2E7PA 2C3QA 2HRFA 1SYRA 3D21A 1T8EB 2O87A 4FYCA 5LD0A 2IMKA 1TDIA 1K0OA 3QOUA 4XHMA 2HE3A 2OE3A 5EL8A 3KJYA 5D9WA 4KUNA 2B7KA 3ZRDA 2LS5A 3U5RE 2C0FA 3ZMKA 2I3YA 1SD9A 1OVNA 4EUYA 3EU3A 3G7YA 5FWGA 4GTUA 1GSDA 3F0IA 3M3MA 3ZVJA 2GT5A 2WZ9A 1WE0A 3QAVA 4ECBA 1GRXA 2X8GA 2MMOA 2OE1A 2RLIA 2CQ9A 1XWGA 1TKDB 4EO3A 5E4WA 1UN2A 3ZFBA 1SENA 3DXBA 2FGXA 1AQVA 1TRWA 2XHFA 2CA8A 1MDIA 3Q19A 1LU4A 4BWQA 4AGSA 3M9KA 4J56E 1XOAA 1Q98A 2IFQA 5HR3A 4TRXA 5IOWA 5D93A 3QD9A 1BX9A 1NM3A 4BWSA 1DE2A 2JU5A 2FWHA 4AJ6A 4CHSA 1GTBA 1TK8B 3MWHA 2VCVA 3IOSA 2O8VB 2K6VA 1K0BA 1GLPA 1Z9HA 1U88A 2GQLA 12GSA 2LRNA 3J7Yb 3FEUA 3M9JA 3D5JA 4I2UA 6GSSA 3L78A 1OC9B 2DJ2A 4HQZA 3FR9A 3QCPA 5A5KA 3BCIA 1GTUA 4XCSA 3GTUB 2B1LA 3APSA 4WR5A 3DWVA 1Z3EA 2NPBA 4MP4A 4RUVA 3IC4A 16GSA 2FWFA 3EMPA 1GUKA 3IBHA 3Q74A 2L5LA 2WFCA 5J9BA 2FLSA 3GRXA 3LWAA 3IA1A 4POKA 1WWJA 2BMXA 2LNSA 3ZL5A 3I6AA 3BBYA 3HD5A 3HVSA 5C04A 4ZL7A 5CYYA 4GXZA 1YKAA 3I69A 4JR4A 4L5LA 3IRAA 2V2GA 1GNWA 1RW1A 4IP6A 2E2GA 1T7PB 1Z7RA 3E0UA 4FYUA 4IQ1A 1TXXA 4NPBA 3D4TA 1SK0A 2VL2C 1K0CA 2N5AA 2IWTA 4PX1A 3GKKA 5INYA 1A8YA 1QXHA 3EINA 5CP1A 1ACVA 5AIVA 1JZDA 1SK2A 4OFTA 3CSIA 4V2LA 4ZB9A 4ZBDA 1JHBA 1FHEA 3L9UA 1X5CA 1W89A 1A24A 4GLTA 2LEGA 2CVKA 3RPNA 3SBCA 3TJKA 1V2AA 1V57A 1FO5A 1X9MB 2OADA 2EIOA 1GSEA 1OKTA 1QFNA 4ZBBA 3TKQA 1MTCA 1BYEA 4X0XA 4FIWA 1OE8A 5D9XA 1QUWA 4N0VA 4F82A 4YAPA 1GTAA 5DCHA 2EC4A 3A5WA 1J08A 3A2VA 4KE3A 2LQQA 1ERWA 1G7OA 4LL4B 1YQ1A 2CAIA 2YWIA 3MNGA 3M1GA 2B5YA 5IO0A 5ECRB 2VLUA 1ZL9A 5DQSA 1A0RP 4PNGA 2YWMA 5E59A 3IR4A 3M8NA 1LJRA 4IKHA 2IMEA 3D0ZA 1ZOFA 4EXJA 3UMAA 5ECOB 1A2MA 2PMTA 4I2TA 4JBBA 5AN1A 2C0DA 1T4ZA 5IMCA 3L4NA 2DMLA 2GT6A 1ZZYA 2M72A 1A0FA 1ON4A 2JSZA 2F8AA 5G5EA 4RI7A 3KD0A 19GSA 4YAVA 1NSWA 2EIRA 3W6GA 3IK9A 4KH7A 3US3A 3KH7A 1PL1A 3CSHA 3A2WA 2OJLA 3VWUA 2PGTA 4ML6A 1TI3A 4DSSB 2H8LA 3HHVA 1W4VA 2HZFA 5JCWA 5HR0A 3TKSE 3RHCA 2H1GA 2GSRA 3F3QA 2BJXA 2IPAA 2H0HA 3DIEA 1VF2A 2QSIA 3MSZA 2H30A 4L0UA 4ACSA 1EZKA 2E2MA 1GSUA 5JCUA 2IMDA 1OC3A 2VL2A 3F63A 4GSNA 3GN3A 3FHKA 4OD7A 5ENUA 3DYRA 2F51A 2TRXA 1JZRA 5AGYA 3TJGA 2YCDA 1M9AA 3ERWA 4GF0A 3G9BA 5AIXA 1EP7A 1XW9A 2H76A 1F3BA 4X1UA 2K9FA 2VOCA 5J3RA 3ISOA 5B7CA 6GSYA 4TXOB 5KN0A 5G30A 2GQMA 2RUFA 1T3BA 2KP1A 4NHWA 1E2YA 4GQCA 2FUG2 5ECMB 1GL8A 2AYTA 4K7IA 3KM6A 1CQHA 5IMAA 1SJIA 3C1RA 4OMVA 3SWLA 2VD1A 1X9SB 1XOBA 1QGVA 3LXZA 4ML1A 3VI5A 4Z7XA 2PERA 2H74A 1GUHA 3W8JA 2DJ3A 3GKMA 3F6DA 3TRXA 1EEMA 18GSA 4IW9A 4HQSA 3D6IA 3F4TA 3F4RA 4JZQA 5J9CA 4ZXGA 3IDVA 3FK8A 4IQAA 1C72A 14GSA 4EKZA 2MMZA 2DJ1A 2LJRA 2OACA 1AQXA 4KDYA 2H66A 3LYPA 2TIRA 5H5RA 4WR4A 4V2NA 1K3LA 1JZWA 3IAS2 4GRFA 3HZ4A 2HZEA 2LQOA 1ILOA 2X8CA 4KNDA 2KLXA 5ID2B 1R26A 1SU9A 4IJ3A 2PVOC 3LGCA 4JE1A 2OBIA 1RQMA 2LRCA 2VLTA 2C8UA 5IQYA 4BL7A 2CV4A 2IN3A 2EIQA 4GCIA 2B5XA 4TKYA 3CSJA 4WXTA 2G0FA 2GQKA 1VF1A 4F0CA 2REMA 2OKAA 2YP6A 4JRRA 2JSYA 1TP9A 3DVXA 5G2ZA 4KW6A 5D73A 5J4UA 1AIUA 4HU7A 4ISDA 2A2RA 4Q5FA 1YF1A 3UAPA 2DSAA 4YQUA 4MCUA 4LMWA 4MZCA 3L9SA 4MABA 1JZOA 1GWCA 3EC3A 2H70A 5G31A 5ECSA 2X99A 4N0ZA 3GURA 1KNGA 2ON5A 1TI1A 2RM6A 3BCKA 3IAM2 4K6XA 4IN0A 4K0NA 2A4VA 3EE2A 1THOA 2LRTA 2CX4A 5IMDA 5IO2A 4HOJA 2H01A 2GSTA 3KTBA 3R2QA 3WD6A 3FZ9A 3ZFLA 4KCAA 5LNKe 2DIYA 3PR8A 3CXGA 4G10A 1AXDA 3UOMA 4XS4B 1PRXA 5B6NA 3WGDA 4X43A 2GTUA 1H75A 4XS1A 1URMA 3RHBA 1NHOA 4EE0A 4BPYA 2YN1A 4YH2A 3TJJA 2I4AA 1O85A 1M0UA 3H8QA 2B3SA 2H19A 2TRCP 5IPGA 1HNBA 4MF7A 1Y25A 1K0DA 3ERGA 1XXUA 4EL1A 4G9HA 4Q5QA 3I9V2 2FNOA 1SJ6A 4WF5A 3DEXA 2N5BA 2GDRA 4MZBA 1EEJA 1U6TA 4IELA 2H72A 1XWAA 2JACA 4PQIA 1SL0B 3U6VA 1R5PA 2H73A 2VO4A 2H75A 1GSSA 2VIMA 2L59A 3L9VA 3QFBC 2VCQA 3Q6OA 2KUCA 4K7NA 3C1SA 4OCFA 2M80A 5CRWA 3E3EA 1QMVA 2YWOA 1FW1A 3GUSA 4N10A 3EWLA 2GGTA 3GNJA 4F03A 2VL3A 4HUAA 3FR6A 1KBNA 3CMIA 4KSMA 2DLXA 2LV3A 4K0GA 1NW2A 4KSOA 5DVBA 5ECKB 3WYWA 4MH2A 2LSTA 1J0FA 1XVQA 4I5QA 1B9YC 3WT2A 5JWQB 3UVTA 4IBPA 1MD3A 2LTKA 1O6JA 3TDGA 2IMIA 5CRDA 1JFUA 1DBYA 3UEMA 5HR1A 2CAQA 1S3CA 1BJXA 1R7HA 1B4PA 4MF5A 4ULXA 3APOA 1K3OA 5F0GA 2H6ZA 1BEDA 2YJ7A 2V6OA 1UVZA 3C7MA 1XBSA 4O5RA 4ECCA 1PQNA 2VAFA 2VUPA 3DMLA 3EYTA 2QKEA 1WPIA 3M0FA 6GSUA 2L4CA 4AJ7A 3CYNA 3L0HA 4BVYA 1O8XA 2PVQA 3VFIA 1T4YA 2R2JA 5CNWA 1XWBA 1WIKA 3GTUA 1V58A 5IIZA 3ZITA 5ECHB 5B6MA 3HJPA 1PKWA 3QMXA 2HSYA 1YZXA 4MA9A 3A2XA 4PQ1A 1WRYA 3PH9A 4K7OA 3HA9A 4PNFA 4ZB8A 3H79A 3UBLA 1M9BA 1XVWA 3CTFA 1WJKA 1T1VA 2DJJA 3VWWA 4RQXA 5DQYA 5G5FA 5ELGA 1M2BA 1SKWB 3KZQA 5HFKA 4GQFA 1I5GA 4FH8A 1V98A 3CBUA 4WEYA 5DBQA 1IYIA 4MDCA 5HR2A 2C1YA 1S3AA 4MJAA 7GSSA 1MDKA 1HNAA 1XCCA 1XZOA 1TRUA 2BTOT 1VF4A 3GX8A 5L71A 1ZYEA 1VF3A 4EDZA 3O6TA 2FD3A 4NAXA 1FG4A 5HFIA 3GIXA 2MBTA 3KMOA 3H1NA 4XS6A 2D2ZA 5KN3A 1BG5A 4I6XA 3FW2A 2JZTA 5ELAA 2WCIA 3G7IA 4H86A 2H1BA 2R3XA 4HJ2A 4LA1A 3DKSA 1EV4A 5IMVA 3KEBA 1XWCA 2VCWA 1GSYA 3G7JA 3MDKA 3ED3A 4XRDA 3FZ4A 5HQPA 1YEPA 1J9BA 4DVCA 2WRTA 2ZUPA 3FZAA 2DBCA 2LJAA 2GLRA 4ZBAA 6GSTA 5KEJA 1EV9A 4XTSA 3WGEA 1U87A 2V32A 3ZZXA 4IVFA 2CVBA 3GSTA 2F9SA 1FOVA 1BAYA 2YPMA 3F9UA 2H6XA 4QL7A 4MLYA 3QR6A 4IP1A 2KP2A 3LYKA 4DEJA 1PX6A 1B4QA 6GSXA 4OFNA 5ECLB 2L57A 3C8EA 3KCMA 4MJCA 1XIYA 2VLVA 4DSSA 1SL2B 3EVIA 2GS3A 4RQRA 3F6FA 3N5OA 3KP8A 4OCEA 5CRHA 3BJ5A 4EDYA 3IV4A 1XW5A 3HDCA 4TR3A 3FY7A 1N8JA 1DUGA 5DALB 4V1Ag 2GZYA 1V9WA 3CRUA 2GZZA 4L0WA 5IPHA 2YV7A 4BVXA 4N11A 3J7Yk 4QQ7A 1B48A 2P5QA 1E6BA 2NDOA 4EC0A 2L5OA 1PSQA 2YANA 3F3RA 2CX3A 2C4JA 1O81A 5B8BA 2WULA 4IJIA 4POMA 5DAKB 4DSQA 3ZLPA 4WETA 4LMVA 1HYUA 4TXOA 3IE3A 5J41A 2AAWA 2NVLA 2L6DA 2CZ3A 1XW6A 1S3DA 4Q5NA 4KAEA 2L4QA 2J23A 3DRNA 1KEBA 2CZ2A 4OO4A 1PX7A 2ZNMA 4KDXA 4JR6A 2HXKA 2MZCA 5A4WA 3KMNA 4BA7A 2Z9SA 3PINA 2VL9A 2B5EA 1USBA 3RAZA 4ZL8A 1WOUA 5GAND 1B9XC 1XWKA 1UC7A 3ME8A 3ZMLA 4O32A 4CDOA 4DSRA 2C3TA 2OA7A 3HVVA 2VD0A 1JLWA 3DVWA 4PGTA 3O3TA 2C3NA 9GSSA 2P31A 1SKSB 5D9TA 4QL9A 2AB6A 1SL1B 3VWVA 1SKRB 2LJKA 4D73A 4TVEA 2O89A 5CAXA 2NBSA 4IGJA 5F8BA 4TR1A 2XC2A 11GSA 1PMTA 3ZREA 1TK0B 1YDKA 4CW9A 4N30A 1GSQA 2YV9A 2N5FA 2ALBA 4KX4A 3ZIVA 5GSTA 2HI7A 2NTOA 4ZIJA 3VURA 3IPZA 2R6KA 4NV2A 1I9DA 22GSA 5ID2A 8GSSA 4G2EA 1K0AA 3CTGA 4K8MA 4HU9A 1WP0A 5H5QA 3FKFA 5D96A 1CQGA 2VM1A 4F2IA 3TKRA 2ZCTA 3TKPA 2PU9C 1LBKA 2FHEA 3TRQA 3FYGA 1Q4JA 3ZVJD 2R5GA 4O7HA 5KN1A 1M99A 5C00A 2HT9A 4K9ZA 3GFKA 1GULA 1SK1A 1OAZA 2VCTA 2DIZA 1GUMA 4Q5RA 5ECNB 3EURA 2V41A 2H6YA 1YEXA 5IM9A 5COHA 3UJ1A 3NZNA 3QDNA 1ERVA 2FWGA 3EMXA 3IK7A 3ZYWA 4E8EA 3QFAC 4FO5A 3GSSA 1TU7A 3LJRA 1WMJA 5ECQB 3TJFA 4HZ2A 2DMMA 1HQOA 5EPFA 1UA5A 1SD8A 5F05A 3ME7A 2ON7A 3WT1A 2WGRA 2YZUA 2FY6A 2IFQB 4XS4A 1PA3A 2PPTA 1A8LA 1GP1A 2CVDA 5JCGA 2MMAA 4ECIA 13GSA 4XIHA 3QAWA 5A4VA 2MYGA 3NIVA 2H0IA 3HJMA 4O92A 2LNTA 2RUEA 2E0QA 5ECPB 3VK9A 1GH2A 1N2AA 1MDJA 4I97A 4AJ8A 4ZL9A 1M2AA 1Z6MA 4I8BA 5A4UA 2MBSA 2XPDA 3HCZA 1A2LA 2HLSA 4HEA2 2YZHA 2F8FA 3TB2A 4WBJA 3GV1A 5JWOB 2PBJA 5EVOA 4HJMA 2IIYA 1F9MA 3GMFA 3LXTA 1FB6A 4KDUA 2C0GA 1R5AA 2H1DA 2FWEA 3E9JB 2FA4A 1G7EA 2I1UA 5CREA 3GKNA 1ABAA 4IHUA 3HZ8A 3TGZA 3A3TA 3DGQA 4HI7A 4V2MA 5JWRB 1B8XA 17GSA 3KXOA 5D8IA 5J5NA 2PN8A 3KGKA 4TOPA 3TOTA 1U3AA 3TKSC 1JLVA 2HSHA 1PD21 1K0MA 3UBKA 1OKDA 4OO5A 1TOFA 1DSBA 3LQ7A 3DD3A 1AC1A 2AUVA 2C0EA 4POLA 1GNEA 2K8SA 1YY7A 1K3YA 3HVXA 2LKUA 3TRPA 2IJYA 1FB0A 20GSA 5G1KA 1KTEA 1FAAA 4MF6A 4J2FA 4E8HA 4GWRA 4MH3A 5IMZA 2JZRA 1TRVA 3O76A 1RK4A 3F8UA 1OC9A 1TW9A 4ECJA 4J57E 3ZIJA 2IMFA 1H4OA 4WF4A 2V6KA 2AJQB 2YJHA 4KGIA 5IMFA 1IYHA 2B7JA 1G0TA 3VWXA 1AQWA 2R37A 3LFLA 5FHIA 1M7TA 2WJUA 3VPQA 2HYXA 3OR5A 3ERFA 1AAZA 4WBRD 4HS1A 3TOUA 4TW5A 6GSWA 3GKXA 1PL2A 3GX0A 3VI7A 2H0GA 2K18A 2DC5A 4TXVA 4HZ4A 4NV5A 2OE0A 1EGOA 3KH9A 1O73A 1A23A 4MK3A 1GLQA 3F4SA 1DE1A 1PN9A 1PKZA 1HNCA 1X9WB 1TK5B 2I81A 2JZSA 5D9VA 1Z5YE 2AV4A 1R4WA 4TR0A 4L8EA 3KTLA 2KHPA 1AUCA 3GH6A 1OC8A 3GYKA 10GSA 2WDUA 1X0RA 3HYPA 1ZYQB 5B8AA 4TR4A 2PWJA 1SYXA 2QC7A 3FR3A 2R4VA 1VRSD 1SJZA 4PXOA 3P7XA 2DJKA 3HKRA 4AF2A 2GVPA 1TRSA 3RBTA 4POBA 2IL3A 3TKSA 3WGXA 3QPMA 4L5OA 5GSSA 2X64A 4KA0A 5F06A 1XFLA 3C71A 4ILFA 4XRAA 4PQHA 5ECIB 3GHAA 2RIIA 3HY2A 3PGTA 2K8VA 3TJBA 5FT3A 4V1Ap 2YOIA 5ABRA 2GSSA 3P8WA 1ST9A 2ES7A 2P5RA 4OFMA 3QAGA 1MEKA 5LCZA 4G19A 3FZ5A 5GAPD 2FCHA 3HJOA 4ZILA 3UVHA
chains in the Genus database with same CATH superfamily
