5EPQA

Structure at 1.75 a resolution of a glycosylated, lipid-binding, lipocalin-like protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
b'KEPCPPENLQLPPRALVGKWYLRTTSPDIFKQVSNITEFYSAHGNDYYGTVTDYSPEYGLEAHRVNLTVSGSTLKFYMNDTHDYDSEYQILAVDKDYFIFYGHPPAAPSGLALIHYRQSCPKEDVIKRVKKNLKNVCLDYKYFGNDTSVPCHY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Milk protein
publication title Structure of a heterogeneous, glycosylated, lipid-bound, in vivo-grown protein crystal at atomic resolution from the viviparous cockroach Diploptera punctata
doi rcsb
molecule tags Lipid binding protein
total genus 37
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5epqA00
4ZGUA 2Q39A 1YP6A 3OJYC 4TQ2A 5DPQA 3KFHA 1IFCA 3DSZA 1MUPA 1S2PA 2HNXA 1Z24A 2L5PA 4IAXA 1P6PA 4GETA 4YCEA 1YIVA 1U17A 4A8ZA 1VYGA 5FFHA 2RQ0A 4IB7A 3EM0A 1BRQA 5LJGA 3HK1A 3GAQA 5HCDC 1EQDA 5KHPA 3VG4A 2QM9A 2KT4B 4QGVA 2AT5X 2FT9A 1X8QA 2P8GA 1LFOA 1OBQA 4I9RA 2W2AA 3NX1A 1QY0A 3BX7A 1GT5A 5LJBA 1HQPA 5H8TA 4AZRA 2WQ9A 1SY3A 4WFVA 1EUOA 4RUNA 3ZUOA 3TGAA 1A57A 5LKEA 3WVMA 5HZ8A 4ZCBA 3P6FA 3HWGA 5EEEA 4YBUA 2AKQA 4AZQA 4YH0A 5D4AA 2RCTA 1BJ7A 1HN2A 4ZHDA 1KT3A 2G78A 1LKEA 3FLLA 2LBAA 3EYCA 1QG5A 3CR6A 1ZNLA 1LPJA 1E06A 1PM1X 1S7DA 2HMBA 5HZ6A 1YP7A 3ZQ3A 4M6SA 5F6ZA 4HPAA 4LKPA 3WJFA 5L8NA 2WWPA 2LB6A 4NYQA 5HCCC 4QGXA 4WFUA 3D95A 4AZMA 4AZNA 3ELZA 2F73A 1CRBA 4WBKA 3BU1A 4IMOA 1DZPA 3KQ0A 3KFFA 5LJCA 1DZMA 1FE3A 1KQWA 2OFMX 2A0AA 1GXAA 1HMTA 4XMHA 3UEWA 3BRNA 1GKAB 5EEDA 2R74A 2GJ5A 4AZPA 1AB0A 1KT6A 3EBWA 1X89A 2AT3X 2ACPX 1ADLA 2NNEA 4OMXA 3KZAA 3AKNA 3FW5A 2OZQA 2GTFX 4TKHA 5IO6A 1UREA 3AKMA 1HMSA 3KFGA 4GKCA 2LKKA 4QZUA 4ZHCA 3FELA 1D3SA 5H9NA 2AH7X 2FTBA 1GKAA 1ERBA 2NNDA 1D2UA 2CZUA 1YWCA 4IB6A 2WUTA 3JS1A 1IFBA 1PMPA 5C0NA 1YWBA 2RD7C 3QKGA 4XMCA 2L9CA 5EPQA 3FEKA 3TZSA 5H9LA 1VPRA 1SXXA 3F8AA 3Q6LA 2E4JA 2X45A 1EALA 1SY0A 1OBPA 3WJGA 4M7MA 1E00A 5LJKA 2ASNX 2EU7X 3IFBA 3PPTA 4ZJ0A 1QFVA 4I3CA 1B56A 3P6DA 5IO5A 2MM3A 4TLJA 1RLBE 4QAEA 4IAWA 1T68X 2OFRX 3HWDA 3ELXA 1OEEA 1IIUA 5HZ9A 2LFOA 3FR4A 5F1EA 1TOUA 5D45A 2OVAA 3BSZE 5BVTA 1KZWA 3WXQA 2MO5A 4TJZA 2HYSA 1AQBA 4I9SA 4EDEA 4TKBA 5HZQA 2MJIA 3K3LA 1SXUA 1X71A 1QABE 3P6HA 4UU3A 3APUA 4N7DA 4Y0QA 3FMZA 3TGCA 1IKJA 4GNWA 1DV9A 2L67A 5LJHA 4Y0PA 1B8EA 1JYDA 4MVKA 3STMX 1GX9A 2K62A 3D97A 1A18A 4TNNA 1IKEA 2RA6A 1GM6A 4OS3A 4YBPA 5B27A 2GC9A 3STKA 4ES7A 3PP6A 4ORUA 1JBHA 2AT8X 1OPAA 4QGWA 3BU9A 3FA8A 2FR3A 1L6MA 2WEXA 3B2JA 2Q4NA 2O62A 2XKLA 1QY2A 1T8VA 1QFTA 1LIFA 2AT6X 3I0AA 5D48A 5EDCA 2CM9A 4IB9A 1A3YA 1ERXA 4AW8A 4ZH9A 1CBIA 1EIOA 5D47A 2R73A 5BVQA 2JU8A 2QOSC 5HTEA 3D96A 1KOIA 1BSYA 1CBQA 1HBPA 4O9SA 1KT4A 1DZKA 4YFPA 1DC9A 3B2IA 1YWDA 3JSQA 1IW2A 1JZUA 2IFBA 1X8PA 3CMPA 3DTQA 3F9DA 1OBUA 2CM4A 5BVSA 2A13A 1TW4A 3MVFA 1EPAA 1QY1A 1B4MA 2FR2A 3C77X 3NR3A 