1OYJA 2C80A 3BOAA 6GSVA 1S3RA 3ZTLA 1F2EA 1O7UA 2X4AA 2DJ0A 1F37A 2J9HA 1X5DA 3TUEA 3RDWA 3H93A 3HXSA 3EU4A 2AHEA 5HFGA 4FYBA 1ML6A 2QGVA 2PUKC 1VGLA 4ZB6A 2GSQA 1YJ6A 3P90A 3W8SA 1THXA 4MPGA 2P0GA 5DCGA 2L6CA 2YNXA 3V1WA 2LUSA 3S9FA 1X5EA 1GTIA 1T00A 3D4MA 1TJDA 5DJMA 1XPVA 4ID0A 3C73A 2V1MA 5CO3A 2O85A 2HNLA 4MJEA 1O8WA 3H4KA 2B1KA 2X8HA 2XBQA 2XBIA 3UL3A 4MPFA 1BQ7A 1GSFA 2O7KA 1A2JA 3IXRA 3GL5A 1EGRA 1ERTA 4F9ZA 5DALA 1OE7A 5CRGA 3AY8A 3LORA 1G6YA 3FRCA 5DJLA 3UARA 1EOHA 3APQA 4JU5A 5GZZB 1FVKA 2JADA 3LSZA 1Z6NA 2H71A 5F07A 3IHQA 1EWXA 4GSSA 2HZEB 5DDLA 1Z7PA 1HD2A 4YKFA 2OBKA 3GH9A 2B6MA 3N9JA 3Q18A 2H1AA 2KOKA 4LL1B 4NHZA 4GSTA 4JEDA 5DAKA 5G1LA 4K1FA 4MZWA 1ZCPA 3K8NA 1MD4A 1NHYA 4D73B 3LEFA 1M2DA 2FA8A 2G2QA 5IOXA 4YQVA 3JCML 4MJBA 2WB9A 2WS2A 1U3IA 4TR1B 4KB3A 3MAKA 4PURA 2VCXA 3KIJA 1G6WA 4IS0A 2VCZA 2YWNA 4LLRA 2HRNA 3NOFA 2GZPA 1AW9A 1K0NA 2JL4A 4WKWA 4YQMA 1F6MC 3D22A 4TN8A 1EP8A 3VLNA 4PUAA 2HFDA 3P2AA 2I9HA 4K5RA 2CT6A 4NWYA 1YKCA 4KCEA 5AISA 4NXIA 4EVMA 4F0BA 1EOGA 3CRTA 1YF0A 4MMMA 2XPEA 1FVJA 4K2DA 1ERUA 4NMUA 3BD2A 4RI6A 1TU8A 3KP9A 1ZMAA 5KN2A 4EF0A 3TCOA 4YKGA 3I43A 3VPTA 1F3AA 2MMNA 3UIWA 3LG6A 3RPPA 2F3MA 1ZGNA 1PGTA 2M46A 4OWYA 4PUFC 1Y6EA 1QQ2A 1TTZA 1V40A 5EY6A 2A2SA 5H5SA 1QK8A 2RM5A 4P3YB 4HDEA 3GA4A 2VM2A 3GL3A 2E7PA 2C3QA 2HRFA 1SYRA 3D21A 1T8EB 2O87A 4FYCA 5LD0A 2IMKA 1TDIA 4KF9A 1K0OA 3QOUA 4XHMA 2HE3A 2OE3A 5EL8A 3KJYA 5D9WA 4KUNA 2B7KA 4MNNA 3ZRDA 2LS5A 3U5RE 2C0FA 3ZMKA 2I3YA 1SD9A 1OVNA 4EUYA 3EU3A 2R0GA 3G7YA 5FWGA 4GTUA 1GSDA 1PFOA 3F0IA 3M3MA 3ZVJA 2GT5A 2WZ9A 1WE0A 3QAVA 4ECBA 1GRXA 2X8GA 2MMOA 2OE1A 2RLIA 2CQ9A 1XWGA 1TKDB 4EO3A 5E4WA 1UN2A 3ZFBA 1SENA 4BIKA 3DXBA 2FGXA 1AQVA 1TRWA 2XHFA 2CA8A 1MDIA 3Q19A 1LU4A 4BWQA 4AGSA 3LW9A 3M9KA 4J56E 1XOAA 1Q98A 2IFQA 5HR3A 4TRXA 5IOWA 5D93A 3QD9A 1BX9A 1NM3A 4BWSA 1DE2A 2JU5A 2FWHA 4AJ6A 4CHSA 1GTBA 1TK8B 3MWHA 2VCVA 1PN0A 3IOSA 2O8VB 4HSCX 2K6VA 1K0BA 1GLPA 1Z9HA 1U88A 2GQLA 12GSA 2LRNA 3J7Yb 3FEUA 3M9JA 3D5JA 4I2UA 6GSSA 4BVYB 3L78A 2UZ8A 1OC9B 2DJ2A 4HQZA 3FR9A 3QCPA 4EIPA 5A5KA 3BCIA 1GTUA 4XCSA 3PPUA 4CY6A 3GTUB 2B1LA 3APSA 4WR5A 3DWVA 1Z3EA 2NPBA 1ZYNA 4MP4A 4RUVA 3IC4A 16GSA 2FWFA 3EMPA 1GUKA 3IBHA 3Q74A 2L5LA 2WFCA 5J9BA 2FLSA 3GRXA 3LWAA 3IA1A 4POKA 1WWJA 2BMXA 2LNSA 3ZL5A 3I6AA 3BBYA 3HD5A 3HVSA 5C04A 4ZL7A 5CYYA 4GXZA 1YKAA 3I69A 4JR4A 4L5LA 3IRAA 2V2GA 1GNWA 1RW1A 4IP6A 2E2GA 1T7PB 1Z7RA 3E0UA 4FYUA 4IQ1A 1TXXA 4NPBA 3D4TA 1SK0A 2VL2C 1K0CA 2N5AA 2IWTA 4PX1A 3GKKA 5INYA 1A8YA 1QXHA 3EINA 5CP1A 1ACVA 5AIVA 1JZDA 1SK2A 4OFTA 3CSIA 4V2LA 4ZB9A 4ZBDA 1JHBA 1FHEA 3L9UA 1X5CA 1W89A 1A24A 4GLTA 4FQUA 2LEGA 2CVKA 3RPNA 3SBCA 3TJKA 1V2AA 1V57A 1FO5A 1X9MB 2OADA 2EIOA 1GSEA 1OKTA 1QFNA 4ZBBA 3TKQA 1MTCA 1BYEA 4X0XA 3IC8A 4FIWA 1OE8A 5D9XA 1QUWA 4N0VA 4F82A 4YAPA 1GTAA 5DCHA 2EC4A 3A5WA 1J08A 3A2VA 4KE3A 2LQQA 1ERWA 1G7OA 4LL4B 1YQ1A 5KOXA 2CAIA 2YWIA 3MNGA 3M1GA 2B5YA 5IO0A 5ECRB 2VLUA 1ZL9A 5DQSA 2QA1A 1A0RP 3HVNA 2YWMA 5E59A 4PNGA 3IR4A 3M8NA 1LJRA 4ICYA 4IKHA 2IMEA 3D0ZA 1ZOFA 4EXJA 3UMAA 5ECOB 1A2MA 2PMTA 4I2TA 4JBBA 5AN1A 2C0DA 1T4ZA 5IMCA 3L4NA 2DMLA 2GT6A 1ZZYA 2M72A 1A0FA 1ON4A 2JSZA 2F8AA 5G5EA 4RI7A 3KD0A 19GSA 4YAVA 1NSWA 2EIRA 3W6GA 3IK9A 4KH7A 3US3A 3KH7A 1PL1A 3CSHA 3A2WA 2OJLA 3VWUA 2HSMA 2PGTA 4ML6A 1TI3A 4DSSB 2H8LA 3HHVA 1W4VA 2HZFA 5JCWA 5HR0A 3TKSE 3RHCA 2H1GA 2GSRA 3CQFA 3F3QA 2BJXA 2IPAA 2H0HA 3DIEA 1VF2A 2QSIA 3MSZA 3R3EA 2H30A 4L0UA 4ACSA 1EZKA 2DKHA 2E2MA 1GSUA 5JCUA 2IMDA 4BVXB 1OC3A 2VL2A 3F63A 4GSNA 3GN3A 5KOWA 3FHKA 4OD7A 4Z2UA 5ENUA 3DYRA 2F51A 2TRXA 1JZRA 5AGYA 3TJGA 2YCDA 1M9AA 3ERWA 4GF0A 3G9BA 5AIXA 1EP7A 1XW9A 2H76A 1F3BA 4X1UA 2K9FA 2VOCA 5J3RA 3ISOA 5B7CA 6GSYA 4TXOB 5KN0A 5G30A 2GQMA 2RUFA 1T3BA 2KP1A 4NHWA 1E2YA 4GQCA 2FUG2 5ECMB 1GL8A 2AYTA 4K7IA 3KM6A 1CQHA 5IMAA 1SJIA 3C1RA 4OMVA 3SWLA 4EIQA 2VD1A 1X9SB 1XOBA 1QGVA 3LXZA 4ML1A 3VI5A 4Z7XA 2PERA 2H74A 1GUHA 3W8JA 2DJ3A 2A2PA 3GKMA 3F6DA 3TRXA 1EEMA 18GSA 4IW9A 4HQSA 3D6IA 3F4TA 3F4RA 4JZQA 5J9CA 4ZXGA 3IDVA 3FK8A 4IQAA 1C72A 14GSA 4EKZA 2MMZA 2DJ1A 2LJRA 2OACA 1AQXA 4KDYA 2H66A 3LYPA 2TIRA 5H5RA 4WR4A 4V2NA 1K3LA 1JZWA 3IAS2 4GRFA 3HZ4A 2HZEA 2LQOA 1ILOA 2X8CA 4KNDA 2KLXA 5BMUA 5ID2B 1R26A 1SU9A 4IJ3A 2PVOC 3LGCA 4JE1A 2OBIA 1RQMA 2LRCA 2VLTA 2C8UA 5IQYA 3MYDA 4BL7A 2CV4A 2IN3A 2EIQA 2QA2A 3EPTA 4GCIA 2B5XA 4TKYA 3CSJA 4WXTA 2G0FA 2GQKA 1VF1A 4F0CA 2REMA 2OKAA 2YP6A 4JRRA 2JSYA 1TP9A 3DVXA 5G2ZA 4KW6A 5D73A 5J4UA 1AIUA 4HU7A 4K2XA 4ISDA 2A2RA 4Q5FA 1YF1A 3UAPA 2DSAA 4YQUA 4MCUA 4LMWA 4MZCA 3L9SA 4MABA 1JZOA 1GWCA 3EC3A 2H70A 5G31A 5ECSA 2X99A 4N0ZA 3GURA 1KNGA 2ON5A 1TI1A 2RM6A 3BCKA 3IAM2 4K6XA 4IN0A 4K0NA 3FMWA 2A4VA 3EE2A 1THOA 2LRTA 2CX4A 5IMDA 5IO2A 4HOJA 2H01A 2GSTA 3KTBA 3R2QA 3WD6A 3FZ9A 3ZFLA 4KCAA 5LNKe 2DIYA 3PR8A 3CXGA 4G10A 1AXDA 3UOMA 4XS4B 1PRXA 5B6NA 3WGDA 4X43A 2GTUA 1H75A 4XS1A 1URMA 3RHBA 1NHOA 4EE0A 4BPYA 2YN1A 4YH2A 3TJJA 2I4AA 1O85A 1M0UA 3H8QA 2B3SA 2H19A 2TRCP 5IPGA 1HNBA 4MF7A 1Y25A 1K0DA 3ERGA 1XXUA 4EL1A 4G9HA 4Q5QA 3I9V2 2FNOA 1SJ6A 4WF5A 3DEXA 2N5BA 2GDRA 4MZBA 1EEJA 1U6TA 4IELA 2H72A 1XWAA 2JACA 4PQIA 1SL0B 3U6VA 1R5PA 2H73A 2VO4A 2H75A 1GSSA 2VIMA 2L59A 3L9VA 3QFBC 2VCQA 3Q6OA 2KUCA 4K7NA 3C1SA 4OCFA 2M80A 5CRWA 3E3EA 1QMVA 2YWOA 1FW1A 3GUSA 4N10A 3EWLA 2GGTA 3GNJA 4F03A 2VL3A 1XG8A 4HUAA 3FR6A 1KBNA 5BRTA 3CMIA 4KSMA 2DLXA 2LV3A 4K0GA 1NW2A 4KSOA 5DVBA 5ECKB 3WYWA 4MH2A 2LSTA 1J0FA 1XVQA 4I5QA 1B9YC 3WT2A 5JWQB 3UVTA 4IBPA 1MD3A 2LTKA 1O6JA 3TDGA 2IMIA 5CRDA 1JFUA 1DBYA 3UEMA 5HR1A 2CAQA 1S3CA 1BJXA 1R7HA 1B4PA 4MF5A 4ULXA 1M3IA 3APOA 1K3OA 5F0GA 2H6ZA 1BEDA 2YJ7A 2V6OA 1UVZA 3C7MA 1XBSA 4O5RA 4G0KA 4ECCA 1PQNA 2VAFA 2VUPA 3DMLA 3EYTA 2QKEA 1WPIA 3M0FA 6GSUA 2L4CA 4AJ7A 3CYNA 3L0HA 4BVYA 4G0IA 1O8XA 2HRAA 2PVQA 3VFIA 1T4YA 2R2JA 5CNWA 1XWBA 1WIKA 3GTUA 1V58A 5IIZA 3ZITA 2R0CA 5ECHB 5B6MA 3HJPA 1PKWA 3QMXA 2HSYA 4O5UA 1YZXA 4MA9A 4CY8A 3A2XA 4PQ1A 1WRYA 3PH9A 4K7OA 3HA9A 4PNFA 2A4HA 4ZB8A 3H79A 3UBLA 1M9BA 1XVWA 3CTFA 1WJKA 1T1VA 2DJJA 3VWWA 4RQXA 5DQYA 5G5FA 5ELGA 1M2BA 1SKWB 3KZQA 5HFKA 4GQFA 1I5GA 4FH8A 1V98A 3CBUA 4WEYA 4G0LA 5DBQA 1IYIA 4MDCA 5HR2A 2C1YA 1S3AA 4MJAA 7GSSA 1MDKA 3MIXA 1HNAA 1XCCA 1XZOA 1M3JA 1TRUA 2BTOT 1VF4A 3GX8A 5L71A 1ZYEA 1VF3A 4EDZA 3O6TA 2FD3A 4NAXA 1FG4A 5HFIA 3GIXA 2MBTA 3KMOA 3H1NA 4XS6A 2D2ZA 5KN3A 1BG5A 4I6XA 3FW2A 2JZTA 5ELAA 2WCIA 3G7IA 4H86A 2H1BA 2R3XA 4HJ2A 4LA1A 3DKSA 1EV4A 5IMVA 3KEBA 1XWCA 2VCWA 1GSYA 3G7JA 3MDKA 3ED3A 4XRDA 3FZ4A 5HQPA 1YEPA 1J9BA 4DVCA 2WRTA 2ZUPA 3FZAA 2DBCA 2LJAA 2GLRA 4ZBAA 6GSTA 5KEJA 1EV9A 4XTSA 3WGEA 1U87A 2V32A 3ZZXA 4IVFA 2CVBA 3GSTA 2F9SA 1FOVA 1BAYA 2YPMA 3F9UA 2H6XA 4QL7A 2DKIA 4MLYA 3QR6A 4IP1A 2KP2A 3LYKA 4DEJA 1PX6A 1B4QA 6GSXA 4OFNA 5ECLB 2L57A 3C8EA 3KCMA 4MJCA 1XIYA 2VLVA 4DSSA 1SL2B 3EVIA 2GS3A 4RQRA 3F6FA 3N5OA 3KP8A 4OCEA 5CRHA 3BJ5A 4EDYA 3IV4A 1XW5A 3HDCA 4TR3A 3FY7A 1N8JA 1DUGA 5DALB 4V1Ag 2GZYA 1V9WA 3CRUA 2GZZA 4L0WA 5IPHA 2YV7A 4BVXA 4N11A 3J7Yk 4QQ7A 4PTSA 1B48A 2P5QA 1E6BA 2NDOA 4EC0A 2L5OA 1PSQA 2YANA 3F3RA 2CX3A 2C4JA 1O81A 5B8BA 2WULA 4IJIA 4POMA 5DAKB 4DSQA 3ZLPA 4WETA 4LMVA 1HYUA 4TXOA 3IE3A 5J41A 2AAWA 2NVLA 2L6DA 2CZ3A 1XW6A 1S3DA 4Q5NA 4KAEA 2L4QA 2J23A 3DRNA 1KEBA 2CZ2A 4OO4A 1PX7A 2ZNMA 4KDXA 4JR6A 2HXKA 2MZCA 5A4WA 3KMNA 4BA7A 2Z9SA 3IHGA 3PINA 2VL9A 2B5EA 1USBA 3RAZA 4ZL8A 1WOUA 5GAND 1B9XC 1XWKA 1UC7A 3ME8A 3ZMLA 4BL7B 4O32A 4CDOA 4DSRA 2C3TA 2OA7A 3HVVA 2VD0A 1JLWA 3DVWA 4PGTA 3O3TA 2C3NA 9GSSA 2P31A 1SKSB 5D9TA 4QL9A 2AB6A 1SL1B 3VWVA 1SKRB 2LJKA 4D73A 4TVEA 2O89A 5CAXA 2NBSA 4IGJA 5F8BA 4TR1A 2XC2A 11GSA 1PMTA 3ZREA 1TK0B 1YDKA 4CW9A 4N30A 1GSQA 2YV9A 2N5FA 2ALBA 4KX4A 3ZIVA 5GSTA 2HI7A 2NTOA 4ZIJA 3VURA 3IPZA 2R6KA 4NV2A 1I9DA 22GSA 3A5IA 5ID2A 8GSSA 4G2EA 1K0AA 3CTGA 4K8MA 4HU9A 1WP0A 5H5QA 3FKFA 5D96A 4A5PA 1CQGA 2VM1A 4F2IA 3TKRA 2ZCTA 3TKPA 2PU9C 1LBKA 2FHEA 3TRQA 3FYGA 1Q4JA 3ZVJD 2R5GA 4O7HA 5KN1A 1M99A 5C00A 2HT9A 4K9ZA 3GFKA 1GULA 1SK1A 1OAZA 2VCTA 2DIZA 1GUMA 4Q5RA 5ECNB 3EURA 2V41A 2H6YA 1YEXA 2R0PA 5IM9A 5COHA 3UJ1A 3NZNA 3QDNA 1ERVA 2FWGA 3EMXA 3IK7A 3ZYWA 4E8EA 3QFAC 4FO5A 3GSSA 4K5SA 1TU7A 3LJRA 1WMJA 5ECQB 3TJFA 4HZ2A 2DMMA 1HQOA 5EPFA 4Z2TA 1UA5A 1SD8A 5F05A 3ME7A 2ON7A 3WT1A 2WGRA 2YZUA 2FY6A 2IFQB 4XS4A 1PA3A 2PPTA 1A8LA 1GP1A 2CVDA 5JCGA 2MMAA 4ECIA 13GSA 4XIHA 3QAWA 5A4VA 2MYGA 3NIVA 2H0IA 3HJMA 4O92A 2LNTA 2RUEA 2E0QA 5ECPB 3VK9A 1GH2A 1N2AA 2X49A 1MDJA 4I97A 4AJ8A 4ZL9A 1M2AA 1Z6MA 4I8BA 5A4UA 2MBSA 2XPDA 3HCZA 1A2LA 2HLSA 4HEA2 2YZHA 2F8FA 3TB2A 4WBJA 3GV1A 5JWOB 2PBJA 5EVOA 4HJMA 2IIYA 1F9MA 3GMFA 2HRKA 3LXTA 1FB6A 4KDUA 2C0GA 1R5AA 2H1DA 2FWEA 3E9JB 2FA4A 1G7EA 2I1UA 5CREA 3GKNA 1ABAA 4IHUA 3HZ8A 3TGZA 3A3TA 3DGQA 4HI7A 4V2MA 5JWRB 1B8XA 17GSA 3KXOA 5D8IA 5J5NA 2PN8A 3KGKA 4TOPA 3TOTA 1U3AA 3TKSC 1JLVA 1ZYPA 2HSHA 1PD21 1K0MA 3UBKA 1OKDA 4OO5A 1TOFA 1DSBA 3LQ7A 3DD3A 1AC1A 2AUVA 2C0EA 4POLA 1GNEA 2K8SA 1YY7A 1K3YA 3HVXA 2LKUA 3TRPA 2IJYA 1FB0A 20GSA 5G1KA 1KTEA 1FAAA 4MF6A 4J2FA 4E8HA 4GWRA 4MH3A 5IMZA 2JZRA 4USSA 1TRVA 3O76A 1RK4A 3F8UA 1OC9A 1TW9A 4ECJA 4J57E 3ZIJA 2IMFA 4Z2RA 1H4OA 4WF4A 2V6KA 2AJQB 2YJHA 4KGIA 5IMFA 1IYHA 2B7JA 1G0TA 3VWXA 1AQWA 2R37A 3LFLA 5FHIA 1M7TA 2WJUA 3VPQA 2HYXA 3OR5A 3ERFA 1AAZA 4WBRD 4HS1A 3TOUA 4TW5A 6GSWA 3GKXA 1PL2A 1FOHA 3GX0A 3VI7A 2H0GA 2K18A 2DC5A 4TXVA 4HZ4A 4NV5A 2OE0A 1EGOA 3KH9A 1O73A 4X4JA 1A23A 4MK3A 1GLQA 3F4SA 1DE1A 1PN9A 1PKZA 1HNCA 1X9WB 1TK5B 2I81A 2JZSA 5D9VA 1Z5YE 2AV4A 1R4WA 4TR0A 4L8EA 3KTLA 2KHPA 1AUCA 3GH6A 1OC8A 3GYKA 4O5QA 10GSA 2WDUA 1X0RA 3HYPA 1ZYQB 5B8AA 4TR4A 2PWJA 1SYXA 2QC7A 3FR3A 2R4VA 1VRSD 1SJZA 4PXOA 3P7XA 2DJKA 3HKRA 4AF2A 2GVPA 1TRSA 3RBTA 4POBA 2IL3A 3TKSA 3WGXA 3QPMA 4L5OA 5GSSA 2X64A 4KA0A 5F06A 1XFLA 3C71A 4ILFA 4XRAA 4PQHA 5ECIB 3GHAA 2RIIA 3HY2A 3PGTA 2K8VA 3TJBA 5FT3A 4V1Ap 2YOIA 5ABRA 2GSSA 3P8WA 1ST9A 2ES7A 2P5RA 4OFMA 3QAGA 1MEKA 5LCZA 4G19A 3FZ5A 5GAPD 2FCHA 3HJOA 4ZILA 3UVHA