2AL0X 1ZRYA 3O2YA 1E02A 3RSWA 2G7BA 4QYNA 3U03A 1BSQA 3APXA 1MX8A 1MDCA 5KICA 1ZNHA 3HWEA 2OVDA 2QO4A 1O1UA 3APVA 5FENA 4ALBA 3UEVA 1T0VA 4YMYA 1GT1A 4R0BA 1A2DA 4A1YA 4ODDA 5L8IA 1H91A 3WJDA 3TF6A 4OMWA 4LZVA 3CBCA 4BOEA 2BLGA 1X8UA 2FRSA 1KGLA 1GT4A 4EXZA 3NQ9A 5LKFA 1OEJA 3BX8A 2K23A 4RUUA 2ACOA 3NADA 2DM5A 4GNYA 3UEXA 4ZHGA 5HZ5A 5HBSA 4PSQA 5HCEC 2LBVA 5LJEA 1EPBA 2POAA 2A2UA 4XMFA 3VG6A 3G7XA 1FTPA 3P6CA 1ZNKA 3ZUIA 3U0DA 4DQ4A 1CJ5A 5KIDA 1MVGA 1BRPA 3NQ3A 5DG4A 3FENA 5HWZA 3O19A 2ANSA 1NP1A 3RZYA 3FA6A 4UU2A 4NLIA 1FENA 3FR5A 4LZUA 1LIDA 1AELA 4YFQA 2WQAE 1QWDA 1LIBA 1I4UA 1BLRA 1KT7A 4D6AA 1AVGI 1JJXA 3B2LA 2W2BA 5HA0A 4KIIA 2WSJA 3FEPA 1R0UA 1DF3A 1FELA 4ALOA 3O22A 1PBOA 3FIQA 2N93A 3UEUA 1XKIA 4TKJA 1KT5A 1DFVA 1XCAA 4AYHA 2NNQA 4EFGA 1ICNA 2YG2A 1E5PA 1S44A 4IMNA 1EIIA 2W2FA 3VG5A 4K19A 1GT3A 5EDBA 1YWAA 5F7GA 4NYRA 4BVMA 4QZTA 3BDRA 3WJEA 2AMMX 1ICMA 4XMGA 1DZJA 3APWA 3FR2A 4YGZA 3PECA 2JU3A 2FWVA 4A60A 1BBPA 2FLJA 1X8OA 4CK4A 1SXYA 3B2KA 1G5WA 3FW4A 4ARHA 3VG3A 4ZFXA 1NP4A 3PH6A 1BWYA 3C76X 1CBSA 1U0XA 3VG2A 3S26A 4ORRA 5F6BA 4MVLA 4BQUA 4AZOA 2FS6A 1NGLA 2XSTA 4HPDA 1SY1A 4NP1A 4YGHA 5EZ2A 2WR6A 1JV4A 2Q9SA 3CBSA 3T1DA 2JN3A 4ORXA 1G74A 1ALBA 5IO7A 2HLVA 3BY0A 4ZH6A 3PH5A 4YDBA 4NNSA 3HWFA 3L4RA 1JYJA 5F58A 2X46A 4D6BA 1G85A 4I3DA 4YKMA 1TVQA 4YCHA 1BSOA 1OPBA 4ZR2A 1TOWA 2A3FX 3FA9A 1QQSA 3B2HA 5H9AA 5HA1A 1UZ2X 4A1HA 3KFIA 3I17A 1I06A 3PEDA 3CQRA 1CBRA 3NPOA 1B0OA 1LF7A 4IB8A 2HZQA 3STNA 1MX7A 3TGBA 2HZRA 1KXOA 1GX8A 3SAOA 1FEMA 3U9PC 4I3BA 5HAEA 5AQ6A 4ZHFA 2OVEA 4LKTA 4ORWA 2A2GA 2CBSA 4YKOA 4HPBA 1ML7A 1SY2A 3IA8A 1O1VA 2WEWA 3P6EA 1FDQA 4ORSA 1BM5A 1SA8A 4ZHHA 3MBTA 2KTDA 4Y0SA 5L8OA 5CE4A 2JU7A 2AT0X 5FAZA 4GH7A 5JR8A 1KZXA 2ALLX 3WJCA 1VYFA 1O8VA 2QO6A 3NP1A 3CQNA 1ACDA 3FA7A 5H9KA 4HPCA 3WJBA 5LJDA 5K06A 4YDAA 5D8JA 1I05A 1KQXA 1N0SA 3P6GA 1X8NA 4IBAA 1I04A 4GRJA 4N7CA 4OS8A 2JOZA 5B29A 1G7NA 2PY1A 3NX2A 4EEJA 2RCQA 3BS2A 3WBGA 2CBRA 1SXWA 3EBKA 1LNMA 1EW3A 2NP1A 2L68A 4Y0RA 4GE1A 1LICA 1PEEA 1HMRA 4DQ3A 1ZNDA 2Q2PA 4YFRA 1GGLA 1EXSA 1ZNEA 1ZNGA 1BEBA 1U18A 4XMDA 4ORYA 2G79A 4MVIA 4NNTA 4YGGA 4QYPA 2CZTA 1JJJA 4NLJA 3BLGA 4OS0A 2FS7A 2R56A 3C78X 3EMMA 5HTDA 4HFOA 1TXLA 4XMEA 1HBQA 3CWKA 1LIEA 1RBPA 3VG7A 2QO5A 1OEKA 1YUPA 2Q2MA
chains in the Genus database with same CATH superfamily
4ZGUA 2Q39A 4EKVA 1YP6A 3P02A 2RTQB 3OJYC 4TQ2A 5DPQA 4Z2OA 5IRUA 3KFHA 1IFCA 3DSZA 1MUPA 5F2BA 1K3BA 1S2PA 2HNXA 1Z24A 1SWKA 2IZHB 2L5PA 4IAXA 1SLEB 1P6PA 4GETA 1VWIB 1JJUA 2GTLM 2RTNB 4YCEA 1YIVA 1U17A 4O3WA 1VYGA 5FFHA 2OY1O 2RQ0A 3RE5A 3RY1A 4A8ZA 4IB7A 3EM0A 1BRQA 5LJGA 3S5VA 3HK1A 3WZQA 3GAQA 2JMBA 4GK9A 5HCDC 1EQDA 1MM9A 4ZGFA 5KHPA 3T2WA 1SWAA 1Y9TA 2QM9A 2KT4B 3VG4A 5AEOA 2RTJA 4QGVA 2AT5X 2X56A 2FT9A 1X8QA 3MM0A 1SWHA 2P8GA 4GZVA 1LFOA 1OBQA 4I9RA 