chains in the Genus database with same CATH topology
1OYJA 2C80A 3BOAA 6GSVA 3ZTLA 1F2EA 1O7UA 2X4AA 2DJ0A 1F37A 2J9HA 1X5DA 3TUEA 3RDWA 3H93A 3HXSA 3EU4A 2AHEA 5HFGA 4FYBA 1ML6A 2QGVA 2PUKC 1VGLA 4ZB6A 2GSQA 1YJ6A 3P90A 3W8SA 1THXA 4MPGA 2P0GA 5DCGA 2L6CA 2YNXA 3V1WA 2LUSA 3S9FA 1X5EA 1GTIA 1T00A 3D4MA 1TJDA 5DJMA 1XPVA 4ID0A 3C73A 2V1MA 5CO3A 2O85A 2HNLA 4MJEA 1O8WA 3H4KA 2B1KA 2X8HA 2XBQA 2XBIA 3UL3A 4MPFA 1BQ7A 1GSFA 2O7KA 1A2JA 3IXRA 3GL5A 1EGRA 1ERTA 4F9ZA 5DALA 1OE7A 5CRGA 3AY8A 3LORA 1G6YA 3FRCA 5DJLA 3UARA 1EOHA 3APQA 4JU5A 5GZZB 1FVKA 2JADA 3LSZA 1Z6NA 2H71A 5F07A 3IHQA 1EWXA 4GSSA 2HZEB 5DDLA 1Z7PA 1HD2A 4YKFA 2OBKA 3GH9A 2B6MA 3N9JA 3Q18A 2H1AA 2KOKA 4LL1B 4NHZA 4GSTA 4JEDA 5DAKA 5G1LA 4K1FA 4MZWA 1ZCPA 3K8NA 1MD4A 1NHYA 4D73B 3LEFA 1M2DA 2FA8A 2G2QA 5IOXA 4YQVA 3JCML 4MJBA 2WB9A 2WS2A 1U3IA 4TR1B 4KB3A 3MAKA 4PURA 2VCXA 3KIJA 1G6WA 4IS0A 2VCZA 2YWNA 4LLRA 2HRNA 3NOFA 2GZPA 1AW9A 1K0NA 2JL4A 4WKWA 4YQMA 1F6MC 3D22A 4TN8A 1EP8A 3VLNA 4PUAA 2HFDA 3P2AA 2I9HA 4K5RA 2CT6A 4NWYA 1YKCA 4KCEA 5AISA 4NXIA 4EVMA 4F0BA 1EOGA 3CRTA 1YF0A 4MMMA 2XPEA 1FVJA 4K2DA 1ERUA 4NMUA 3BD2A 4RI6A 1TU8A 3KP9A 1ZMAA 5KN2A 4EF0A 3TCOA 4YKGA 3I43A 3VPTA 1F3AA 2MMNA 3UIWA 3LG6A 3RPPA 2F3MA 1ZGNA 1PGTA 2M46A 4OWYA 4PUFC 1Y6EA 1QQ2A 1TTZA 1V40A 5EY6A 2A2SA 5H5SA 1QK8A 2RM5A 4P3YB 4HDEA 3GA4A 2VM2A 3GL3A 2E7PA 2C3QA 2HRFA 1SYRA 3D21A 1T8EB 2O87A 4FYCA 5LD0A 2IMKA 1TDIA 4KF9A 1K0OA 3QOUA 4XHMA 2HE3A 2OE3A 5EL8A 3KJYA 5D9WA 4KUNA 2B7KA 4MNNA 3ZRDA 2LS5A 3U5RE 2C0FA 3ZMKA 2I3YA 1SD9A 1OVNA 4EUYA 3EU3A 2R0GA 3G7YA 5FWGA 4GTUA 1GSDA 3F0IA 3M3MA 3ZVJA 2GT5A 2WZ9A 1WE0A 3QAVA 4ECBA 1GRXA 2X8GA 2MMOA 2OE1A 2RLIA 2CQ9A 1XWGA 1TKDB 4EO3A 5E4WA 1UN2A 3ZFBA 1SENA 3DXBA 2FGXA 1AQVA 1TRWA 2XHFA 2CA8A 1MDIA 3Q19A 1LU4A 4BWQA 4AGSA 3LW9A 3M9KA 4J56E 1XOAA 1Q98A 2IFQA 5HR3A 4TRXA 5IOWA 5D93A 3QD9A 1BX9A 1NM3A 4BWSA 1DE2A 2JU5A 2FWHA 4AJ6A 4CHSA 1GTBA 1TK8B 3MWHA 2VCVA 1PN0A 3IOSA 2O8VB 2K6VA 1K0BA 1GLPA 1Z9HA 1U88A 2GQLA 12GSA 2LRNA 3J7Yb 3FEUA 3M9JA 3D5JA 4I2UA 6GSSA 4BVYB 3L78A 2UZ8A 1OC9B 2DJ2A 4HQZA 3FR9A 3QCPA 4EIPA 5A5KA 3BCIA 1GTUA 4XCSA 3PPUA 4CY6A 3GTUB 2B1LA 3APSA 4WR5A 3DWVA 1Z3EA 2NPBA 1ZYNA 4MP4A 4RUVA 3IC4A 16GSA 2FWFA 3EMPA 1GUKA 3IBHA 3Q74A 2L5LA 2WFCA 5J9BA 2FLSA 3GRXA 3LWAA 3IA1A 4POKA 1WWJA 2BMXA 2LNSA 3ZL5A 3I6AA 3BBYA 3HD5A 3HVSA 5C04A 4ZL7A 5CYYA 4GXZA 1YKAA 3I69A 4JR4A 4L5LA 3IRAA 2V2GA 1GNWA 1RW1A 4IP6A 2E2GA 1T7PB 1Z7RA 3E0UA 4FYUA 4IQ1A 1TXXA 4NPBA 3D4TA 1SK0A 2VL2C 1K0CA 2N5AA 2IWTA 4PX1A 3GKKA 5INYA 1A8YA 1QXHA 3EINA 5CP1A 1ACVA 5AIVA 1JZDA 1SK2A 4OFTA 3CSIA 4V2LA 4ZB9A 4ZBDA 1JHBA 1FHEA 3L9UA 1X5CA 1W89A 1A24A 4GLTA 4FQUA 2LEGA 2CVKA 3RPNA 3SBCA 3TJKA 1V2AA 1V57A 1FO5A 1X9MB 2OADA 2EIOA 1GSEA 1OKTA 1QFNA 4ZBBA 3TKQA 1MTCA 1BYEA 4X0XA 3IC8A 4FIWA 1OE8A 5D9XA 1QUWA 4N0VA 4F82A 4YAPA 1GTAA 5DCHA 2EC4A 3A5WA 1J08A 3A2VA 4KE3A 2LQQA 1ERWA 1G7OA 4LL4B 1YQ1A 5KOXA 2CAIA 2YWIA 3MNGA 3M1GA 2B5YA 5IO0A 5ECRB 2VLUA 1ZL9A 5DQSA 2QA1A 1A0RP 4PNGA 2YWMA 5E59A 3IR4A 3M8NA 1LJRA 4ICYA 4IKHA 2IMEA 3D0ZA 1ZOFA 4EXJA 3UMAA 5ECOB 1A2MA 2PMTA 4I2TA 4JBBA 5AN1A 2C0DA 1T4ZA 5IMCA 3L4NA 2DMLA 2GT6A 1ZZYA 2M72A 1A0FA 1ON4A 2JSZA 2F8AA 5G5EA 4RI7A 3KD0A 19GSA 4YAVA 1NSWA 2EIRA 3W6GA 3IK9A 4KH7A 3US3A 3KH7A 1PL1A 3CSHA 3A2WA 2OJLA 3VWUA 2HSMA 2PGTA 4ML6A 1TI3A 4DSSB 2H8LA 3HHVA 1W4VA 2HZFA 5JCWA 5HR0A 3TKSE 3RHCA 2H1GA 2GSRA 3F3QA 2BJXA 2IPAA 2H0HA 3DIEA 1VF2A 2QSIA 3MSZA 3R3EA 2H30A 4L0UA 4ACSA 1EZKA 2DKHA 2E2MA 1GSUA 5JCUA 2IMDA 4BVXB 1OC3A 2VL2A 3F63A 4GSNA 3GN3A 5KOWA 3FHKA 4OD7A 4Z2UA 5ENUA 3DYRA 2F51A 2TRXA 1JZRA 5AGYA 3TJGA 2YCDA 1M9AA 3ERWA 4GF0A 3G9BA 5AIXA 1EP7A 1XW9A 2H76A 1F3BA 4X1UA 2K9FA 2VOCA 5J3RA 3ISOA 5B7CA 6GSYA 4TXOB 5KN0A 5G30A 2GQMA 2RUFA 1T3BA 2KP1A 4NHWA 1E2YA 4GQCA 2FUG2 5ECMB 1GL8A 2AYTA 4K7IA 3KM6A 1CQHA 5IMAA 1SJIA 3C1RA 4OMVA 3SWLA 4EIQA 2VD1A 1X9SB 1XOBA 1QGVA 3LXZA 4ML1A 3VI5A 4Z7XA 2PERA 2H74A 1GUHA 3W8JA 2DJ3A 2A2PA 3GKMA 3F6DA 3TRXA 1EEMA 18GSA 4IW9A 4HQSA 3D6IA 3F4TA 3F4RA 4JZQA 5J9CA 4ZXGA 3IDVA 3FK8A 4IQAA 1C72A 14GSA 4EKZA 2MMZA 2DJ1A 2LJRA 2OACA 1AQXA 4KDYA 2H66A 3LYPA 2TIRA 5H5RA 4WR4A 4V2NA 1K3LA 1JZWA 3IAS2 4GRFA 3HZ4A 2HZEA 2LQOA 1ILOA 2X8CA 4KNDA 2KLXA 5BMUA 5ID2B 1R26A 1SU9A 4IJ3A 2PVOC 3LGCA 4JE1A 2OBIA 1RQMA 2LRCA 2VLTA 2C8UA 5IQYA 3MYDA 4BL7A 2CV4A 2IN3A 2EIQA 2QA2A 3EPTA 4GCIA 2B5XA 4TKYA 3CSJA 4WXTA 2G0FA 2GQKA 1VF1A 4F0CA 2REMA 2OKAA 2YP6A 4JRRA 2JSYA 1TP9A 3DVXA 5G2ZA 4KW6A 5D73A 5J4UA 1AIUA 4HU7A 4K2XA 4ISDA 2A2RA 4Q5FA 1YF1A 3UAPA 2DSAA 4YQUA 4MCUA 4LMWA 4MZCA 3L9SA 4MABA 1JZOA 1GWCA 3EC3A 2H70A 5G31A 5ECSA 2X99A 4N0ZA 3GURA 1KNGA 2ON5A 1TI1A 2RM6A 3BCKA 3IAM2 4K6XA 4IN0A 4K0NA 3FMWA 2A4VA 3EE2A 1THOA 2LRTA 2CX4A 5IMDA 5IO2A 4HOJA 2H01A 2GSTA 3KTBA 3R2QA 3WD6A 3FZ9A 3ZFLA 4KCAA 5LNKe 2DIYA 3PR8A 3CXGA 4G10A 1AXDA 3UOMA 4XS4B 1PRXA 5B6NA 3WGDA 4X43A 2GTUA 1H75A 4XS1A 1URMA 3RHBA 1NHOA 4EE0A 4BPYA 2YN1A 4YH2A 3TJJA 2I4AA 1O85A 1M0UA 3H8QA 2B3SA 2H19A 2TRCP 5IPGA 1HNBA 4MF7A 1Y25A 1K0DA 3ERGA 1XXUA 4EL1A 4G9HA 4Q5QA 3I9V2 2FNOA 1SJ6A 4WF5A 3DEXA 2N5BA 2GDRA 4MZBA 1EEJA 1U6TA 4IELA 2H72A 1XWAA 2JACA 4PQIA 1SL0B 3U6VA 1R5PA 2H73A 2VO4A 2H75A 1GSSA 2VIMA 2L59A 3L9VA 3QFBC 2VCQA 3Q6OA 2KUCA 4K7NA 3C1SA 4OCFA 2M80A 5CRWA 3E3EA 1QMVA 2YWOA 1FW1A 3GUSA 4N10A 3EWLA 2GGTA 3GNJA 4F03A 2VL3A 4HUAA 3FR6A 1KBNA 5BRTA 3CMIA 4KSMA 2DLXA 2LV3A 4K0GA 1NW2A 4KSOA 5DVBA 5ECKB 3WYWA 4MH2A 2LSTA 1J0FA 1XVQA 4I5QA 1B9YC 3WT2A 5JWQB 3UVTA 4IBPA 1MD3A 2LTKA 1O6JA 3TDGA 2IMIA 5CRDA 1JFUA 1DBYA 3UEMA 5HR1A 2CAQA 1S3CA 1BJXA 1R7HA 1B4PA 4MF5A 4ULXA 3APOA 1K3OA 5F0GA 2H6ZA 1BEDA 2YJ7A 2V6OA 1UVZA 3C7MA 1XBSA 4O5RA 4G0KA 4ECCA 1PQNA 2VAFA 2VUPA 3DMLA 3EYTA 2QKEA 1WPIA 3M0FA 6GSUA 2L4CA 4AJ7A 3CYNA 3L0HA 4BVYA 4G0IA 1O8XA 2HRAA 2PVQA 3VFIA 1T4YA 2R2JA 5CNWA 1XWBA 1WIKA 3GTUA 1V58A 5IIZA 3ZITA 2R0CA 5ECHB 5B6MA 3HJPA 1PKWA 3QMXA 2HSYA 4O5UA 1YZXA 4MA9A 4CY8A 3A2XA 4PQ1A 1WRYA 3PH9A 4K7OA 3HA9A 4PNFA 2A4HA 4ZB8A 3H79A 3UBLA 1M9BA 1XVWA 3CTFA 1WJKA 1T1VA 2DJJA 3VWWA 4RQXA 5DQYA 5G5FA 5ELGA 1M2BA 1SKWB 3KZQA 5HFKA 4GQFA 1I5GA 4FH8A 1V98A 3CBUA 4WEYA 4G0LA 5DBQA 1IYIA 4MDCA 5HR2A 2C1YA 1S3AA 4MJAA 7GSSA 1MDKA 3MIXA 1HNAA 1XCCA 1XZOA 1TRUA 2BTOT 1VF4A 3GX8A 5L71A 1ZYEA 1VF3A 4EDZA 3O6TA 2FD3A 4NAXA 1FG4A 5HFIA 3GIXA 2MBTA 3KMOA 3H1NA 4XS6A 2D2ZA 5KN3A 1BG5A 4I6XA 3FW2A 2JZTA 5ELAA 2WCIA 3G7IA 4H86A 2H1BA 2R3XA 4HJ2A 4LA1A 3DKSA 1EV4A 5IMVA 3KEBA 1XWCA 2VCWA 1GSYA 3G7JA 3MDKA 3ED3A 4XRDA 3FZ4A 5HQPA 1YEPA 1J9BA 4DVCA 2WRTA 2ZUPA 3FZAA 2DBCA 2LJAA 2GLRA 4ZBAA 6GSTA 5KEJA 1EV9A 4XTSA 3WGEA 1U87A 2V32A 3ZZXA 4IVFA 2CVBA 3GSTA 2F9SA 1FOVA 1BAYA 2YPMA 3F9UA 2H6XA 4QL7A 2DKIA 4MLYA 3QR6A 4IP1A 2KP2A 3LYKA 4DEJA 1PX6A 1B4QA 6GSXA 4OFNA 5ECLB 2L57A 3C8EA 3KCMA 4MJCA 1XIYA 2VLVA 4DSSA 1SL2B 3EVIA 2GS3A 4RQRA 3F6FA 3N5OA 3KP8A 4OCEA 5CRHA 3BJ5A 4EDYA 3IV4A 1XW5A 3HDCA 4TR3A 3FY7A 1N8JA 1DUGA 5DALB 4V1Ag 2GZYA 1V9WA 3CRUA 2GZZA 4L0WA 5IPHA 2YV7A 4BVXA 4N11A 3J7Yk 4QQ7A 4PTSA 1B48A 2P5QA 1E6BA 2NDOA 4EC0A 2L5OA 1PSQA 2YANA 3F3RA 2CX3A 2C4JA 1O81A 5B8BA 2WULA 4IJIA 4POMA 5DAKB 4DSQA 3ZLPA 4WETA 4LMVA 1HYUA 4TXOA 3IE3A 5J41A 2AAWA 2NVLA 2L6DA 2CZ3A 1XW6A 1S3DA 4Q5NA 4KAEA 2L4QA 2J23A 3DRNA 1KEBA 2CZ2A 4OO4A 1PX7A 2ZNMA 4KDXA 4JR6A 2HXKA 2MZCA 5A4WA 3KMNA 4BA7A 2Z9SA 3IHGA 3PINA 2VL9A 2B5EA 1USBA 3RAZA 4ZL8A 1WOUA 5GAND 1B9XC 1XWKA 1UC7A 3ME8A 3ZMLA 4BL7B 4O32A 4CDOA 4DSRA 2C3TA 2OA7A 3HVVA 2VD0A 1JLWA 3DVWA 4PGTA 3O3TA 2C3NA 9GSSA 2P31A 1SKSB 5D9TA 4QL9A 2AB6A 1SL1B 3VWVA 1SKRB 2LJKA 4D73A 4TVEA 2O89A 5CAXA 2NBSA 4IGJA 5F8BA 4TR1A 2XC2A 11GSA 1PMTA 3ZREA 1TK0B 1YDKA 4CW9A 4N30A 1GSQA 2YV9A 2N5FA 2ALBA 4KX4A 3ZIVA 5GSTA 2HI7A 2NTOA 4ZIJA 3VURA 3IPZA 2R6KA 4NV2A 1I9DA 22GSA 3A5IA 5ID2A 8GSSA 4G2EA 1K0AA 3CTGA 4K8MA 4HU9A 1WP0A 5H5QA 3FKFA 5D96A 4A5PA 1CQGA 2VM1A 4F2IA 3TKRA 2ZCTA 3TKPA 2PU9C 1LBKA 2FHEA 3TRQA 3FYGA 1Q4JA 3ZVJD 2R5GA 4O7HA 5KN1A 1M99A 5C00A 2HT9A 4K9ZA 3GFKA 1GULA 1SK1A 1OAZA 2VCTA 2DIZA 1GUMA 4Q5RA 5ECNB 3EURA 2V41A 2H6YA 1YEXA 2R0PA 5IM9A 5COHA 3UJ1A 3NZNA 3QDNA 1ERVA 2FWGA 3EMXA 3IK7A 3ZYWA 4E8EA 3QFAC 4FO5A 3GSSA 4K5SA 1TU7A 3LJRA 1WMJA 5ECQB 3TJFA 4HZ2A 2DMMA 1HQOA 5EPFA 4Z2TA 1UA5A 1SD8A 5F05A 3ME7A 2ON7A 3WT1A 2WGRA 2YZUA 2FY6A 2IFQB 4XS4A 1PA3A 2PPTA 1A8LA 1GP1A 2CVDA 5JCGA 2MMAA 4ECIA 13GSA 4XIHA 3QAWA 5A4VA 2MYGA 3NIVA 2H0IA 3HJMA 4O92A 2LNTA 2RUEA 2E0QA 5ECPB 3VK9A 1GH2A 1N2AA 2X49A 1MDJA 4I97A 4AJ8A 4ZL9A 1M2AA 1Z6MA 4I8BA 5A4UA 2MBSA 2XPDA 3HCZA 1A2LA 2HLSA 4HEA2 2YZHA 2F8FA 3TB2A 4WBJA 3GV1A 5JWOB 2PBJA 5EVOA 4HJMA 2IIYA 1F9MA 3GMFA 2HRKA 3LXTA 1FB6A 4KDUA 2C0GA 1R5AA 2H1DA 2FWEA 3E9JB 2FA4A 1G7EA 2I1UA 5CREA 3GKNA 1ABAA 4IHUA 3HZ8A 3TGZA 3A3TA 3DGQA 4HI7A 4V2MA 5JWRB 1B8XA 17GSA 3KXOA 5D8IA 5J5NA 2PN8A 3KGKA 4TOPA 3TOTA 1U3AA 3TKSC 1JLVA 1ZYPA 2HSHA 1PD21 1K0MA 3UBKA 1OKDA 4OO5A 1TOFA 1DSBA 3LQ7A 3DD3A 1AC1A 2AUVA 2C0EA 4POLA 1GNEA 2K8SA 1YY7A 