3EW1A 4KC7A 1NC9A 2G5LA 4DCBA 2W2AA 1SLGB 3NX1A 1QY0A 3BX7A 1GT5A 1VWEB 2OVSA 3VHIA 1HQPA 1RXJA 5H8TA 2G8CO 1SY3A 2WQ9A 3FYFA 4WFVA 3VPJE 2GTLN 1EUOA 4RUNA 3ZUOA 4KCAA 3TGAA 1A57A 5LKEA 3WVMA 5HZ8A 4ZCBA 1SLDB 3HWGA 3P6FA 5EEEA 1Y9LA 3OD9A 2AKQA 4YBUA 4YH0A 2A8GA 2RCTA 5D4AA 4AZQA 3HOLA 1BJ7A 1HN2A 4ZHDA 1KT3A 2G78A 1LKEA 3FLLA 2LBAA 1SWDA 3EYCA 4WHIA 1QG5A 3CR6A 1ZNLA 2RTEB 3RWXA 1LPJA 1E06A 1PM1X 4O4UA 1S7DA 1Y53X 2HMBA 2RTLA 1YP7A 3SLJA 5HZ6A 3ZQ3A 4M6SA 1NQMA 5F6ZA 1SWEA 4HPAA 2MF6A 1DF8A 3N91A 4LKPA 3WJFA 3NQKA 5L8NA 3WZNA 4Z6JA 2WWPA 5B2AO 2LB6A 4NYQA 3D4RA 4BX5B 2LA7A 5HCCC 4QGXA 4WFUA 3D95A 2IZFB 4AZMA 3ELZA 2F73A 1CRBA 4JNJA 4AZNA 4WBKA 3BU1A 4IMOA 1DZPA 1RXKA 3KQ0A 4GJVA 3KFFA 5LJCA 1DZMA 1FE3A 1KQWA 1N7YA 2OFMX 3F6ZB 2A0AA 1WUBA 1GXAA 1HMTA 4XMHA 3UEWA 3BRNA 1GKAB 4FGIB 3ZZVA 3AUMO 5EEDA 5CHKA 5JD2A 2Y3FA 3PK2A 2R74A 2GJ5A 4AZPA 1AB0A 4Z2PA 2RTGB 1KT6A 2FKJA 1LDQA 2X8FA 3GE2A 5L3YA 3EBWA 1W5RA 1X89A 2ACPX 2AT3X 2RTOB 1ADLA 4BX5A 2NNEA 3RY2A 4OMXA 1MK5A 3KZAA 3Q34A 1JIWI 3AKNA 1SWUA 2OZQA 3FW5A 2GTFX 1RSTB 4GDZA 4TKHA 4IRWA 3RDXA 5IO6A 1UREA 3AKMA 4CPHB 1LCVA 1HMSA 1VWAB 3KFGA 1VWQB 4GKCA 2LKKA 4QZUA 4ZHCA 2VDFA 3FELA 1W6FA 1D3SA 2KD2A 2JGSA 5H9NA 2FTBA 2AH7X 1GKAA 2AVIA 2X4MA 1ERBA 1D2UA 2CZUA 2NNDA 1YWCA 3FIDA 4IB6A 1JMXA 1SWTA 2M4LA 4HWMA 4C5PA 2WUTA 4GGZA 3JS1A 1IFBA 1PMPA 1SRIA 2RTCB 5C0NA 1YWBA 2IZKA 2RD7C 3QKGA 4XMCA 2L9CA 4INNA 3FEKA 2QOMA 5EPQA 3TZSA 5H9LA 1VPRA 1SXXA 3RKGA 1SWPA 3AEHA 3F8AA 3Q6LA 1N9YA 1N43A 2E4JA 3VE1A 2X45A 3WZPA 2IZLB 1LDOA 1EALA 1SY0A 1SMPI 3HOEA 1WBIA 3SOTA 1OBPA 3WJGA 4M7MA 5HZ5A 1E00A 5LJKA 2ASNX 2EU7X 3IFBA 3PPTA 4U8UO 4ZJ0A 1QFVA 4I3CA 1IJ8A 1B56A 2QMIA 3P6DA 4GD9A 5IO5A 2MM3A 1UYOX 5FQ7E 4TLJA 1RLBE 4QAEA 1SWOA 4IAWA 1T68X 2OFRX 3PDFA 3HWDA 3ELXA 1HXLA 1OEEA 3E3CA 2BSZA 1IIUA 3ZW0B 2FHNX 5HZ9A 3CKFA 2LFOA 3FR4A 5F1EA 1TOUA 5FQ8E 5D45A 2OVAA 3BSZE 4PJ2A 1STPA 3SLOA 5BVTA 3WXQA 1KZWA 2MO5A 4LQZA 4TJZA 2HYSA 1AQBA 4I9SA 4O4OA 4EDEA 3SZJA 3SLTA 5HZQA 4TKBA 2MJIA 1LELA 1SXUA 3K3LA 1X71A 1QABE 1MEPA 3P6HA 3EW2A 2F01A 4UU3A 3RDSA 4FQBB 3APUA 4N7DA 4FBVA 4Y0QA 3FMZA 3TGCA 1IKJA 4GNWA 4O49A 5B5FA 2OL6O 1VWLB 1DV9A 4Y59A 3D9WA 2L67A 5LJHA 4Y0PA 3ZW0A 1B8EA 1JYDA 4MVKA 1SRGA 3STMX 3T6FA 1GX9A 2K62A 3D97A 1A18A 2ZSCA 4TNNA 2Y32A 1IKEA 2RA6A 1GM6A 4OS3A 4U8UN 4YBPA 5B27A 2GC9A 3STKA 4ES7A 3PP6A 4ORUA 1JBHA 2AT8X 1OPAA 2IZIA 4QGWA 2RTMA 3BU9A 3FA8A 3ZI8A 2FR3A 1L6MA 4Y5DA 2WEXA 3B2JA 2Q4NA 2O62A 2XKLA 2OYBO 1QY2A 1T8VA 2VFCA 1QFTA 1LIFA 2AT6X 3I0AA 3KVNA 5D48A 3ZW1B 2A5CA 5EDCA 2I5ZO 2CM9A 4IB9A 3WZOA 1A3YA 1ERXA 2OL8O 4AW8A 4JO6A 4KC8A 4ZH9A 4COTA 3VU1A 2JW1A 3VHHA 3HTYA 1CBIA 3FDCA 1SWFA 1EIOA 2Y3EA 5D47A 2R73A 5BVQA 2JU8A 3MG5A 4U46A 1VWRB 5K67A 1SWJA 2QOSC 5HTEA 1SLFB 3D96A 1KOIA 1BSYA 1GX3A 2IZEB 1CBQA 4FBRA 1HBPA 4O9SA 1NDJA 1KT4A 1DZKA 4YFPA 1W4TA 1DC9A 3B2IA 1YWDA 3JSQA 1IW2A 3ZW1A 2OY8A 1JZUA 4Z27A 2IFBA 1X8PA 3CMPA 3DTQA 3F9DA 1OBUA 2CM4A 4CDDA 5BVSA 2A13A 1K24A 1TW4A 3MVFA 1EPAA 1HY2A 1QY1A 5AJBA 1B4MA 3VHMA 3HPEA 2FR2A 3C77X 3NR3A 2AL0X 5IRWA 1ZRYA 3O2YA 1E02A 3RSWA 2G7BA 4QYNA 2QCBA 3U03A 1BSQA 3APXA 1MX8A 1MDCA 2MWHA 1SRFA 5CSEA 5KICA 1ZNHA 1Y55X 3HWEA 2OVDA 1I78A 2QO4A 1O1UA 3APVA 2RTKA 2BHVA 3RBYA 3RDUA 5FENA 3ZW2A 2C1SA 1RXHA 4ALBA 3UEVA 2RTDB 1T0VA 4YMYA 3RDQA 1GT1A 4R0BA 1A2DA 4A1YA 4ODDA 5L8IA 1H91A 2X55A 3WJDA 4IABA 4DNEA 3TF6A 1VWOB 2FGSA 4OMWA 4I95A 4LZVA 3CBCA 4BOEA 2BLGA 4BCSA 1X8UA 2FRSA 4NV7A 1KGLA 1SWLA 1GT4A 1KL4A 4EXZA 1JQPA 3NQ9A 5LKFA 1OEJA 3BX8A 4QQ1A 2K23A 4RUUA 2ACOA 3NADA 2DM5A 4CDEA 4GNYA 1VWPB 3UEXA 4ZHGA 5HBSA 1VWJB 4MVEA 4PSQA 5HCEC 2LBVA 1EPBA 2POAA 2A2UA 4XMFA 3VG6A 3G7XA 1FTPA 1VWBB 3P6CA 1ZNKA 2OFAA 3QQ2A 3ZUIA 4DQ4A 5KIDA 3U0DA 1CJ5A 1FJ1E 1SREA 1SWSA 1MVGA 4I60A 4BJ8A 1BRPA 4CPFA 3NQ3A 5DG4A 5K68A 3EC5A 3FENA 5HWZA 3O19A 2ANSA 1NBXA 2A5BA 1NP1A 3RZYA 3FA6A 3V8UA 4UU2A 4NLIA 1STSB 1FENA 3FR5A 4LZUA 4NW4A 1LIDA 1AELA 5LJEA 4YFQA 2WQAE 1QWDA 4O3ZA 1LCWA 1PTSA 3RDOA 3S60A 1LIBA 4AZRA 1I4UA 1BLRA 2BS6A 1KT7A 1PBYA 1AVGI 1I9HA 3JQOA 4Z28A 4D6AA 3B2LA 1JJXA 2W2BA 5HA0A 2IZAA 2VFBA 2Z4HA 2WSJA 4KIIA 3FEPA 1R0UA 1SWQA 2RTRB 1FELA 2IZCB 3O22A 3VE2A 1PBOA 4ALOA 3FIQA 1VWGB 4OKAA 4KT5A 5IXGA 2FKGA 2N93A 4ID2A 3UEUA 1HQQA 1XKIA 4TKJA 2F09A 1KT5A 1DFVA 3LHNA 3PQUA 1XCAA 3UAQA 2NNQA 4AYHA 5B29A 4EFGA 1ICNA 2GH7A 2YG2A 1SWCA 1E5PA 2RTBB 3RE6A 3PQSA 1S44A 2RTFB 4IMNA 4JHQA 4CSBA 4GDAA 1EIIA 4OELA 2IZBA 2W2FA 1VWMB 3VG5A 1HXZA 1GT3A 2C4IA 4K19A 5EDBA 3SZIA 1YWAA 3WYQA 5F7GA 4ML7B 2HKDA 4NYRA 4BVMA 4QZTA 4MISA 3BDRA 3WJEA 2AMMX 1ICMA 4XMGA 1DZJA 3APWA 3FR2A 3LV4A 4YGZA 3PECA 4BX6B 2JU3A 4QNIA 2FWVA 4A60A 1BBPA 2FLJA 1X8OA 4CK4A 2BS5A 1SXYA 3B2KA 1LCZA 1G5WA 3FW4A 1VWCB 4ARHA 4Z2VA 4GGTA 3VG3A 2AF5A 1VWKB 4ZFXA 1NP4A 2X34A 3PH6A 1OSPO 1BWYA 3C76X 1CBSA 1U0XA 3VG2A 3S26A 4ORRA 2FHLA 5F6BA 4MVLA 4O3YA 5B11O 4BQUA 4AZOA 2FS6A 1NGLA 2XSTA 4HPDA 1SY1A 1VWFB 2KW1A 4NP1A 4U9CA 4KH8A 4BX6A 4GJSA 4YGHA 1VWNB 3S5XA 5EZ2A 2WR6A 1JV4A 2RTAA 1STRB 2PI3O 2IZGB 4FBOA 4CDFA 2Q9SA 3CBSA 1N4JA 4B55A 2KTSA 3T1DA 2JN3A 4ORXA 1G74A 1ALBA 1E2TA 2RN4A 1SRHA 5IO7A 2HLVA 4NV8A 2OF9A 3BY0A 4ZH6A 1KL5A 3PH5A 4YDBA 4NNSA 3HWFA 3L4RA 1JYJA 4O4SA 4O3XB 2I5VO 5F58A 2X46A 4D6BA 1G85A 4I3DA 2C1QA 4YKMA 1TVQA 4YCHA 1KL3A 1BSOA 1OPBA 4ZR2A 1TOWA 2OFBA 2A3FX 3FA9A 1QQSA 3B2HA 1Y0GA 2IZDB 2Z4IA 5H9AA 5HA1A 1SWNA 1UZ2X 4A1HA 4CV7A 3KFIA 1SRJA 3I17A 1I06A 2ZAIA 3CKGA 5B10O 3PEDA 3CQRA 4CDCA 1CBRA 3NPOA 1B0OA 1LF7A 4L1NA 2OY7A 4BBOA 4IB8A 2HZQA 4JGLA 3NBXX 1MX7A 3STNA 3T2XA 3TGBA 2HZRA 1KXOA 1LUQA 1GX8A 3SAOA 4MEEA 1FEMA 3U9PC 4I3BA 5HAEA 2RTIB 5AQ6A 4ZHFA 2OVEA 4GU8A 4I6SA 4LKTA 4ORWA 2A2GA 2CBSA 3LTWA 