1K3YA 3HVXA 2LKUA 3TRPA 2IJYA 1FB0A 20GSA 5G1KA 1KTEA 1FAAA 4MF6A 4J2FA 4E8HA 4GWRA 4MH3A 5IMZA 2JZRA 4USSA 1TRVA 3O76A 1RK4A 3F8UA 1OC9A 1TW9A 4ECJA 4J57E 3ZIJA 2IMFA 4Z2RA 1H4OA 4WF4A 2V6KA 2AJQB 2YJHA 4KGIA 5IMFA 1IYHA 2B7JA 1G0TA 3VWXA 1AQWA 2R37A 3LFLA 5FHIA 1M7TA 2WJUA 3VPQA 2HYXA 3OR5A 3ERFA 1AAZA 4WBRD 4HS1A 3TOUA 4TW5A 6GSWA 3GKXA 1PL2A 1FOHA 3GX0A 3VI7A 2H0GA 2K18A 2DC5A 4TXVA 4HZ4A 4NV5A 2OE0A 1EGOA 3KH9A 1O73A 4X4JA 1A23A 4MK3A 1GLQA 3F4SA 1DE1A 1PN9A 1PKZA 1HNCA 1X9WB 1TK5B 2I81A 2JZSA 5D9VA 1Z5YE 2AV4A 1R4WA 4TR0A 4L8EA 3KTLA 2KHPA 1AUCA 3GH6A 1OC8A 3GYKA 4O5QA 10GSA 2WDUA 1X0RA 3HYPA 1ZYQB 5B8AA 4TR4A 2PWJA 1SYXA 2QC7A 3FR3A 2R4VA 1VRSD 1SJZA 4PXOA 3P7XA 2DJKA 3HKRA 4AF2A 2GVPA 1TRSA 3RBTA 4POBA 2IL3A 3TKSA 3WGXA 3QPMA 4L5OA 5GSSA 2X64A 4KA0A 5F06A 1XFLA 3C71A 4ILFA 4XRAA 4PQHA 5ECIB 3GHAA 2RIIA 3HY2A 3PGTA 2K8VA 3TJBA 5FT3A 4V1Ap 2YOIA 5ABRA 2GSSA 3P8WA 1ST9A 2ES7A 2P5RA 4OFMA 3QAGA 1MEKA 5LCZA 4G19A 3FZ5A 5GAPD 2FCHA 3HJOA 4ZILA 3UVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYJ A;  2C80 A;  3BOA A;  6GSV A;  3ZTL A;  1F2E A;  1O7U A;  2DJ0 A;  1F37 A;  2J9H A;  1X5D A;  3TUE A;  3RDW A;  3H93 A;  3HXS A;  3EU4 A;  2AHE A;  5HFG A;  4FYB A;  1ML6 A;  2QGV A;  2PUK C;  1VGL A;  4ZB6 A;  2GSQ A;  1YJ6 A;  3P90 A;  3W8S A;  1THX A;  4MPG A;  2P0G A;  5DCG A;  2L6C A;  2YNX A;  3V1W A;  2LUS A;  3S9F A;  1X5E A;  1GTI A;  1T00 A;  3D4M A;  1TJD A;  5DJM A;  1XPV A;  4ID0 A;  3C73 A;  2V1M A;  5CO3 A;  2O85 A;  2HNL A;  4MJE A;  1O8W A;  3H4K A;  2B1K A;  2X8H A;  2XBQ A;  2XBI A;  3UL3 A;  4MPF A;  1BQ7 A;  1GSF A;  2O7K A;  1A2J A;  3IXR A;  3GL5 A;  1EGR A;  1ERT A;  4F9Z A;  5DAL A;  1OE7 A;  5CRG A;  3AY8 A;  3LOR A;  1G6Y A;  3FRC A;  5DJL A;  3UAR A;  1EOH A;  3APQ A;  4JU5 A;  5GZZ B;  1FVK A;  2JAD A;  3LSZ A;  1Z6N A;  2H71 A;  5F07 A;  3IHQ A;  1EWX A;  4GSS A;  2HZE B;  5DDL A;  1Z7P A;  1HD2 A;  2OBK A;  3GH9 A;  2B6M A;  3N9J A;  3Q18 A;  2H1A A;  2KOK A;  4LL1 B;  4NHZ A;  4GST A;  4JED A;  5DAK A;  5G1L A;  4K1F A;  4MZW A;  1ZCP A;  3K8N A;  1MD4 A;  1NHY A;  4D73 B;  3LEF A;  1M2D A;  2FA8 A;  2G2Q A;  5IOX A;  4YQV A;  3JCM L;  4MJB A;  2WB9 A;  2WS2 A;  1U3I A;  4TR1 B;  4KB3 A;  3MAK A;  4PUR A;  2VCX A;  3KIJ A;  1G6W A;  4IS0 A;  2VCZ A;  2YWN A;  4LLR A;  2HRN A;  3NOF A;  2GZP A;  1AW9 A;  1K0N A;  2JL4 A;  4WKW A;  4YQM A;  1F6M C;  3D22 A;  4TN8 A;  1EP8 A;  3VLN A;  4PUA A;  2HFD A;  3P2A A;  2I9H A;  2CT6 A;  4NWY A;  1YKC A;  4KCE A;  5AIS A;  4NXI A;  4EVM A;  4F0B A;  1EOG A;  3CRT A;  1YF0 A;  4MMM A;  2XPE A;  1FVJ A;  4K2D A;  1ERU A;  4NMU A;  3BD2 A;  4RI6 A;  1TU8 A;  3KP9 A;  1ZMA A;  5KN2 A;  4EF0 A;  3TCO A;  3I43 A;  3VPT A;  1F3A A;  2MMN A;  3UIW A;  3LG6 A;  3RPP A;  2F3M A;  1ZGN A;  1PGT A;  2M46 A;  4OWY A;  4PUF C;  1Y6E A;  1QQ2 A;  1TTZ A;  1V40 A;  5EY6 A;  2A2S A;  5H5S A;  1QK8 A;  2RM5 A;  4P3Y B;  4HDE A;  3GA4 A;  2VM2 A;  3GL3 A;  2E7P A;  2C3Q A;  2HRF A;  1SYR A;  3D21 A;  1T8E B;  2O87 A;  4FYC A;  5LD0 A;  2IMK A;  1TDI A;  1K0O A;  3QOU A;  4XHM A;  2HE3 A;  2OE3 A;  5EL8 A;  3KJY A;  5D9W A;  4KUN A;  2B7K A;  3ZRD A;  2LS5 A;  3U5R E;  2C0F A;  3ZMK A;  2I3Y A;  1SD9 A;  1OVN A;  4EUY A;  3EU3 A;  3G7Y A;  5FWG A;  4GTU A;  1GSD A;  3F0I A;  3M3M A;  3ZVJ A;  2GT5 A;  2WZ9 A;  1WE0 A;  3QAV A;  4ECB A;  1GRX A;  2X8G A;  2MMO A;  2OE1 A;  2RLI A;  2CQ9 A;  1XWG A;  1TKD B;  4EO3 A;  5E4W A;  1UN2 A;  3ZFB A;  1SEN A;  3DXB A;  2FGX A;  1AQV A;  1TRW A;  2XHF A;  2CA8 A;  1MDI A;  3Q19 A;  1LU4 A;  4BWQ A;  4AGS A;  3M9K A;  4J56 E;  1XOA A;  1Q98 A;  2IFQ A;  5HR3 A;  4TRX A;  5IOW A;  5D93 A;  3QD9 A;  1BX9 A;  1NM3 A;  4BWS A;  1DE2 A;  2JU5 A;  2FWH A;  4AJ6 A;  4CHS A;  1GTB A;  1TK8 B;  3MWH A;  2VCV A;  3IOS A;  2O8V B;  2K6V A;  1K0B A;  1GLP A;  1Z9H A;  1U88 A;  2GQL A;  12GS A;  2LRN A;  3J7Y b;  3FEU A;  3M9J A;  3D5J A;  4I2U A;  6GSS A;  3L78 A;  1OC9 B;  2DJ2 A;  4HQZ A;  3FR9 A;  3QCP A;  5A5K A;  3BCI A;  1GTU A;  4XCS A;  3GTU B;  2B1L A;  3APS A;  4WR5 A;  3DWV A;  1Z3E A;  2NPB A;  4MP4 A;  4RUV A;  3IC4 A;  16GS A;  2FWF A;  3EMP A;  1GUK A;  3IBH A;  3Q74 A;  2L5L A;  2WFC A;  5J9B A;  2FLS A;  3GRX A;  3LWA A;  3IA1 A;  4POK A;  1WWJ A;  2BMX A;  2LNS A;  3ZL5 A;  3I6A A;  3BBY A;  3HD5 A;  3HVS A;  5C04 A;  4ZL7 A;  5CYY A;  4GXZ A;  1YKA A;  3I69 A;  4JR4 A;  4L5L A;  3IRA A;  2V2G A;  1GNW A;  1RW1 A;  4IP6 A;  2E2G A;  1T7P B;  1Z7R A;  3E0U A;  4FYU A;  4IQ1 A;  1TXX A;  4NPB A;  3D4T A;  1SK0 A;  2VL2 C;  1K0C A;  2N5A A;  2IWT A;  4PX1 A;  3GKK A;  5INY A;  1A8Y A;  1QXH A;  3EIN A;  5CP1 A;  1ACV A;  5AIV A;  1JZD A;  1SK2 A;  4OFT A;  3CSI A;  4V2L A;  4ZB9 A;  4ZBD A;  1JHB A;  1FHE A;  3L9U A;  1X5C A;  1W89 A;  1A24 A;  4GLT A;  2LEG A;  2CVK A;  3RPN A;  3SBC A;  3TJK A;  1V2A A;  1V57 A;  1FO5 A;  1X9M B;  2OAD A;  2EIO A;  1GSE A;  1OKT A;  1QFN A;  4ZBB A;  3TKQ A;  1MTC A;  1BYE A;  4X0X A;  4FIW A;  1OE8 A;  5D9X A;  1QUW A;  4N0V A;  4F82 A;  4YAP A;  1GTA A;  5DCH A;  2EC4 A;  3A5W A;  1J08 A;  3A2V A;  4KE3 A;  2LQQ A;  1ERW A;  1G7O A;  4LL4 B;  1YQ1 A;  2CAI A;  2YWI A;  3MNG A;  3M1G A;  2B5Y A;  5IO0 A;  5ECR B;  2VLU A;  1ZL9 A;  5DQS A;  1A0R P;  4PNG A;  2YWM A;  5E59 A;  3IR4 A;  3M8N A;  1LJR A;  4IKH A;  2IME A;  3D0Z A;  1ZOF A;  4EXJ A;  3UMA A;  5ECO B;  1A2M A;  2PMT A;  4I2T A;  4JBB A;  5AN1 A;  2C0D A;  1T4Z A;  5IMC A;  3L4N A;  2DML A;  2GT6 A;  1ZZY A;  2M72 A;  1A0F A;  1ON4 A;  2JSZ A;  2F8A A;  5G5E A;  4RI7 A;  3KD0 A;  19GS A;  4YAV A;  1NSW A;  2EIR A;  3W6G A;  3IK9 A;  4KH7 A;  3US3 A;  3KH7 A;  1PL1 A;  3CSH A;  3A2W A;  2OJL A;  3VWU A;  2PGT A;  4ML6 A;  1TI3 A;  4DSS B;  2H8L A;  3HHV A;  1W4V A;  2HZF A;  5JCW A;  5HR0 A;  3TKS E;  3RHC A;  2H1G A;  2GSR A;  3F3Q A;  2BJX A;  2IPA A;  2H0H A;  3DIE A;  1VF2 A;  2QSI A;  3MSZ A;  2H30 A;  4L0U A;  4ACS A;  1EZK A;  2E2M A;  1GSU A;  5JCU A;  2IMD A;  1OC3 A;  2VL2 A;  3F63 A;  4GSN A;  3GN3 A;  3FHK A;  4OD7 A;  5ENU A;  3DYR A;  2F51 A;  2TRX A;  1JZR A;  5AGY A;  3TJG A;  2YCD A;  1M9A A;  3ERW A;  4GF0 A;  3G9B A;  5AIX A;  1EP7 A;  1XW9 A;  2H76 A;  1F3B A;  4X1U A;  2K9F A;  2VOC A;  5J3R A;  3ISO A;  5B7C A;  6GSY A;  4TXO B;  5KN0 A;  5G30 A;  2GQM A;  2RUF A;  1T3B A;  2KP1 A;  4NHW A;  1E2Y A;  4GQC A;  2FUG 2;  5ECM B;  1GL8 A;  2AYT A;  4K7I A;  3KM6 A;  1CQH A;  5IMA A;  1SJI A;  3C1R A;  4OMV A;  3SWL A;  2VD1 A;  1X9S B;  1XOB A;  1QGV A;  3LXZ A;  4ML1 A;  3VI5 A;  4Z7X A;  2PER A;  2H74 A;  1GUH A;  3W8J A;  2DJ3 A;  3GKM A;  3F6D A;  3TRX A;  1EEM A;  18GS A;  4IW9 A;  4HQS A;  3D6I A;  3F4T A;  3F4R A;  4JZQ A;  5J9C A;  4ZXG A;  3IDV A;  3FK8 A;  4IQA A;  1C72 A;  14GS A;  4EKZ A;  2MMZ A;  2DJ1 A;  2LJR A;  2OAC A;  1AQX A;  4KDY A;  2H66 A;  3LYP A;  2TIR A;  5H5R A;  4WR4 A;  4V2N A;  1K3L A;  1JZW A;  3IAS 2;  4GRF A;  3HZ4 A;  2HZE A;  2LQO A;  1ILO A;  2X8C A;  4KND A;  2KLX A;  5ID2 B;  1R26 A;  1SU9 A;  4IJ3 A;  2PVO C;  3LGC A;  4JE1 A;  2OBI A;  1RQM A;  2LRC A;  2VLT A;  2C8U A;  5IQY A;  4BL7 A;  2CV4 A;  2IN3 A;  2EIQ A;  4GCI A;  2B5X A;  4TKY A;  3CSJ A;  4WXT A;  2G0F A;  2GQK A;  1VF1 A;  4F0C A;  2REM A;  2OKA A;  2YP6 A;  4JRR A;  2JSY A;  1TP9 A;  3DVX A;  5G2Z A;  4KW6 A;  5D73 A;  5J4U A;  1AIU A;  4HU7 A;  4ISD A;  2A2R A;  4Q5F A;  1YF1 A;  3UAP A;  2DSA A;  4YQU A;  4MCU A;  4LMW A;  4MZC A;  3L9S A;  4MAB A;  1JZO A;  1GWC A;  3EC3 A;  2H70 A;  5G31 A;  5ECS A;  2X99 A;  4N0Z A;  3GUR A;  1KNG A;  2ON5 A;  1TI1 A;  2RM6 A;  3BCK A;  3IAM 2;  4K6X A;  4IN0 A;  4K0N A;  2A4V A;  3EE2 A;  1THO A;  2LRT A;  2CX4 A;  5IMD A;  5IO2 A;  4HOJ A;  2H01 A;  2GST A;  3KTB A;  3R2Q A;  3WD6 A;  3FZ9 A;  3ZFL A;  4KCA A;  5LNK e;  2DIY A;  3PR8 A;  3CXG A;  4G10 A;  1AXD A;  3UOM A;  4XS4 B;  1PRX A;  5B6N A;  3WGD A;  4X43 A;  2GTU A;  1H75 A;  4XS1 A;  1URM A;  3RHB A;  1NHO A;  4EE0 A;  4BPY A;  2YN1 A;  4YH2 A;  3TJJ A;  2I4A A;  1O85 A;  1M0U A;  3H8Q A;  2B3S A;  2H19 A;  2TRC P;  5IPG A;  1HNB A;  4MF7 A;  1Y25 A;  1K0D A;  3ERG A;  1XXU A;  4EL1 A;  4G9H A;  4Q5Q A;  3I9V 2;  2FNO A;  1SJ6 A;  4WF5 A;  3DEX A;  2N5B A;  2GDR A;  4MZB A;  1EEJ A;  1U6T A;  4IEL A;  2H72 A;  1XWA A;  2JAC A;  4PQI A;  1SL0 B;  3U6V A;  1R5P A;  2H73 A;  2VO4 A;  2H75 A;  1GSS A;  2VIM A;  2L59 A;  3L9V A;  3QFB C;  2VCQ A;  3Q6O A;  2KUC A;  4K7N A;  3C1S A;  4OCF A;  2M80 A;  5CRW A;  3E3E A;  1QMV A;  2YWO A;  1FW1 A;  3GUS A;  4N10 A;  3EWL A;  2GGT A;  3GNJ A;  4F03 A;  2VL3 A;  4HUA A;  3FR6 A;  1KBN A;  3CMI A;  4KSM A;  2DLX A;  2LV3 A;  4K0G A;  1NW2 A;  4KSO A;  5DVB A;  5ECK B;  3WYW A;  4MH2 A;  2LST A;  1J0F A;  1XVQ A;  4I5Q A;  1B9Y C;  3WT2 A;  5JWQ B;  3UVT A;  4IBP A;  1MD3 A;  2LTK A;  1O6J A;  3TDG A;  2IMI A;  5CRD A;  1JFU A;  1DBY A;  3UEM A;  5HR1 A;  2CAQ A;  1S3C A;  1BJX A;  1R7H A;  1B4P A;  4MF5 A;  4ULX A;  3APO A;  1K3O A;  5F0G A;  2H6Z A;  1BED A;  2YJ7 A;  2V6O A;  1UVZ A;  3C7M A;  1XBS A;  4O5R A;  4ECC A;  1PQN A;  2VAF A;  2VUP A;  3DML A;  3EYT A;  2QKE A;  1WPI A;  3M0F A;  6GSU A;  2L4C A;  4AJ7 A;  3CYN A;  3L0H A;  4BVY A;  1O8X A;  2PVQ A;  3VFI A;  1T4Y A;  2R2J A;  5CNW A;  1XWB A;  1WIK A;  3GTU A;  1V58 A;  5IIZ A;  3ZIT A;  5ECH B;  5B6M A;  3HJP A;  1PKW A;  3QMX A;  2HSY A;  1YZX A;  4MA9 A;  3A2X A;  4PQ1 A;  1WRY A;  3PH9 A;  4K7O A;  3HA9 A;  4PNF A;  4ZB8 A;  3H79 A;  3UBL A;  1M9B A;  1XVW A;  3CTF A;  1WJK A;  1T1V A;  2DJJ A;  3VWW A;  4RQX A;  5DQY A;  5G5F A;  5ELG A;  1M2B A;  1SKW B;  3KZQ A;  5HFK A;  4GQF A;  1I5G A;  4FH8 A;  1V98 A;  3CBU A;  4WEY A;  5DBQ A;  1IYI A;  4MDC A;  5HR2 A;  2C1Y A;  1S3A A;  4MJA A;  7GSS A;  1MDK A;  1HNA A;  1XCC A;  1XZO A;  1TRU A;  2BTO T;  1VF4 A;  3GX8 A;  5L71 A;  1ZYE A;  1VF3 A;  4EDZ A;  3O6T A;  2FD3 A;  4NAX A;  1FG4 A;  5HFI A;  3GIX A;  2MBT A;  3KMO A;  3H1N A;  4XS6 A;  2D2Z A;  5KN3 A;  1BG5 A;  4I6X A;  3FW2 A;  2JZT A;  5ELA A;  2WCI A;  3G7I A;  4H86 A;  2H1B A;  2R3X A;  4HJ2 A;  4LA1 A;  3DKS A;  1EV4 A;  5IMV A;  3KEB A;  1XWC A;  2VCW A;  1GSY A;  3G7J A;  3MDK A;  3ED3 A;  4XRD A;  3FZ4 A;  5HQP A;  1YEP A;  1J9B A;  4DVC A;  2WRT A;  2ZUP A;  3FZA A;  2DBC A;  2LJA A;  2GLR A;  4ZBA A;  6GST A;  5KEJ A;  1EV9 A;  4XTS A;  3WGE A;  1U87 A;  2V32 A;  3ZZX A;  4IVF A;  2CVB A;  3GST A;  2F9S A;  1FOV A;  1BAY A;  2YPM A;  3F9U A;  2H6X A;  4QL7 A;  4MLY A;  3QR6 A;  4IP1 A;  2KP2 A;  3LYK A;  4DEJ A;  1PX6 A;  1B4Q A;  6GSX A;  4OFN A;  5ECL B;  2L57 A;  3C8E A;  3KCM A;  4MJC A;  1XIY A;  2VLV A;  4DSS A;  1SL2 B;  3EVI A;  2GS3 A;  4RQR A;  3F6F A;  3N5O A;  3KP8 A;  4OCE A;  5CRH A;  3BJ5 A;  4EDY A;  3IV4 A;  1XW5 A;  3HDC A;  4TR3 A;  3FY7 A;  1N8J A;  1DUG A;  5DAL B;  4V1A g;  2GZY A;  1V9W A;  3CRU A;  2GZZ A;  4L0W A;  5IPH A;  2YV7 A;  4BVX A;  4N11 A;  3J7Y k;  4QQ7 A;  1B48 A;  2P5Q A;  1E6B A;  2NDO A;  4EC0 A;  2L5O A;  1PSQ A;  2YAN A;  3F3R A;  2CX3 A;  2C4J A;  1O81 A;  5B8B A;  2WUL A;  4IJI A;  4POM A;  5DAK B;  4DSQ A;  3ZLP A;  4WET A;  4LMV A;  1HYU A;  4TXO A;  3IE3 A;  5J41 A;  2AAW A;  2NVL A;  2L6D A;  2CZ3 A;  1XW6 A;  1S3D A;  4Q5N A;  4KAE A;  2L4Q A;  2J23 A;  3DRN A;  1KEB A;  2CZ2 A;  4OO4 A;  1PX7 A;  2ZNM A;  4KDX A;  4JR6 A;  2HXK A;  2MZC A;  5A4W A;  3KMN A;  4BA7 A;  2Z9S A;  3PIN A;  2VL9 A;  2B5E A;  1USB A;  3RAZ A;  4ZL8 A;  1WOU A;  5GAN D;  1B9X C;  1XWK A;  1UC7 A;  3ME8 A;  3ZML A;  4O32 A;  4CDO A;  4DSR A;  2C3T A;  2OA7 A;  3HVV A;  2VD0 A;  1JLW A;  3DVW A;  4PGT A;  3O3T A;  2C3N A;  9GSS A;  2P31 A;  1SKS B;  5D9T A;  4QL9 A;  2AB6 A;  1SL1 B;  3VWV A;  1SKR B;  2LJK A;  4D73 A;  4TVE A;  2O89 A;  5CAX A;  2NBS A;  4IGJ A;  5F8B A;  4TR1 A;  2XC2 A;  11GS A;  1PMT A;  3ZRE A;  1TK0 B;  1YDK A;  4CW9 A;  4N30 A;  1GSQ A;  2YV9 A;  2N5F A;  2ALB A;  4KX4 A;  3ZIV A;  5GST A;  2HI7 A;  2NTO A;  4ZIJ A;  3VUR A;  3IPZ A;  2R6K A;  4NV2 A;  1I9D A;  22GS A;  5ID2 A;  8GSS A;  4G2E A;  1K0A A;  3CTG A;  4K8M A;  4HU9 A;  1WP0 A;  5H5Q A;  3FKF A;  5D96 A;  1CQG A;  2VM1 A;  4F2I A;  3TKR A;  2ZCT A;  3TKP A;  2PU9 C;  1LBK A;  2FHE A;  3TRQ A;  3FYG A;  1Q4J A;  3ZVJ D;  2R5G A;  4O7H A;  5KN1 A;  1M99 A;  5C00 A;  2HT9 A;  4K9Z A;  3GFK A;  1GUL A;  1SK1 A;  1OAZ A;  2VCT A;  2DIZ A;  1GUM A;  4Q5R A;  5ECN B;  3EUR A;  2V41 A;  2H6Y A;  1YEX A;  5IM9 A;  5COH A;  3UJ1 A;  3NZN A;  3QDN A;  1ERV A;  2FWG A;  3EMX A;  3IK7 A;  3ZYW A;  4E8E A;  3QFA C;  4FO5 A;  3GSS A;  1TU7 A;  3LJR A;  1WMJ A;  5ECQ B;  3TJF A;  4HZ2 A;  2DMM A;  1HQO A;  5EPF A;  1UA5 A;  1SD8 A;  5F05 A;  3ME7 A;  2ON7 A;  3WT1 A;  2WGR A;  2YZU A;  2FY6 A;  2IFQ B;  4XS4 A;  1PA3 A;  2PPT A;  1A8L A;  1GP1 A;  2CVD A;  5JCG A;  2MMA A;  4ECI A;  13GS A;  4XIH A;  3QAW A;  5A4V A;  2MYG A;  3NIV A;  2H0I A;  3HJM A;  4O92 A;  2LNT A;  2RUE A;  2E0Q A;  5ECP B;  3VK9 A;  1GH2 A;  1N2A A;  1MDJ A;  4I97 A;  4AJ8 A;  4ZL9 A;  1M2A A;  1Z6M A;  4I8B A;  5A4U A;  2MBS A;  2XPD A;  3HCZ A;  1A2L A;  2HLS A;  4HEA 2;  2YZH A;  2F8F A;  3TB2 A;  4WBJ A;  3GV1 A;  5JWO B;  2PBJ A;  5EVO A;  4HJM A;  2IIY A;  1F9M A;  3GMF A;  3LXT A;  1FB6 A;  4KDU A;  2C0G A;  1R5A A;  2H1D A;  2FWE A;  3E9J B;  2FA4 A;  1G7E A;  2I1U A;  5CRE A;  3GKN A;  1ABA A;  4IHU A;  3HZ8 A;  3TGZ A;  3A3T A;  3DGQ A;  4HI7 A;  4V2M A;  5JWR B;  1B8X A;  17GS A;  3KXO A;  5D8I A;  5J5N A;  2PN8 A;  3KGK A;  4TOP A;  3TOT A;  1U3A A;  3TKS C;  1JLV A;  2HSH A;  1PD2 1;  1K0M A;  3UBK A;  1OKD A;  4OO5 A;  1TOF A;  1DSB A;  3LQ7 A;  3DD3 A;  1AC1 A;  2AUV A;  2C0E A;  4POL A;  1GNE A;  2K8S A;  1YY7 A;  1K3Y A;  3HVX A;  2LKU A;  3TRP A;  2IJY A;  1FB0 A;  20GS A;  5G1K A;  1KTE A;  1FAA A;  4MF6 A;  4J2F A;  4E8H A;  4GWR A;  4MH3 A;  5IMZ A;  2JZR A;  1TRV A;  3O76 A;  1RK4 A;  3F8U A;  1OC9 A;  1TW9 A;  4ECJ A;  4J57 E;  3ZIJ A;  2IMF A;  1H4O A;  4WF4 A;  2V6K A;  2AJQ B;  2YJH A;  4KGI A;  5IMF A;  1IYH A;  2B7J A;  1G0T A;  3VWX A;  1AQW A;  2R37 A;  3LFL A;  5FHI A;  1M7T A;  2WJU A;  3VPQ A;  2HYX A;  3OR5 A;  3ERF A;  1AAZ A;  4WBR D;  4HS1 A;  3TOU A;  4TW5 A;  6GSW A;  3GKX A;  1PL2 A;  3GX0 A;  3VI7 A;  2H0G A;  2K18 A;  2DC5 A;  4TXV A;  4HZ4 A;  4NV5 A;  2OE0 A;  1EGO A;  3KH9 A;  1O73 A;  1A23 A;  4MK3 A;  1GLQ A;  3F4S A;  1DE1 A;  1PN9 A;  1PKZ A;  1HNC A;  1X9W B;  1TK5 B;  2I81 A;  2JZS A;  5D9V A;  1Z5Y E;  2AV4 A;  1R4W A;  4TR0 A;  4L8E A;  3KTL A;  2KHP A;  1AUC A;  3GH6 A;  1OC8 A;  3GYK A;  10GS A;  2WDU A;  1X0R A;  3HYP A;  1ZYQ B;  5B8A A;  4TR4 A;  2PWJ A;  1SYX A;  2QC7 A;  3FR3 A;  2R4V A;  1VRS D;  1SJZ A;  4PXO A;  3P7X A;  2DJK A;  3HKR A;  4AF2 A;  2GVP A;  1TRS A;  3RBT A;  4POB A;  2IL3 A;  3TKS A;  3WGX A;  3QPM A;  4L5O A;  5GSS A;  2X64 A;  4KA0 A;  5F06 A;  1XFL A;  3C71 A;  4ILF A;  4XRA A;  4PQH A;  5ECI B;  3GHA A;  2RII A;  3HY2 A;  3PGT A;  2K8V A;  3TJB A;  5FT3 A;  4V1A p;  2YOI A;  5ABR A;  2GSS A;  3P8W A;  1ST9 A;  2ES7 A;  2P5R A;  4OFM A;  3QAG A;  1MEK A;  5LCZ A;  4G19 A;  3FZ5 A;  5GAP D;  2FCH A;  3HJO A;  4ZIL A;  3UVH A; 
#chains in the Genus database with same CATH topology
 1OYJ A;  2C80 A;  3BOA A;  6GSV A;  1S3R A;  3ZTL A;  1F2E A;  1O7U A;  2X4A A;  2DJ0 A;  1F37 A;  2J9H A;  1X5D A;  3TUE A;  3RDW A;  3H93 A;  3HXS A;  3EU4 A;  2AHE A;  5HFG A;  4FYB A;  1ML6 A;  2QGV A;  2PUK C;  1VGL A;  4ZB6 A;  2GSQ A;  1YJ6 A;  3P90 A;  3W8S A;  1THX A;  4MPG A;  2P0G A;  5DCG A;  2L6C A;  2YNX A;  3V1W A;  2LUS A;  3S9F A;  1X5E A;  1GTI A;  1T00 A;  3D4M A;  1TJD A;  5DJM A;  1XPV A;  4ID0 A;  3C73 A;  2V1M A;  5CO3 A;  2O85 A;  2HNL A;  4MJE A;  1O8W A;  3H4K A;  2B1K A;  2X8H A;  2XBQ A;  2XBI A;  3UL3 A;  4MPF A;  1BQ7 A;  1GSF A;  2O7K A;  1A2J A;  3IXR A;  3GL5 A;  1EGR A;  1ERT A;  4F9Z A;  5DAL A;  1OE7 A;  5CRG A;  3AY8 A;  3LOR A;  1G6Y A;  3FRC A;  5DJL A;  3UAR A;  1EOH A;  3APQ A;  4JU5 A;  5GZZ B;  1FVK A;  2JAD A;  3LSZ A;  1Z6N A;  2H71 A;  5F07 A;  3IHQ A;  1EWX A;  4GSS A;  2HZE B;  5DDL A;  1Z7P A;  1HD2 A;  4YKF A;  2OBK A;  3GH9 A;  2B6M A;  3N9J A;  3Q18 A;  2H1A A;  2KOK A;  4LL1 B;  4NHZ A;  4GST A;  4JED A;  5DAK A;  5G1L A;  4K1F A;  4MZW A;  1ZCP A;  3K8N A;  1MD4 A;  1NHY A;  4D73 B;  3LEF A;  1M2D A;  2FA8 A;  2G2Q A;  5IOX A;  4YQV A;  3JCM L;  4MJB A;  2WB9 A;  2WS2 A;  1U3I A;  4TR1 B;  4KB3 A;  3MAK A;  4PUR A;  2VCX A;  3KIJ A;  1G6W A;  4IS0 A;  2VCZ A;  2YWN A;  4LLR A;  2HRN A;  3NOF A;  2GZP A;  1AW9 A;  1K0N A;  2JL4 A;  4WKW A;  4YQM A;  1F6M C;  3D22 A;  4TN8 A;  1EP8 A;  3VLN A;  4PUA A;  2HFD A;  3P2A A;  2I9H A;  4K5R A;  2CT6 A;  4NWY A;  1YKC A;  4KCE A;  5AIS A;  4NXI A;  4EVM A;  4F0B A;  1EOG A;  3CRT A;  1YF0 A;  4MMM A;  2XPE A;  1FVJ A;  4K2D A;  1ERU A;  4NMU A;  3BD2 A;  4RI6 A;  1TU8 A;  3KP9 A;  1ZMA A;  5KN2 A;  4EF0 A;  3TCO A;  4YKG A;  3I43 A;  3VPT A;  1F3A A;  2MMN A;  3UIW A;  3LG6 A;  3RPP A;  2F3M A;  1ZGN A;  1PGT A;  2M46 A;  4OWY A;  4PUF C;  1Y6E A;  1QQ2 A;  1TTZ A;  1V40 A;  5EY6 A;  2A2S A;  5H5S A;  1QK8 A;  2RM5 A;  4P3Y B;  4HDE A;  3GA4 A;  2VM2 A;  3GL3 A;  2E7P A;  2C3Q A;  2HRF A;  1SYR A;  3D21 A;  1T8E B;  2O87 A;  4FYC A;  5LD0 A;  2IMK A;  1TDI A;  4KF9 A;  1K0O A;  3QOU A;  4XHM A;  2HE3 A;  2OE3 A;  5EL8 A;  3KJY A;  5D9W A;  4KUN A;  2B7K A;  4MNN A;  3ZRD A;  2LS5 A;  3U5R E;  2C0F A;  3ZMK A;  2I3Y A;  1SD9 A;  1OVN A;  4EUY A;  3EU3 A;  2R0G A;  3G7Y A;  5FWG A;  4GTU A;  1GSD A;  1PFO A;  3F0I A;  3M3M A;  3ZVJ A;  2GT5 A;  2WZ9 A;  1WE0 A;  3QAV A;  4ECB A;  1GRX A;  2X8G A;  2MMO A;  2OE1 A;  2RLI A;  2CQ9 A;  1XWG A;  1TKD B;  4EO3 A;  5E4W A;  1UN2 A;  3ZFB A;  1SEN A;  4BIK A;  3DXB A;  2FGX A;  1AQV A;  1TRW A;  2XHF A;  2CA8 A;  1MDI A;  3Q19 A;  1LU4 A;  4BWQ A;  4AGS A;  3LW9 A;  3M9K A;  4J56 E;  1XOA A;  1Q98 A;  2IFQ A;  5HR3 A;  4TRX A;  5IOW A;  5D93 A;  3QD9 A;  1BX9 A;  1NM3 A;  4BWS A;  1DE2 A;  2JU5 A;  2FWH A;  4AJ6 A;  4CHS A;  1GTB A;  1TK8 B;  3MWH A;  2VCV A;  1PN0 A;  3IOS A;  2O8V B;  4HSC X;  2K6V A;  1K0B A;  1GLP A;  1Z9H A;  1U88 A;  2GQL A;  12GS A;  2LRN A;  3J7Y b;  3FEU A;  3M9J A;  3D5J A;  4I2U A;  6GSS A;  4BVY B;  3L78 A;  2UZ8 A;  1OC9 B;  2DJ2 A;  4HQZ A;  3FR9 A;  3QCP A;  4EIP A;  5A5K A;  3BCI A;  1GTU A;  4XCS A;  3PPU A;  4CY6 A;  3GTU B;  2B1L A;  3APS A;  4WR5 A;  3DWV A;  1Z3E A;  2NPB A;  1ZYN A;  4MP4 A;  4RUV A;  3IC4 A;  16GS A;  2FWF A;  3EMP A;  1GUK A;  3IBH A;  3Q74 A;  2L5L A;  2WFC A;  5J9B A;  2FLS A;  3GRX A;  3LWA A;  3IA1 A;  4POK A;  1WWJ A;  2BMX A;  2LNS A;  3ZL5 A;  3I6A A;  3BBY A;  3HD5 A;  3HVS A;  5C04 A;  4ZL7 A;  5CYY A;  4GXZ A;  1YKA A;  3I69 A;  4JR4 A;  4L5L A;  3IRA A;  2V2G A;  1GNW A;  1RW1 A;  4IP6 A;  2E2G A;  1T7P B;  1Z7R A;  3E0U A;  4FYU A;  4IQ1 A;  1TXX A;  4NPB A;  3D4T A;  1SK0 A;  2VL2 C;  1K0C A;  2N5A A;  2IWT A;  4PX1 A;  3GKK A;  5INY A;  1A8Y A;  1QXH A;  3EIN A;  5CP1 A;  1ACV A;  5AIV A;  1JZD A;  1SK2 A;  4OFT A;  3CSI A;  4V2L A;  4ZB9 A;  4ZBD A;  1JHB A;  1FHE A;  3L9U A;  1X5C A;  1W89 A;  1A24 A;  4GLT A;  4FQU A;  2LEG A;  2CVK A;  3RPN A;  3SBC A;  3TJK A;  1V2A A;  1V57 A;  1FO5 A;  1X9M B;  2OAD A;  2EIO A;  1GSE A;  1OKT A;  1QFN A;  4ZBB A;  3TKQ A;  1MTC A;  1BYE A;  4X0X A;  3IC8 A;  4FIW A;  1OE8 A;  5D9X A;  1QUW A;  4N0V A;  4F82 A;  4YAP A;  1GTA A;  5DCH A;  2EC4 A;  3A5W A;  1J08 A;  3A2V A;  4KE3 A;  2LQQ A;  1ERW A;  1G7O A;  4LL4 B;  1YQ1 A;  5KOX A;  2CAI A;  2YWI A;  3MNG A;  3M1G A;  2B5Y A;  5IO0 A;  5ECR B;  2VLU A;  1ZL9 A;  5DQS A;  2QA1 A;  1A0R P;  3HVN A;  2YWM A;  5E59 A;  4PNG A;  3IR4 A;  3M8N A;  1LJR A;  4ICY A;  4IKH A;  2IME A;  3D0Z A;  1ZOF A;  4EXJ A;  3UMA A;  5ECO B;  1A2M A;  2PMT A;  4I2T A;  4JBB A;  5AN1 A;  2C0D A;  1T4Z A;  5IMC A;  3L4N A;  2DML A;  2GT6 A;  1ZZY A;  2M72 A;  1A0F A;  1ON4 A;  2JSZ A;  2F8A A;  5G5E A;  4RI7 A;  3KD0 A;  19GS A;  4YAV A;  1NSW A;  2EIR A;  3W6G A;  3IK9 A;  4KH7 A;  3US3 A;  3KH7 A;  1PL1 A;  3CSH A;  3A2W A;  2OJL A;  3VWU A;  2HSM A;  2PGT A;  4ML6 A;  1TI3 A;  4DSS B;  2H8L A;  3HHV A;  1W4V A;  2HZF A;  5JCW A;  5HR0 A;  3TKS E;  3RHC A;  2H1G A;  2GSR A;  3CQF A;  3F3Q A;  2BJX A;  2IPA A;  2H0H A;  3DIE A;  1VF2 A;  2QSI A;  3MSZ A;  3R3E A;  2H30 A;  4L0U A;  4ACS A;  1EZK A;  2DKH A;  2E2M A;  1GSU A;  5JCU A;  2IMD A;  4BVX B;  1OC3 A;  2VL2 A;  3F63 A;  4GSN A;  3GN3 A;  5KOW A;  3FHK A;  4OD7 A;  4Z2U A;  5ENU A;  3DYR A;  2F51 A;  2TRX A;  1JZR A;  5AGY A;  3TJG A;  2YCD A;  1M9A A;  3ERW A;  4GF0 A;  3G9B A;  5AIX A;  1EP7 A;  1XW9 A;  2H76 A;  1F3B A;  4X1U A;  2K9F A;  2VOC A;  5J3R A;  3ISO A;  5B7C A;  6GSY A;  4TXO B;  5KN0 A;  5G30 A;  2GQM A;  2RUF A;  1T3B A;  2KP1 A;  4NHW A;  1E2Y A;  4GQC A;  2FUG 2;  5ECM B;  1GL8 A;  2AYT A;  4K7I A;  3KM6 A;  1CQH A;  5IMA A;  1SJI A;  3C1R A;  4OMV A;  3SWL A;  4EIQ A;  2VD1 A;  1X9S B;  1XOB A;  1QGV A;  3LXZ A;  4ML1 A;  3VI5 A;  4Z7X A;  2PER A;  2H74 A;  1GUH A;  3W8J A;  2DJ3 A;  2A2P A;  3GKM A;  3F6D A;  3TRX A;  1EEM A;  18GS A;  4IW9 A;  4HQS A;  3D6I A;  3F4T A;  3F4R A;  4JZQ A;  5J9C A;  4ZXG A;  3IDV A;  3FK8 A;  4IQA A;  1C72 A;  14GS A;  4EKZ A;  2MMZ A;  2DJ1 A;  2LJR A;  2OAC A;  1AQX A;  4KDY A;  2H66 A;  3LYP A;  2TIR A;  5H5R A;  4WR4 A;  4V2N A;  1K3L A;  1JZW A;  3IAS 2;  4GRF A;  3HZ4 A;  2HZE A;  2LQO A;  1ILO A;  2X8C A;  4KND A;  2KLX A;  5BMU A;  5ID2 B;  1R26 A;  1SU9 A;  4IJ3 A;  2PVO C;  3LGC A;  4JE1 A;  2OBI A;  1RQM A;  2LRC A;  2VLT A;  2C8U A;  5IQY A;  3MYD A;  4BL7 A;  2CV4 A;  2IN3 A;  2EIQ A;  2QA2 A;  3EPT A;  4GCI A;  2B5X A;  4TKY A;  3CSJ A;  4WXT A;  2G0F A;  2GQK A;  1VF1 A;  4F0C A;  2REM A;  2OKA A;  2YP6 A;  4JRR A;  2JSY A;  1TP9 A;  3DVX A;  5G2Z A;  4KW6 A;  5D73 A;  5J4U A;  1AIU A;  4HU7 A;  4K2X A;  4ISD A;  2A2R A;  4Q5F A;  1YF1 A;  3UAP A;  2DSA A;  4YQU A;  4MCU A;  4LMW A;  4MZC A;  3L9S A;  4MAB A;  1JZO A;  1GWC A;  3EC3 A;  2H70 A;  5G31 A;  5ECS A;  2X99 A;  4N0Z A;  3GUR A;  1KNG A;  2ON5 A;  1TI1 A;  2RM6 A;  3BCK A;  3IAM 2;  4K6X A;  4IN0 A;  4K0N A;  3FMW A;  2A4V A;  3EE2 A;  1THO A;  2LRT A;  2CX4 A;  5IMD A;  5IO2 A;  4HOJ A;  2H01 A;  2GST A;  3KTB A;  3R2Q A;  3WD6 A;  3FZ9 A;  3ZFL A;  4KCA A;  5LNK e;  2DIY A;  3PR8 A;  3CXG A;  4G10 A;  1AXD A;  3UOM A;  4XS4 B;  1PRX A;  5B6N A;  3WGD A;  4X43 A;  2GTU A;  1H75 A;  4XS1 A;  1URM A;  3RHB A;  1NHO A;  4EE0 A;  4BPY A;  2YN1 A;  4YH2 A;  3TJJ A;  2I4A A;  1O85 A;  1M0U A;  3H8Q A;  2B3S A;  2H19 A;  2TRC P;  5IPG A;  1HNB A;  4MF7 A;  1Y25 A;  1K0D A;  3ERG A;  1XXU A;  4EL1 A;  4G9H A;  4Q5Q A;  3I9V 2;  2FNO A;  1SJ6 A;  4WF5 A;  3DEX A;  2N5B A;  2GDR A;  4MZB A;  1EEJ A;  1U6T A;  4IEL A;  2H72 A;  1XWA A;  2JAC A;  4PQI A;  1SL0 B;  3U6V A;  1R5P A;  2H73 A;  2VO4 A;  2H75 A;  1GSS A;  2VIM A;  2L59 A;  3L9V A;  3QFB C;  2VCQ A;  3Q6O A;  2KUC A;  4K7N A;  3C1S A;  4OCF A;  2M80 A;  5CRW A;  3E3E A;  1QMV A;  2YWO A;  1FW1 A;  3GUS A;  4N10 A;  3EWL A;  2GGT A;  3GNJ A;  4F03 A;  2VL3 A;  1XG8 A;  4HUA A;  3FR6 A;  1KBN A;  5BRT A;  3CMI A;  4KSM A;  2DLX A;  2LV3 A;  4K0G A;  1NW2 A;  4KSO A;  5DVB A;  5ECK B;  3WYW A;  4MH2 A;  2LST A;  1J0F A;  1XVQ A;  4I5Q A;  1B9Y C;  3WT2 A;  5JWQ B;  3UVT A;  4IBP A;  1MD3 A;  2LTK A;  1O6J A;  3TDG A;  2IMI A;  5CRD A;  1JFU A;  1DBY A;  3UEM A;  5HR1 A;  2CAQ A;  1S3C A;  1BJX A;  1R7H A;  1B4P A;  4MF5 A;  4ULX A;  1M3I A;  3APO A;  1K3O A;  5F0G A;  2H6Z A;  1BED A;  2YJ7 A;  2V6O A;  1UVZ A;  3C7M A;  1XBS A;  4O5R A;  4G0K A;  4ECC A;  1PQN A;  2VAF A;  2VUP A;  3DML A;  3EYT A;  2QKE A;  1WPI A;  3M0F A;  6GSU A;  2L4C A;  4AJ7 A;  3CYN A;  3L0H A;  4BVY A;  4G0I A;  1O8X A;  2HRA A;  2PVQ A;  3VFI A;  1T4Y A;  2R2J A;  5CNW A;  1XWB A;  1WIK A;  3GTU A;  1V58 A;  5IIZ A;  3ZIT A;  2R0C A;  5ECH B;  5B6M A;  3HJP A;  1PKW A;  3QMX A;  2HSY A;  4O5U A;  1YZX A;  4MA9 A;  4CY8 A;  3A2X A;  4PQ1 A;  1WRY A;  3PH9 A;  4K7O A;  3HA9 A;  4PNF A;  2A4H A;  4ZB8 A;  3H79 A;  3UBL A;  1M9B A;  1XVW A;  3CTF A;  1WJK A;  1T1V A;  2DJJ A;  3VWW A;  4RQX A;  5DQY A;  5G5F A;  5ELG A;  1M2B A;  1SKW B;  3KZQ A;  5HFK A;  4GQF A;  1I5G A;  4FH8 A;  1V98 A;  3CBU A;  4WEY A;  4G0L A;  5DBQ A;  1IYI A;  4MDC A;  5HR2 A;  2C1Y A;  1S3A A;  4MJA A;  7GSS A;  1MDK A;  3MIX A;  1HNA A;  1XCC A;  1XZO A;  1M3J A;  1TRU A;  2BTO T;  1VF4 A;  3GX8 A;  5L71 A;  1ZYE A;  1VF3 A;  4EDZ A;  3O6T A;  2FD3 A;  4NAX A;  1FG4 A;  5HFI A;  3GIX A;  2MBT A;  3KMO A;  3H1N A;  4XS6 A;  2D2Z A;  5KN3 A;  1BG5 A;  4I6X A;  3FW2 A;  2JZT A;  5ELA A;  2WCI A;  3G7I A;  4H86 A;  2H1B A;  2R3X A;  4HJ2 A;  4LA1 A;  3DKS A;  1EV4 A;  5IMV A;  3KEB A;  1XWC A;  2VCW A;  1GSY A;  3G7J A;  3MDK A;  3ED3 A;  4XRD A;  3FZ4 A;  5HQP A;  1YEP A;  1J9B A;  4DVC A;  2WRT A;  2ZUP A;  3FZA A;  2DBC A;  2LJA A;  2GLR A;  4ZBA A;  6GST A;  5KEJ A;  1EV9 A;  4XTS A;  3WGE A;  1U87 A;  2V32 A;  3ZZX A;  4IVF A;  2CVB A;  3GST A;  2F9S A;  1FOV A;  1BAY A;  2YPM A;  3F9U A;  2H6X A;  4QL7 A;  2DKI A;  4MLY A;  3QR6 A;  4IP1 A;  2KP2 A;  3LYK A;  4DEJ A;  1PX6 A;  1B4Q A;  6GSX A;  4OFN A;  5ECL B;  2L57 A;  3C8E A;  3KCM A;  4MJC A;  1XIY A;  2VLV A;  4DSS A;  1SL2 B;  3EVI A;  2GS3 A;  4RQR A;  3F6F A;  3N5O A;  3KP8 A;  4OCE A;  5CRH A;  3BJ5 A;  4EDY A;  3IV4 A;  1XW5 A;  3HDC A;  4TR3 A;  3FY7 A;  1N8J A;  1DUG A;  5DAL B;  4V1A g;  2GZY A;  1V9W A;  3CRU A;  2GZZ A;  4L0W A;  5IPH A;  2YV7 A;  4BVX A;  4N11 A;  3J7Y k;  4QQ7 A;  4PTS A;  1B48 A;  2P5Q A;  1E6B A;  2NDO A;  4EC0 A;  2L5O A;  1PSQ A;  2YAN A;  3F3R A;  2CX3 A;  2C4J A;  1O81 A;  5B8B A;  2WUL A;  4IJI A;  4POM A;  5DAK B;  4DSQ A;  3ZLP A;  4WET A;  4LMV A;  1HYU A;  4TXO A;  3IE3 A;  5J41 A;  2AAW A;  2NVL A;  2L6D A;  2CZ3 A;  1XW6 A;  1S3D A;  4Q5N A;  4KAE A;  2L4Q A;  2J23 A;  3DRN A;  1KEB A;  2CZ2 A;  4OO4 A;  1PX7 A;  2ZNM A;  4KDX A;  4JR6 A;  2HXK A;  2MZC A;  5A4W A;  3KMN A;  4BA7 A;  2Z9S A;  3IHG A;  3PIN A;  2VL9 A;  2B5E A;  1USB A;  3RAZ A;  4ZL8 A;  1WOU A;  5GAN D;  1B9X C;  1XWK A;  1UC7 A;  3ME8 A;  3ZML A;  4BL7 B;  4O32 A;  4CDO A;  4DSR A;  2C3T A;  2OA7 A;  3HVV A;  2VD0 A;  1JLW A;  3DVW A;  4PGT A;  3O3T A;  2C3N A;  9GSS A;  2P31 A;  1SKS B;  5D9T A;  4QL9 A;  2AB6 A;  1SL1 B;  3VWV A;  1SKR B;  2LJK A;  4D73 A;  4TVE A;  2O89 A;  5CAX A;  2NBS A;  4IGJ A;  5F8B A;  4TR1 A;  2XC2 A;  11GS A;  1PMT A;  3ZRE A;  1TK0 B;  1YDK A;  4CW9 A;  4N30 A;  1GSQ A;  2YV9 A;  2N5F A;  2ALB A;  4KX4 A;  3ZIV A;  5GST A;  2HI7 A;  2NTO A;  4ZIJ A;  3VUR A;  3IPZ A;  2R6K A;  4NV2 A;  1I9D A;  22GS A;  3A5I A;  5ID2 A;  8GSS A;  4G2E A;  1K0A A;  3CTG A;  4K8M A;  4HU9 A;  1WP0 A;  5H5Q A;  3FKF A;  5D96 A;  4A5P A;  1CQG A;  2VM1 