4GUZA 2X32A 4YKOA 4HPBA 1ML7A 1SY2A 3IA8A 1O1VA 2RTHB 2WEWA 3P6EA 3WYPA 1EI5A 2OY5O 1FDQA 4ORSA 5B5GA 1BM5A 1SA8A 2DJFA 4ZHHA 1SWRA 1VYOA 2BT9A 2KTDA 3MBTA 1SWGA 2UZ2A 4Y0SA 5L8OA 5CE4A 2JU7A 2AT0X 5FAZA 4GH7A 5B3MO 5JR8A 1KZXA 2ALLX 3WJCA 1VYFA 1O8VA 4O4XA 4YVBA 2QO6A 1DF3A 3NP1A 3CQNA 1MOYA 4OEMA 1ACDA 3FA7A 5H9KA 3OE3A 4HPCA 5LJDA 3WJBA 1Y52X 5K06A 4YDAA 5CYBA 5D8JA 4MIRA 2RTPB 1I05A 5LJBA 1KQXA 1N0SA 3P6GA 4CPIA 1X8NA 4IBAA 2MHDA 1I04A 4GRJA 3MX7A 4N7CA 4OS8A 2JOZA 1AVDA 1G7NA 1VWDB 2PY1A 2UYWA 2WPUA 3NX2A 5IRAA 4EEJA 5FQ6E 2RCQA 3BS2A 3WBGA 2CBRA 4ON1A 1SXWA 3EBKA 1LNMA 1EW3A 2NP1A 1N9MA 2L68A 4Y0RA 2BC3A 4GE1A 1LICA 2OF8A 1PEEA 1HMRA 1KFFA 4DQ3A 1AVEA 2DJGA 4BX7B 1ZNDA 2Q2PA 3OBLA 4YFRA 1GGLA 1JMZA 1RAVA 1EXSA 4QRLA 3T6LA 3ZWEA 1ZNEA 1ZNGA 3P24A 1BEBA 1U18A 4GGRA 4CPHA 1UYNX 4L3RA 1SWBA 4ORYA 4XMDA 2G79A 4MVIA 2OL7A 4NNTA 4YGGA 4QYPA 2CZTA 1NQNA 1JJJA 4NLJA 2X8TA 3BLGA 2CAMA 2FS7A 2R56A 3C78X 4OS0A 2IZJA 2ZAGA 3EMMA 2X8SA 4HFOA 1TXLA 4XMEA 2YMSA 5HTDA 1HBQA 3WOVA 3SZHA 4EQAC 5BYPA 3CWKA 1LIEA 4U3QA 3X00A 4BGFA 4BX7A 1VWHB 1RBPA 1RSUB 3H3IA 4U8UM 5AJCA 3RDMA 2GTLO 3VGWA 3VG7A 2QO5A 1OEKA 1YUPA 4CPEA 2Q2MA
chains in the Genus database with same CATH topology
4ZGUA 2Q39A 1YP6A 3P02A 3OJYC 4TQ2A 5DPQA 3KFHA 1IFCA 3DSZA 1MUPA 1S2PA 2HNXA 1Z24A 2L5PA 4IAXA 1P6PA 4GETA 2GTLM 4YCEA 1YIVA 1U17A 4O3WA 1VYGA 5FFHA 2RQ0A 4A8ZA 4IB7A 3EM0A 1BRQA 5LJGA 3S5VA 3HK1A 3GAQA 2JMBA 4GK9A 5HCDC 1EQDA 4ZGFA 5KHPA 3VG4A 1Y9TA 2QM9A 5AEOA 2KT4B 4QGVA 2AT5X 2FT9A 1X8QA 2P8GA 4GZVA 1LFOA 1OBQA 4I9RA 4KC7A 2W2AA 3NX1A 1QY0A 3BX7A 1GT5A 2OVSA 5LJBA 1HQPA 5H8TA 4AZRA 2WQ9A 1SY3A 4WFVA 3FYFA 3VPJE 2GTLN 1EUOA 4RUNA 3ZUOA 4KCAA 3TGAA 1A57A 5LKEA 3WVMA 5HZ8A 4ZCBA 3P6FA 3HWGA 5EEEA 1Y9LA 3OD9A 2AKQA 4YBUA 4YH0A 5D4AA 2RCTA 4AZQA 3HOLA 1BJ7A 1HN2A 4ZHDA 1KT3A 2G78A 1LKEA 3FLLA 2LBAA 3EYCA 4WHIA 1QG5A 3CR6A 1ZNLA 3RWXA 1LPJA 1E06A 1PM1X 4O4UA 1S7DA 2HMBA 5HZ6A 1YP7A 3ZQ3A 4M6SA 5F6ZA 4HPAA 3N91A 4LKPA 3WJFA 3NQKA 5L8NA 2WWPA 2LB6A 4NYQA 3D4RA 5HCCC 2LA7A 4QGXA 4WFUA 3D95A 4AZMA 4AZNA 3ELZA 2F73A 1CRBA 4WBKA 3BU1A 4IMOA 1DZPA 3KQ0A 3KFFA 5LJCA 1DZMA 1FE3A 1KQWA 2OFMX 3F6ZB 2A0AA 1GXAA 1HMTA 4XMHA 3UEWA 3BRNA 1GKAB 4FGIB 3ZZVA 5EEDA 2R74A 2GJ5A 4AZPA 1AB0A 1KT6A 2X8FA 3GE2A 3EBWA 1X89A 2AT3X 2ACPX 1ADLA 2NNEA 4OMXA 3KZAA 1JIWI 3AKNA 2OZQA 3FW5A 4GDZA 2GTFX 4TKHA 5IO6A 1UREA 3AKMA 1HMSA 3KFGA 4GKCA 2LKKA 4QZUA 4ZHCA 3FELA 1D3SA 2KD2A 5H9NA 2AH7X 2FTBA 1GKAA 1ERBA 2NNDA 1D2UA 2CZUA 1YWCA 4IB6A 2M4LA 4HWMA 2WUTA 3JS1A 1IFBA 1PMPA 5C0NA 1YWBA 2RD7C 3QKGA 4XMCA 2L9CA 4INNA 3FEKA 5EPQA 3TZSA 5H9LA 1VPRA 1SXXA 3RKGA 3F8AA 3Q6LA 2E4JA 3VE1A 2X45A 1EALA 1SY0A 1SMPI 3HOEA 3SOTA 1OBPA 3WJGA 4M7MA 1E00A 5LJKA 2ASNX 2EU7X 3IFBA 3PPTA 4U8UO 4ZJ0A 1QFVA 4I3CA 1B56A 2QMIA 3P6DA 5IO5A 2MM3A 5FQ7E 4TLJA 1RLBE 4QAEA 