A;  4F2I A;  3TKR A;  2ZCT A;  3TKP A;  2PU9 C;  1LBK A;  2FHE A;  3TRQ A;  3FYG A;  1Q4J A;  3ZVJ D;  2R5G A;  4O7H A;  5KN1 A;  1M99 A;  5C00 A;  2HT9 A;  4K9Z A;  3GFK A;  1GUL A;  1SK1 A;  1OAZ A;  2VCT A;  2DIZ A;  1GUM A;  4Q5R A;  5ECN B;  3EUR A;  2V41 A;  2H6Y A;  1YEX A;  2R0P A;  5IM9 A;  5COH A;  3UJ1 A;  3NZN A;  3QDN A;  1ERV A;  2FWG A;  3EMX A;  3IK7 A;  3ZYW A;  4E8E A;  3QFA C;  4FO5 A;  3GSS A;  4K5S A;  1TU7 A;  3LJR A;  1WMJ A;  5ECQ B;  3TJF A;  4HZ2 A;  2DMM A;  1HQO A;  5EPF A;  4Z2T A;  1UA5 A;  1SD8 A;  5F05 A;  3ME7 A;  2ON7 A;  3WT1 A;  2WGR A;  2YZU A;  2FY6 A;  2IFQ B;  4XS4 A;  1PA3 A;  2PPT A;  1A8L A;  1GP1 A;  2CVD A;  5JCG A;  2MMA A;  4ECI A;  13GS A;  4XIH A;  3QAW A;  5A4V A;  2MYG A;  3NIV A;  2H0I A;  3HJM A;  4O92 A;  2LNT A;  2RUE A;  2E0Q A;  5ECP B;  3VK9 A;  1GH2 A;  1N2A A;  2X49 A;  1MDJ A;  4I97 A;  4AJ8 A;  4ZL9 A;  1M2A A;  1Z6M A;  4I8B A;  5A4U A;  2MBS A;  2XPD A;  3HCZ A;  1A2L A;  2HLS A;  4HEA 2;  2YZH A;  2F8F A;  3TB2 A;  4WBJ A;  3GV1 A;  5JWO B;  2PBJ A;  5EVO A;  4HJM A;  2IIY A;  1F9M A;  3GMF A;  2HRK A;  3LXT A;  1FB6 A;  4KDU A;  2C0G A;  1R5A A;  2H1D A;  2FWE A;  3E9J B;  2FA4 A;  1G7E A;  2I1U A;  5CRE A;  3GKN A;  1ABA A;  4IHU A;  3HZ8 A;  3TGZ A;  3A3T A;  3DGQ A;  4HI7 A;  4V2M A;  5JWR B;  1B8X A;  17GS A;  3KXO A;  5D8I A;  5J5N A;  2PN8 A;  3KGK A;  4TOP A;  3TOT A;  1U3A A;  3TKS C;  1JLV A;  1ZYP A;  2HSH A;  1PD2 1;  1K0M A;  3UBK A;  1OKD A;  4OO5 A;  1TOF A;  1DSB A;  3LQ7 A;  3DD3 A;  1AC1 A;  2AUV A;  2C0E A;  4POL A;  1GNE A;  2K8S A;  1YY7 A;  1K3Y A;  3HVX A;  2LKU A;  3TRP A;  2IJY A;  1FB0 A;  20GS A;  5G1K A;  1KTE A;  1FAA A;  4MF6 A;  4J2F A;  4E8H A;  4GWR A;  4MH3 A;  5IMZ A;  2JZR A;  4USS A;  1TRV A;  3O76 A;  1RK4 A;  3F8U A;  1OC9 A;  1TW9 A;  4ECJ A;  4J57 E;  3ZIJ A;  2IMF A;  4Z2R A;  1H4O A;  4WF4 A;  2V6K A;  2AJQ B;  2YJH A;  4KGI A;  5IMF A;  1IYH A;  2B7J A;  1G0T A;  3VWX A;  1AQW A;  2R37 A;  3LFL A;  5FHI A;  1M7T A;  2WJU A;  3VPQ A;  2HYX A;  3OR5 A;  3ERF A;  1AAZ A;  4WBR D;  4HS1 A;  3TOU A;  4TW5 A;  6GSW A;  3GKX A;  1PL2 A;  1FOH A;  3GX0 A;  3VI7 A;  2H0G A;  2K18 A;  2DC5 A;  4TXV A;  4HZ4 A;  4NV5 A;  2OE0 A;  1EGO A;  3KH9 A;  1O73 A;  4X4J A;  1A23 A;  4MK3 A;  1GLQ A;  3F4S A;  1DE1 A;  1PN9 A;  1PKZ A;  1HNC A;  1X9W B;  1TK5 B;  2I81 A;  2JZS A;  5D9V A;  1Z5Y E;  2AV4 A;  1R4W A;  4TR0 A;  4L8E A;  3KTL A;  2KHP A;  1AUC A;  3GH6 A;  1OC8 A;  3GYK A;  4O5Q A;  10GS A;  2WDU A;  1X0R A;  3HYP A;  1ZYQ B;  5B8A A;  4TR4 A;  2PWJ A;  1SYX A;  2QC7 A;  3FR3 A;  2R4V A;  1VRS D;  1SJZ A;  4PXO A;  3P7X A;  2DJK A;  3HKR A;  4AF2 A;  2GVP A;  1TRS A;  3RBT A;  4POB A;  2IL3 A;  3TKS A;  3WGX A;  3QPM A;  4L5O A;  5GSS A;  2X64 A;  4KA0 A;  5F06 A;  1XFL A;  3C71 A;  4ILF A;  4XRA A;  4PQH A;  5ECI B;  3GHA A;  2RII A;  3HY2 A;  3PGT A;  2K8V A;  3TJB A;  5FT3 A;  4V1A p;  2YOI A;  5ABR A;  2GSS A;  3P8W A;  1ST9 A;  2ES7 A;  2P5R A;  4OFM A;  3QAG A;  1MEK A;  5LCZ A;  4G19 A;  3FZ5 A;  5GAP D;  2FCH A;  3HJO A;  4ZIL A;  3UVH A; 
#chains in the Genus database with same CATH homology
 1OYJ A;  2C80 A;  3BOA A;  6GSV A;  3ZTL A;  1F2E A;  1O7U A;  2X4A A;  2DJ0 A;  1F37 A;  2J9H A;  1X5D A;  3TUE A;  3RDW A;  3H93 A;  3HXS A;  3EU4 A;  2AHE A;  5HFG A;  4FYB A;  1ML6 A;  2QGV A;  2PUK C;  1VGL A;  4ZB6 A;  2GSQ A;  1YJ6 A;  3P90 A;  3W8S A;  1THX A;  4MPG A;  2P0G A;  5DCG A;  2L6C A;  2YNX A;  3V1W A;  2LUS A;  3S9F A;  1X5E A;  1GTI A;  1T00 A;  3D4M A;  1TJD A;  5DJM A;  1XPV A;  4ID0 A;  3C73 A;  2V1M A;  5CO3 A;  2O85 A;  2HNL A;  4MJE A;  1O8W A;  3H4K A;  2B1K A;  2X8H A;  2XBQ A;  2XBI A;  3UL3 A;  4MPF A;  1BQ7 A;  1GSF A;  2O7K A;  1A2J A;  3IXR A;  3GL5 A;  1EGR A;  1ERT A;  4F9Z A;  5DAL A;  1OE7 A;  5CRG A;  3AY8 A;  3LOR A;  1G6Y A;  3FRC A;  5DJL A;  3UAR A;  1EOH A;  3APQ A;  4JU5 A;  5GZZ B;  1FVK A;  2JAD A;  3LSZ A;  1Z6N A;  2H71 A;  5F07 A;  3IHQ A;  1EWX A;  4GSS A;  2HZE B;  5DDL A;  1Z7P A;  1HD2 A;  4YKF A;  2OBK A;  3GH9 A;  2B6M A;  3N9J A;  3Q18 A;  2H1A A;  2KOK A;  4LL1 B;  4NHZ A;  4GST A;  4JED A;  5DAK A;  5G1L A;  4K1F A;  4MZW A;  1ZCP A;  3K8N A;  1MD4 A;  1NHY A;  4D73 B;  3LEF A;  1M2D A;  2FA8 A;  2G2Q A;  5IOX A;  4YQV A;  3JCM L;  4MJB A;  2WB9 A;  2WS2 A;  1U3I A;  4TR1 B;  4KB3 A;  3MAK A;  4PUR A;  2VCX A;  3KIJ A;  1G6W A;  4IS0 A;  2VCZ A;  2YWN A;  4LLR A;  2HRN A;  3NOF A;  2GZP A;  1AW9 A;  1K0N A;  2JL4 A;  4WKW A;  4YQM A;  1F6M C;  3D22 A;  4TN8 A;  1EP8 A;  3VLN A;  4PUA A;  2HFD A;  3P2A A;  2I9H A;  4K5R A;  2CT6 A;  4NWY A;  1YKC A;  4KCE A;  5AIS A;  4NXI A;  4EVM A;  4F0B A;  1EOG A;  3CRT A;  1YF0 A;  4MMM A;  2XPE A;  1FVJ A;  4K2D A;  1ERU A;  4NMU A;  3BD2 A;  4RI6 A;  1TU8 A;  3KP9 A;  1ZMA A;  5KN2 A;  4EF0 A;  3TCO A;  4YKG A;  3I43 A;  3VPT A;  1F3A A;  2MMN A;  3UIW A;  3LG6 A;  3RPP A;  2F3M A;  1ZGN A;  1PGT A;  2M46 A;  4OWY A;  4PUF C;  1Y6E A;  1QQ2 A;  1TTZ A;  1V40 A;  5EY6 A;  2A2S A;  5H5S A;  1QK8 A;  2RM5 A;  4P3Y B;  4HDE A;  3GA4 A;  2VM2 A;  3GL3 A;  2E7P A;  2C3Q A;  2HRF A;  1SYR A;  3D21 A;  1T8E B;  2O87 A;  4FYC A;  5LD0 A;  2IMK A;  1TDI A;  4KF9 A;  1K0O A;  3QOU A;  4XHM A;  2HE3 A;  2OE3 A;  5EL8 A;  3KJY A;  5D9W A;  4KUN A;  2B7K A;  4MNN A;  3ZRD A;  2LS5 A;  3U5R E;  2C0F A;  3ZMK A;  2I3Y A;  1SD9 A;  1OVN A;  4EUY A;  3EU3 A;  2R0G A;  3G7Y A;  5FWG A;  4GTU A;  1GSD A;  3F0I A;  3M3M A;  3ZVJ A;  2GT5 A;  2WZ9 A;  1WE0 A;  3QAV A;  4ECB A;  1GRX A;  2X8G A;  2MMO A;  2OE1 A;  2RLI A;  2CQ9 A;  1XWG A;  1TKD B;  4EO3 A;  5E4W A;  1UN2 A;  3ZFB A;  1SEN A;  3DXB A;  2FGX A;  1AQV A;  1TRW A;  2XHF A;  2CA8 A;  1MDI A;  3Q19 A;  1LU4 A;  4BWQ A;  4AGS A;  3LW9 A;  3M9K A;  4J56 E;  1XOA A;  1Q98 A;  2IFQ A;  5HR3 A;  4TRX A;  5IOW A;  5D93 A;  3QD9 A;  1BX9 A;  1NM3 A;  4BWS A;  1DE2 A;  2JU5 A;  2FWH A;  4AJ6 A;  4CHS A;  1GTB A;  1TK8 B;  3MWH A;  2VCV A;  1PN0 A;  3IOS A;  2O8V B;  2K6V A;  1K0B A;  1GLP A;  1Z9H A;  1U88 A;  2GQL A;  12GS A;  2LRN A;  3J7Y b;  3FEU A;  3M9J A;  3D5J A;  4I2U A;  6GSS A;  4BVY B;  3L78 A;  2UZ8 A;  1OC9 B;  2DJ2 A;  4HQZ A;  3FR9 A;  3QCP A;  4EIP A;  5A5K A;  3BCI A;  1GTU A;  4XCS A;  3PPU A;  4CY6 A;  3GTU B;  2B1L A;  3APS A;  4WR5 A;  3DWV A;  1Z3E A;  2NPB A;  1ZYN A;  4MP4 A;  4RUV A;  3IC4 A;  16GS A;  2FWF A;  3EMP A;  1GUK A;  3IBH A;  3Q74 A;  2L5L A;  2WFC A;  5J9B A;  2FLS A;  3GRX A;  3LWA A;  3IA1 A;  4POK A;  1WWJ A;  2BMX A;  2LNS A;  3ZL5 A;  3I6A A;  3BBY A;  3HD5 A;  3HVS A;  5C04 A;  4ZL7 A;  5CYY A;  4GXZ A;  1YKA A;  3I69 A;  4JR4 A;  4L5L A;  3IRA A;  2V2G A;  1GNW A;  1RW1 A;  4IP6 A;  2E2G A;  1T7P B;  1Z7R A;  3E0U A;  4FYU A;  4IQ1 A;  1TXX A;  4NPB A;  3D4T A;  1SK0 A;  2VL2 C;  1K0C A;  2N5A A;  2IWT A;  4PX1 A;  3GKK A;  5INY A;  1A8Y A;  1QXH A;  3EIN A;  5CP1 A;  1ACV A;  5AIV A;  1JZD A;  1SK2 A;  4OFT A;  3CSI A;  4V2L A;  4ZB9 A;  4ZBD A;  1JHB A;  1FHE A;  3L9U A;  1X5C A;  1W89 A;  1A24 A;  4GLT A;  4FQU A;  2LEG A;  2CVK A;  3RPN A;  3SBC A;  3TJK A;  1V2A A;  1V57 A;  1FO5 A;  1X9M B;  2OAD A;  2EIO A;  1GSE A;  1OKT A;  1QFN A;  4ZBB A;  3TKQ A;  1MTC A;  1BYE A;  4X0X A;  3IC8 A;  4FIW A;  1OE8 A;  5D9X A;  1QUW A;  4N0V A;  4F82 A;  4YAP A;  1GTA A;  5DCH A;  2EC4 A;  3A5W A;  1J08 A;  3A2V A;  4KE3 A;  2LQQ A;  1ERW A;  1G7O A;  4LL4 B;  1YQ1 A;  5KOX A;  2CAI A;  2YWI A;  3MNG A;  3M1G A;  2B5Y A;  5IO0 A;  5ECR B;  2VLU A;  1ZL9 A;  5DQS A;  2QA1 A;  1A0R P;  4PNG A;  2YWM A;  5E59 A;  3IR4 A;  3M8N A;  1LJR A;  4ICY A;  4IKH A;  2IME A;  3D0Z A;  1ZOF A;  4EXJ A;  3UMA A;  5ECO B;  1A2M A;  2PMT A;  4I2T A;  4JBB A;  5AN1 A;  2C0D A;  1T4Z A;  5IMC A;  3L4N A;  2DML A;  2GT6 A;  1ZZY A;  2M72 A;  1A0F A;  1ON4 A;  2JSZ A;  2F8A A;  5G5E A;  4RI7 A;  3KD0 A;  19GS A;  4YAV A;  1NSW A;  2EIR A;  3W6G A;  3IK9 A;  4KH7 A;  3US3 A;  3KH7 A;  1PL1 A;  3CSH A;  3A2W A;  2OJL A;  3VWU A;  2HSM A;  2PGT A;  4ML6 A;  1TI3 A;  4DSS B;  2H8L A;  3HHV A;  1W4V A;  2HZF A;  5JCW A;  5HR0 A;  3TKS E;  3RHC A;  2H1G A;  2GSR A;  3F3Q A;  2BJX A;  2IPA A;  2H0H A;  3DIE A;  1VF2 A;  2QSI A;  3MSZ A;  3R3E A;  2H30 A;  4L0U A;  4ACS A;  1EZK A;  2DKH A;  2E2M A;  1GSU A;  5JCU A;  2IMD A;  4BVX B;  1OC3 A;  2VL2 A;  3F63 A;  4GSN A;  3GN3 A;  5KOW A;  3FHK A;  4OD7 A;  4Z2U A;  5ENU A;  3DYR A;  2F51 A;  2TRX A;  1JZR A;  5AGY A;  3TJG A;  2YCD A;  1M9A A;  3ERW A;  4GF0 A;  3G9B A;  5AIX A;  1EP7 A;  1XW9 A;  2H76 A;  1F3B A;  4X1U A;  2K9F A;  2VOC A;  5J3R A;  3ISO A;  5B7C A;  6GSY A;  4TXO B;  5KN0 A;  5G30 A;  2GQM A;  2RUF A;  1T3B A;  2KP1 A;  4NHW A;  1E2Y A;  4GQC A;  2FUG 2;  5ECM B;  1GL8 A;  2AYT A;  4K7I A;  3KM6 A;  1CQH A;  5IMA A;  1SJI A;  3C1R A;  4OMV A;  3SWL A;  4EIQ A;  2VD1 A;  1X9S B;  1XOB A;  1QGV A;  3LXZ A;  4ML1 A;  3VI5 A;  4Z7X A;  2PER A;  2H74 