4IAWA 1T68X 2OFRX 3HWDA 3ELXA 1OEEA 3E3CA 1IIUA 3ZW0B 5HZ9A 2LFOA 3FR4A 5F1EA 1TOUA 5FQ8E 5D45A 2OVAA 3BSZE 4PJ2A 5BVTA 1KZWA 3WXQA 2MO5A 4LQZA 4TJZA 2HYSA 1AQBA 4I9SA 4O4OA 4EDEA 4TKBA 5HZQA 2MJIA 3K3LA 1SXUA 1X71A 1QABE 3P6HA 4UU3A 4FQBB 3APUA 4N7DA 4FBVA 4Y0QA 3FMZA 3TGCA 1IKJA 4GNWA 4O49A 1DV9A 2L67A 5LJHA 4Y0PA 3ZW0A 1B8EA 1JYDA 4MVKA 3STMX 1GX9A 2K62A 3D97A 1A18A 4TNNA 1IKEA 2RA6A 1GM6A 4OS3A 4U8UN 4YBPA 5B27A 2GC9A 3STKA 4ES7A 3PP6A 4ORUA 1JBHA 2AT8X 1OPAA 4QGWA 3BU9A 3FA8A 3ZI8A 2FR3A 1L6MA 2WEXA 3B2JA 2Q4NA 2O62A 2XKLA 1QY2A 1T8VA 1QFTA 1LIFA 2AT6X 3I0AA 5D48A 3ZW1B 5EDCA 2CM9A 4IB9A 1A3YA 1ERXA 4AW8A 4KC8A 4ZH9A 4COTA 3VU1A 2JW1A 3HTYA 1CBIA 1EIOA 5D47A 2R73A 5BVQA 2JU8A 2QOSC 5HTEA 3D96A 1KOIA 1BSYA 1CBQA 4FBRA 1HBPA 4O9SA 1KT4A 1DZKA 4YFPA 1DC9A 3B2IA 1YWDA 3JSQA 1IW2A 3ZW1A 1JZUA 2IFBA 1X8PA 3CMPA 3DTQA 3F9DA 1OBUA 2CM4A 5BVSA 2A13A 1TW4A 3MVFA 1EPAA 1QY1A 5AJBA 1B4MA 2FR2A 3C77X 3NR3A 2AL0X 1ZRYA 3O2YA 1E02A 3RSWA 2G7BA 4QYNA 3U03A 1BSQA 3APXA 1MX8A 1MDCA 2MWHA 5KICA 1ZNHA 3HWEA 2OVDA 2QO4A 1O1UA 3APVA 3RBYA 5FENA 3ZW2A 4ALBA 3UEVA 1T0VA 4YMYA 1GT1A 4R0BA 1A2DA 4A1YA 4ODDA 5L8IA 1H91A 3WJDA 4IABA 3TF6A 4OMWA 4I95A 4LZVA 3CBCA 4BOEA 2BLGA 1X8UA 2FRSA 1KGLA 1GT4A 4EXZA 3NQ9A 5LKFA 1OEJA 3BX8A 4QQ1A 2K23A 4RUUA 2ACOA 3NADA 2DM5A 4GNYA 3UEXA 4ZHGA 5HZ5A 5HBSA 4MVEA 4PSQA 5HCEC 2LBVA 5LJEA 1EPBA 2POAA 2A2UA 4XMFA 3VG6A 3G7XA 1FTPA 3P6CA 1ZNKA 3ZUIA 3U0DA 4DQ4A 1CJ5A 5KIDA 1MVGA 1BRPA 3NQ3A 5DG4A 3FENA 5HWZA 3O19A 2ANSA 1NP1A 3RZYA 3FA6A 3V8UA 4UU2A 4NLIA 1FENA 3FR5A 4LZUA 4NW4A 1LIDA 1AELA 4YFQA 2WQAE 1QWDA 4O3ZA 3S60A 1LIBA 1I4UA 1BLRA 2BS6A 1KT7A 4D6AA 1AVGI 3JQOA 1JJXA 3B2LA 2W2BA 5HA0A 2Z4HA 2WSJA 4KIIA 3FEPA 1R0UA 1DF3A 1FELA 3VE2A 3O22A 4ALOA 1PBOA 3FIQA 4KT5A 2N93A 4ID2A 3UEUA 1XKIA 4TKJA 2F09A 1KT5A 1DFVA 3LHNA 3PQUA 1XCAA 3UAQA 2NNQA 4AYHA 4EFGA 1ICNA 2YG2A 1E5PA 3PQSA 1S44A 4IMNA 4CSBA 1EIIA 2W2FA 3VG5A 4K19A 1GT3A 5EDBA 1YWAA 5F7GA 4ML7B 4NYRA 4BVMA 4QZTA 4MISA 3BDRA 3WJEA 2AMMX 1ICMA 4XMGA 1DZJA 3APWA 3FR2A 3LV4A 4YGZA 3PECA 2JU3A 4QNIA 2FWVA 4A60A 1BBPA 2FLJA 1X8OA 4CK4A 2BS5A 1SXYA 3B2KA 1G5WA 3FW4A 4ARHA 3VG3A 4ZFXA 1NP4A 3PH6A 1BWYA 3C76X 1CBSA 1YUPA 1U0XA 3VG2A 3S26A 4ORRA 5F6BA 4MVLA 4O3YA 4BQUA 4AZOA 2FS6A 1NGLA 2XSTA 4HPDA 1SY1A 4NP1A 2KW1A 4U9CA 4KH8A 4YGHA 3S5XA 5EZ2A 2WR6A 1JV4A 4FBOA 2Q9SA 3CBSA 2KTSA 3T1DA 2JN3A 4ORXA 1G74A 1ALBA 2RN4A 5IO7A 2HLVA 3BY0A 4ZH6A 3PH5A 4YDBA 4NNSA 3HWFA 3L4RA 1JYJA 4O4SA 4O3XB 5F58A 2X46A 4D6BA 1G85A 4I3DA 4YKMA 1TVQA 4YCHA 1BSOA 1OPBA 4ZR2A 1TOWA 2A3FX 3FA9A 1QQSA 3B2HA 2Z4IA 5H9AA 5HA1A 1UZ2X 4A1HA 4CV7A 3KFIA 3I17A 1I06A 2ZAIA 3PEDA 3CQRA 1CBRA 3NPOA 1B0OA 1LF7A 4L1NA 4IB8A 2HZQA 4JGLA 3NBXX 1MX7A 3STNA 3TGBA 2HZRA 1KXOA 1GX8A 3SAOA 1FEMA 3U9PC 4I3BA 5HAEA 5AQ6A 4ZHFA 2OVEA 4GU8A 4I6SA 4LKTA 4ORWA 