A;  1GUH A;  3W8J A;  2DJ3 A;  2A2P A;  3GKM A;  3F6D A;  3TRX A;  1EEM A;  18GS A;  4IW9 A;  4HQS A;  3D6I A;  3F4T A;  3F4R A;  4JZQ A;  5J9C A;  4ZXG A;  3IDV A;  3FK8 A;  4IQA A;  1C72 A;  14GS A;  4EKZ A;  2MMZ A;  2DJ1 A;  2LJR A;  2OAC A;  1AQX A;  4KDY A;  2H66 A;  3LYP A;  2TIR A;  5H5R A;  4WR4 A;  4V2N A;  1K3L A;  1JZW A;  3IAS 2;  4GRF A;  3HZ4 A;  2HZE A;  2LQO A;  1ILO A;  2X8C A;  4KND A;  2KLX A;  5BMU A;  5ID2 B;  1R26 A;  1SU9 A;  4IJ3 A;  2PVO C;  3LGC A;  4JE1 A;  2OBI A;  1RQM A;  2LRC A;  2VLT A;  2C8U A;  5IQY A;  3MYD A;  4BL7 A;  2CV4 A;  2IN3 A;  2EIQ A;  2QA2 A;  3EPT A;  4GCI A;  2B5X A;  4TKY A;  3CSJ A;  4WXT A;  2G0F A;  2GQK A;  1VF1 A;  4F0C A;  2REM A;  2OKA A;  2YP6 A;  4JRR A;  2JSY A;  1TP9 A;  3DVX A;  5G2Z A;  4KW6 A;  5D73 A;  5J4U A;  1AIU A;  4HU7 A;  4K2X A;  4ISD A;  2A2R A;  4Q5F A;  1YF1 A;  3UAP A;  2DSA A;  4YQU A;  4MCU A;  4LMW A;  4MZC A;  3L9S A;  4MAB A;  1JZO A;  1GWC A;  3EC3 A;  2H70 A;  5G31 A;  5ECS A;  2X99 A;  4N0Z A;  3GUR A;  1KNG A;  2ON5 A;  1TI1 A;  2RM6 A;  3BCK A;  3IAM 2;  4K6X A;  4IN0 A;  4K0N A;  3FMW A;  2A4V A;  3EE2 A;  1THO A;  2LRT A;  2CX4 A;  5IMD A;  5IO2 A;  4HOJ A;  2H01 A;  2GST A;  3KTB A;  3R2Q A;  3WD6 A;  3FZ9 A;  3ZFL A;  4KCA A;  5LNK e;  2DIY A;  3PR8 A;  3CXG A;  4G10 A;  1AXD A;  3UOM A;  4XS4 B;  1PRX A;  5B6N A;  3WGD A;  4X43 A;  2GTU A;  1H75 A;  4XS1 A;  1URM A;  3RHB A;  1NHO A;  4EE0 A;  4BPY A;  2YN1 A;  4YH2 A;  3TJJ A;  2I4A A;  1O85 A;  1M0U A;  3H8Q A;  2B3S A;  2H19 A;  2TRC P;  5IPG A;  1HNB A;  4MF7 A;  1Y25 A;  1K0D A;  3ERG A;  1XXU A;  4EL1 A;  4G9H A;  4Q5Q A;  3I9V 2;  2FNO A;  1SJ6 A;  4WF5 A;  3DEX A;  2N5B A;  2GDR A;  4MZB A;  1EEJ A;  1U6T A;  4IEL A;  2H72 A;  1XWA A;  2JAC A;  4PQI A;  1SL0 B;  3U6V A;  1R5P A;  2H73 A;  2VO4 A;  2H75 A;  1GSS A;  2VIM A;  2L59 A;  3L9V A;  3QFB C;  2VCQ A;  3Q6O A;  2KUC A;  4K7N A;  3C1S A;  4OCF A;  2M80 A;  5CRW A;  3E3E A;  1QMV A;  2YWO A;  1FW1 A;  3GUS A;  4N10 A;  3EWL A;  2GGT A;  3GNJ A;  4F03 A;  2VL3 A;  4HUA A;  3FR6 A;  1KBN A;  5BRT A;  3CMI A;  4KSM A;  2DLX A;  2LV3 A;  4K0G A;  1NW2 A;  4KSO A;  5DVB A;  5ECK B;  3WYW A;  4MH2 A;  2LST A;  1J0F A;  1XVQ A;  4I5Q A;  1B9Y C;  3WT2 A;  5JWQ B;  3UVT A;  4IBP A;  1MD3 A;  2LTK A;  1O6J A;  3TDG A;  2IMI A;  5CRD A;  1JFU A;  1DBY A;  3UEM A;  5HR1 A;  2CAQ A;  1S3C A;  1BJX A;  1R7H A;  1B4P A;  4MF5 A;  4ULX A;  3APO A;  1K3O A;  5F0G A;  2H6Z A;  1BED A;  2YJ7 A;  2V6O A;  1UVZ A;  3C7M A;  1XBS A;  4O5R A;  4G0K A;  4ECC A;  1PQN A;  2VAF A;  2VUP A;  3DML A;  3EYT A;  2QKE A;  1WPI A;  3M0F A;  6GSU A;  2L4C A;  4AJ7 A;  3CYN A;  3L0H A;  4BVY A;  4G0I A;  1O8X A;  2HRA A;  2PVQ A;  3VFI A;  1T4Y A;  2R2J A;  5CNW A;  1XWB A;  1WIK A;  3GTU A;  1V58 A;  5IIZ A;  3ZIT A;  2R0C A;  5ECH B;  5B6M A;  3HJP A;  1PKW A;  3QMX A;  2HSY A;  4O5U A;  1YZX A;  4MA9 A;  4CY8 A;  3A2X A;  4PQ1 A;  1WRY A;  3PH9 A;  4K7O A;  3HA9 A;  4PNF A;  2A4H A;  4ZB8 A;  3H79 A;  3UBL A;  1M9B A;  1XVW A;  3CTF A;  1WJK A;  1T1V A;  2DJJ A;  3VWW A;  4RQX A;  5DQY A;  5G5F A;  5ELG A;  1M2B A;  1SKW B;  3KZQ A;  5HFK A;  4GQF A;  1I5G A;  4FH8 A;  1V98 A;  3CBU A;  4WEY A;  4G0L A;  5DBQ A;  1IYI A;  4MDC A;  5HR2 A;  2C1Y A;  1S3A A;  4MJA A;  7GSS A;  1MDK A;  3MIX A;  1HNA A;  1XCC A;  1XZO A;  1TRU A;  2BTO T;  1VF4 A;  3GX8 A;  5L71 A;  1ZYE A;  1VF3 A;  4EDZ A;  3O6T A;  2FD3 A;  4NAX A;  1FG4 A;  5HFI A;  3GIX A;  2MBT A;  3KMO A;  3H1N A;  4XS6 A;  2D2Z A;  5KN3 A;  1BG5 A;  4I6X A;  3FW2 A;  2JZT A;  5ELA A;  2WCI A;  3G7I A;  4H86 A;  2H1B A;  2R3X A;  4HJ2 A;  4LA1 A;  3DKS A;  1EV4 A;  5IMV A;  3KEB A;  1XWC A;  2VCW A;  1GSY A;  3G7J A;  3MDK A;  3ED3 A;  4XRD A;  3FZ4 A;  5HQP A;  1YEP A;  1J9B A;  4DVC A;  2WRT A;  2ZUP A;  3FZA A;  2DBC A;  2LJA A;  2GLR A;  4ZBA A;  6GST A;  5KEJ A;  1EV9 A;  4XTS A;  3WGE A;  1U87 A;  2V32 A;  3ZZX A;  4IVF A;  2CVB A;  3GST A;  2F9S A;  1FOV A;  1BAY A;  2YPM A;  3F9U A;  2H6X A;  4QL7 A;  2DKI A;  4MLY A;  3QR6 A;  4IP1 A;  2KP2 A;  3LYK A;  4DEJ A;  1PX6 A;  1B4Q A;  6GSX A;  4OFN A;  5ECL B;  2L57 A;  3C8E A;  3KCM A;  4MJC A;  1XIY A;  2VLV A;  4DSS A;  1SL2 B;  3EVI A;  2GS3 A;  4RQR A;  3F6F A;  3N5O A;  3KP8 A;  4OCE A;  5CRH A;  3BJ5 A;  4EDY A;  3IV4 A;  1XW5 A;  3HDC A;  4TR3 A;  3FY7 A;  1N8J A;  1DUG A;  5DAL B;  4V1A g;  2GZY A;  1V9W A;  3CRU A;  2GZZ A;  4L0W A;  5IPH A;  2YV7 A;  4BVX A;  4N11 A;  3J7Y k;  4QQ7 A;  4PTS A;  1B48 A;  2P5Q A;  1E6B A;  2NDO A;  4EC0 A;  2L5O A;  1PSQ A;  2YAN A;  3F3R A;  2CX3 A;  2C4J A;  1O81 A;  5B8B A;  2WUL A;  4IJI A;  4POM A;  5DAK B;  4DSQ A;  3ZLP A;  4WET A;  4LMV A;  1HYU A;  4TXO A;  3IE3 A;  5J41 A;  2AAW A;  2NVL A;  2L6D A;  2CZ3 A;  1XW6 A;  1S3D A;  4Q5N A;  4KAE A;  2L4Q A;  2J23 A;  3DRN A;  1KEB A;  2CZ2 A;  4OO4 A;  1PX7 A;  2ZNM A;  4KDX A;  4JR6 A;  2HXK A;  2MZC A;  5A4W A;  3KMN A;  4BA7 A;  2Z9S A;  3IHG A;  3PIN A;  2VL9 A;  2B5E A;  1USB A;  3RAZ A;  4ZL8 A;  1WOU A;  5GAN D;  1B9X C;  1XWK A;  1UC7 A;  3ME8 A;  3ZML A;  4BL7 B;  4O32 A;  4CDO A;  4DSR A;  2C3T A;  2OA7 A;  3HVV A;  2VD0 A;  1JLW A;  3DVW A;  4PGT A;  3O3T A;  2C3N A;  9GSS A;  2P31 A;  1SKS B;  5D9T A;  4QL9 A;  2AB6 A;  1SL1 B;  3VWV A;  1SKR B;  2LJK A;  4D73 A;  4TVE A;  2O89 A;  5CAX A;  2NBS A;  4IGJ A;  5F8B A;  4TR1 A;  2XC2 A;  11GS A;  1PMT A;  3ZRE A;  1TK0 B;  1YDK A;  4CW9 A;  4N30 A;  1GSQ A;  2YV9 A;  2N5F A;  2ALB A;  4KX4 A;  3ZIV A;  5GST A;  2HI7 A;  2NTO A;  4ZIJ A;  3VUR A;  3IPZ A;  2R6K A;  4NV2 A;  1I9D A;  22GS A;  3A5I A;  5ID2 A;  8GSS A;  4G2E A;  1K0A A;  3CTG A;  4K8M A;  4HU9 A;  1WP0 A;  5H5Q A;  3FKF A;  5D96 A;  4A5P A;  1CQG A;  2VM1 A;  4F2I A;  3TKR A;  2ZCT A;  3TKP A;  2PU9 C;  1LBK A;  2FHE A;  3TRQ A;  3FYG A;  1Q4J A;  3ZVJ D;  2R5G A;  4O7H A;  5KN1 A;  1M99 A;  5C00 A;  2HT9 A;  4K9Z A;  3GFK A;  1GUL A;  1SK1 A;  1OAZ A;  2VCT A;  2DIZ A;  1GUM A;  4Q5R A;  5ECN B;  3EUR A;  2V41 A;  2H6Y A;  1YEX A;  2R0P A;  5IM9 A;  5COH A;  3UJ1 A;  3NZN A;  3QDN A;  1ERV A;  2FWG A;  3EMX A;  3IK7 A;  3ZYW A;  4E8E A;  3QFA C;  4FO5 A;  3GSS A;  4K5S A;  1TU7 A;  3LJR A;  1WMJ A;  5ECQ B;  3TJF A;  4HZ2 A;  2DMM A;  1HQO A;  5EPF A;  4Z2T A;  1UA5 A;  1SD8 A;  5F05 A;  3ME7 A;  2ON7 A;  3WT1 A;  2WGR A;  2YZU A;  2FY6 A;  2IFQ B;  4XS4 A;  1PA3 A;  2PPT A;  1A8L A;  1GP1 A;  2CVD A;  5JCG A;  2MMA A;  4ECI A;  13GS A;  4XIH A;  3QAW A;  5A4V A;  2MYG A;  3NIV A;  2H0I A;  3HJM A;  4O92 A;  2LNT A;  2RUE A;  2E0Q A;  5ECP B;  3VK9 A;  1GH2 A;  1N2A A;  2X49 A;  1MDJ A;  4I97 A;  4AJ8 A;  4ZL9 A;  1M2A A;  1Z6M A;  4I8B A;  5A4U A;  2MBS A;  2XPD A;  3HCZ A;  1A2L A;  2HLS A;  4HEA 2;  2YZH A;  2F8F A;  3TB2 A;  4WBJ A;  3GV1 A;  5JWO B;  2PBJ A;  5EVO A;  4HJM A;  2IIY A;  1F9M A;  3GMF A;  2HRK A;  3LXT A;  1FB6 A;  4KDU A;  2C0G A;  1R5A A;  2H1D A;  2FWE A;  3E9J B;  2FA4 A;  1G7E A;  2I1U A;  5CRE A;  3GKN A;  1ABA A;  4IHU A;  3HZ8 A;  3TGZ A;  3A3T A;  3DGQ A;  4HI7 A;  4V2M A;  5JWR B;  1B8X A;  17GS A;  3KXO A;  5D8I A;  5J5N A;  2PN8 A;  3KGK A;  4TOP A;  3TOT A;  1U3A A;  3TKS C;  1JLV A;  1ZYP A;  2HSH A;  1PD2 1;  1K0M A;  3UBK A;  1OKD A;  4OO5 A;  1TOF A;  1DSB A;  3LQ7 A;  3DD3 A;  1AC1 A;  2AUV A;  2C0E A;  4POL A;  1GNE A;  2K8S A;  1YY7 A;  1K3Y A;  3HVX A;  2LKU A;  3TRP A;  2IJY A;  1FB0 A;  20GS A;  5G1K A;  1KTE A;  1FAA A;  4MF6 A;  4J2F A;  4E8H A;  4GWR A;  4MH3 A;  5IMZ A;  2JZR A;  4USS A;  1TRV A;  3O76 A;  1RK4 A;  3F8U A;  1OC9 A;  1TW9 A;  4ECJ A;  4J57 E;  3ZIJ A;  2IMF A;  4Z2R A;  1H4O A;  4WF4 A;  2V6K A;  2AJQ B;  2YJH A;  4KGI A;  5IMF A;  1IYH A;  2B7J A;  1G0T A;  3VWX A;  1AQW A;  2R37 A;  3LFL A;  5FHI A;  1M7T A;  2WJU A;  3VPQ A;  2HYX A;  3OR5 A;  3ERF A;  1AAZ A;  4WBR D;  4HS1 A;  3TOU A;  4TW5 A;  6GSW A;  3GKX A;  1PL2 A;  1FOH A;  3GX0 A;  3VI7 A;  2H0G A;  2K18 A;  2DC5 A;  4TXV A;  4HZ4 A;  4NV5 A;  2OE0 A;  1EGO A;  3KH9 A;  1O73 A;  4X4J A;  1A23 A;  4MK3 A;  1GLQ A;  3F4S A;  1DE1 A;  1PN9 A;  1PKZ A;  1HNC A;  1X9W B;  1TK5 B;  2I81 A;  2JZS A;  5D9V A;  1Z5Y E;  2AV4 A;  1R4W A;  4TR0 A;  4L8E A;  3KTL A;  2KHP A;  1AUC A;  3GH6 A;  1OC8 A;  3GYK A;  4O5Q A;  10GS A;  2WDU A;  1X0R A;  3HYP A;  1ZYQ B;  5B8A A;  4TR4 A;  2PWJ A;  1SYX A;  2QC7 A;  3FR3 A;  2R4V A;  1VRS D;  1SJZ A;  4PXO A;  3P7X A;  2DJK A;  3HKR A;  4AF2 A;  2GVP A;  1TRS A;  3RBT A;  4POB A;  2IL3 A;  3TKS A;  3WGX A;  3QPM A;  4L5O A;  5GSS A;  2X64 A;  4KA0 A;  5F06 A;  1XFL A;  3C71 A;  4ILF A;  4XRA A;  4PQH A;  5ECI B;  3GHA A;  2RII A;  3HY2 A;  3PGT A;  2K8V A;  3TJB A;  5FT3 A;  4V1A p;  2YOI A;  5ABR A;  2GSS A;  3P8W A;  1ST9 A;  2ES7 A;  2P5R A;  4OFM A;  3QAG A;  1MEK A;  5LCZ A;  4G19 A;  3FZ5 A;  5GAP D;  2FCH A;  3HJO A;  4ZIL A;  3UVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...