2A2GA 2CBSA 4YKOA 4HPBA 1ML7A 1SY2A 3IA8A 1O1VA 2WEWA 3P6EA 1EI5A 1FDQA 4ORSA 1BM5A 1SA8A 4ZHHA 2BT9A 3MBTA 2KTDA 4Y0SA 5L8OA 5CE4A 2JU7A 2AT0X 5FAZA 4GH7A 5JR8A 1KZXA 2ALLX 3WJCA 1VYFA 1O8VA 4O4XA 2QO6A 3NP1A 3CQNA 1ACDA 3FA7A 5H9KA 3OE3A 4HPCA 5LJDA 3WJBA 5K06A 4YDAA 5CYBA 5D8JA 4MIRA 1I05A 1KQXA 1N0SA 3P6GA 1X8NA 4IBAA 2MHDA 1I04A 4GRJA 3MX7A 4N7CA 4OS8A 2JOZA 5B29A 1G7NA 2PY1A 3NX2A 4EEJA 5FQ6E 2RCQA 3BS2A 3WBGA 2CBRA 4ON1A 1SXWA 3EBKA 1LNMA 1EW3A 2NP1A 2L68A 4Y0RA 4GE1A 1LICA 1PEEA 1HMRA 4DQ3A 1ZNDA 2Q2PA 3OBLA 4YFRA 1GGLA 1EXSA 4QRLA 3ZWEA 1ZNEA 1ZNGA 3P24A 1BEBA 1U18A 4L3RA 4XMDA 4ORYA 2G79A 4MVIA 4NNTA 4YGGA 4QYPA 2CZTA 1JJJA 4NLJA 2X8TA 3BLGA 4OS0A 2FS7A 2R56A 3C78X 2ZAGA 3EMMA 2X8SA 4HFOA 1TXLA 4XMEA 2YMSA 5HTDA 1HBQA 3WOVA 4EQAC 5BYPA 3CWKA 1LIEA 4U3QA 1RBPA 3H3IA 4U8UM 5AJCA 2GTLO 3VG7A 2QO5A 1OEKA 2BHVA 2Q2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGU A;  2Q39 A;  1YP6 A;  3OJY C;  4TQ2 A;  5DPQ A;  3KFH A;  1IFC A;  3DSZ A;  1MUP A;  1S2P A;  2HNX A;  1Z24 A;  2L5P A;  4IAX A;  1P6P A;  4GET A;  4YCE A;  1YIV A;  1U17 A;  4A8Z A;  1VYG A;  5FFH A;  2RQ0 A;  4IB7 A;  3EM0 A;  1BRQ A;  5LJG A;  3HK1 A;  3GAQ A;  5HCD C;  1EQD A;  5KHP A;  3VG4 A;  2QM9 A;  2KT4 B;  4QGV A;  2AT5 X;  2FT9 A;  1X8Q A;  2P8G A;  1LFO A;  1OBQ A;  4I9R A;  2W2A A;  3NX1 A;  1QY0 A;  3BX7 A;  1GT5 A;  5LJB A;  1HQP A;  5H8T A;  4AZR A;  2WQ9 A;  1SY3 A;  4WFV A;  1EUO A;  4RUN A;  3ZUO A;  3TGA A;  1A57 A;  5LKE A;  3WVM A;  5HZ8 A;  4ZCB A;  3P6F A;  3HWG A;  5EEE A;  4YBU A;  2AKQ A;  4AZQ A;  4YH0 A;  5D4A A;  2RCT A;  1BJ7 A;  1HN2 A;  4ZHD A;  1KT3 A;  2G78 A;  1LKE A;  3FLL A;  2LBA A;  3EYC A;  1QG5 A;  3CR6 A;  1ZNL A;  1LPJ A;  1E06 A;  1PM1 X;  1S7D A;  2HMB A;  5HZ6 A;  1YP7 A;  3ZQ3 A;  4M6S A;  5F6Z A;  4HPA A;  4LKP A;  3WJF A;  5L8N A;  2WWP A;  2LB6 A;  4NYQ A;  5HCC C;  4QGX A;  4WFU A;  3D95 A;  4AZM A;  4AZN A;  3ELZ A;  2F73 A;  1CRB A;  4WBK A;  3BU1 A;  4IMO A;  1DZP A;  3KQ0 A;  3KFF A;  5LJC A;  1DZM A;  1FE3 A;  1KQW A;  2OFM X;  2A0A A;  1GXA A;  1HMT A;  4XMH A;  3UEW A;  3BRN A;  1GKA B;  5EED A;  2R74 A;  2GJ5 A;  4AZP A;  1AB0 A;  1KT6 A;  3EBW A;  1X89 A;  2AT3 X;  2ACP X;  1ADL A;  2NNE A;  4OMX A;  3KZA A;  3AKN A;  3FW5 A;  2OZQ A;  2GTF X;  4TKH A;  5IO6 A;  1URE A;  3AKM A;  1HMS A;  3KFG A;  4GKC A;  2LKK A;  4QZU A;  4ZHC A;  3FEL A;  1D3S A;  5H9N A;  2AH7 X;  2FTB A;  1GKA A;  1ERB A;  2NND A;  1D2U A;  2CZU A;  1YWC A;  4IB6 A;  2WUT A;  3JS1 A;  1IFB A;  1PMP A;  5C0N A;  1YWB A;  2RD7 C;  3QKG A;  4XMC A;  2L9C A;  5EPQ A;  3FEK A;  3TZS A;  5H9L A;  1VPR A;  1SXX A;  3F8A A;  3Q6L A;  2E4J A;  2X45 A;  1EAL A;  1SY0 A;  1OBP A;  3WJG A;  4M7M A;  1E00 A;  5LJK A;  2ASN X;  2EU7 X;  3IFB A;  3PPT A;  4ZJ0 A;  1QFV A;  4I3C A;  1B56 A;  3P6D A;  5IO5 A;  2MM3 A;  4TLJ A;  1RLB E;  4QAE A;  4IAW A;  1T68 X;  2OFR X;  3HWD A;  3ELX A;  1OEE A;  1IIU A;  5HZ9 A;  2LFO A;  3FR4 A;  5F1E A;  1TOU A;  5D45 A;  2OVA A;  3BSZ E;  5BVT A;  1KZW A;  3WXQ A;  2MO5 A;  4TJZ A;  2HYS A;  1AQB A;  4I9S A;  4EDE A;  4TKB A;  5HZQ A;  2MJI A;  3K3L A;  1SXU A;  1X71 A;  1QAB E;  3P6H A;  4UU3 A;  3APU A;  4N7D A;  4Y0Q A;  3FMZ A;  3TGC A;  1IKJ A;  4GNW A;  1DV9 A;  2L67 A;  5LJH A;  4Y0P A;  1B8E A;  1JYD A;  4MVK A;  3STM X;  1GX9 A;  2K62 A;  3D97 A;  1A18 A;  4TNN A;  1IKE A;  2RA6 A;  1GM6 A;  4OS3 A;  4YBP A;  5B27 A;  2GC9 A;  3STK A;  4ES7 A;  3PP6 A;  4ORU A;  1JBH A;  2AT8 X;  1OPA A;  4QGW A;  3BU9 A;  3FA8 A;  2FR3 A;  1L6M A;  2WEX A;  3B2J A;  2Q4N A;  2O62 A;  2XKL A;  1QY2 A;  1T8V A;  1QFT A;  1LIF A;  2AT6 X;  3I0A A;  5D48 A;  5EDC A;  2CM9 A;  4IB9 A;  1A3Y A;  1ERX A;  4AW8 A;  4ZH9 A;  1CBI A;  1EIO A;  5D47 A;  2R73 A;  5BVQ A;  2JU8 A;  2QOS C;  5HTE A;  3D96 A;  1KOI A;  1BSY A;  1CBQ A;  1HBP A;  4O9S A;  1KT4 A;  1DZK A;  4YFP A;  1DC9 A;  3B2I A;  1YWD A;  3JSQ A;  1IW2 A;  1JZU A;  2IFB A;  1X8P A;  3CMP A;  3DTQ A;  3F9D A;  1OBU A;  2CM4 A;  5BVS A;  2A13 A;  1TW4 A;  3MVF A;  1EPA A;  1QY1 A;  1B4M A;  2FR2 A;  3C77 X;  3NR3 A;  2AL0 X;  1ZRY A;  3O2Y A;  1E02 A;  3RSW A;  2G7B A;  4QYN A;  3U03 A;  1BSQ A;  3APX A;  1MX8 A;  1MDC A;  5KIC A;  1ZNH A;  3HWE A;  2OVD A;  2QO4 A;  1O1U A;  3APV A;  5FEN A;  4ALB A;  3UEV A;  1T0V A;  4YMY A;  1GT1 A;  4R0B A;  1A2D A;  4A1Y A;  4ODD A;  5L8I A;  1H91 A;  3WJD A;  3TF6 A;  4OMW A;  4LZV A;  3CBC A;  4BOE A;  2BLG A;  1X8U A;  2FRS A;  1KGL A;  1GT4 A;  4EXZ A;  3NQ9 A;  5LKF A;  1OEJ A;  3BX8 A;  2K23 A;  4RUU A;  2ACO A;  3NAD A;  2DM5 A;  4GNY A;  3UEX A;  4ZHG A;  5HZ5 A;  5HBS A;  4PSQ A;  5HCE C;  2LBV A;  5LJE A;  1EPB A;  2POA A;  2A2U A;  4XMF A;  3VG6 A;  3G7X A;  1FTP A;  3P6C A;  1ZNK A;  3ZUI A;  3U0D A;  4DQ4 A;  1CJ5 A;  5KID A;  1MVG A;  1BRP A;  3NQ3 A;  5DG4 A;  3FEN A;  5HWZ A;  3O19 A;  2ANS A;  1NP1 A;  3RZY A;  3FA6 A;  4UU2 A;  4NLI A;  1FEN A;  3FR5 A;  4LZU A;  1LID A;  1AEL A;  4YFQ A;  2WQA E;  1QWD A;  1LIB A;  1I4U A;  1BLR A;  1KT7 A;  4D6A A;  1AVG I;  1JJX A;  3B2L A;  2W2B A;  5HA0 A;  4KII A;  2WSJ A;  3FEP A;  1R0U A;  1DF3 A;  1FEL A;  4ALO A;  3O22 A;  1PBO A;  3FIQ A;  2N93 A;  3UEU A;  1XKI A;  4TKJ A;  1KT5 A;  1DFV A;  1XCA A;  4AYH A;  2NNQ A;  4EFG A;  1ICN A;  2YG2 A;  1E5P A;  1S44 A;  4IMN A;  1EII A;  2W2F A;  3VG5 A;  4K19 A;  1GT3 A;  5EDB A;  1YWA A;  5F7G A;  4NYR A;  4BVM A;  4QZT A;  3BDR A;  3WJE A;  2AMM X;  1ICM A;  4XMG A;  1DZJ A;  3APW A;  3FR2 A;  4YGZ A;  3PEC A;  2JU3 A;  2FWV A;  4A60 A;  1BBP A;  2FLJ A;  1X8O A;  4CK4 A;  1SXY A;  3B2K A;  1G5W A;  3FW4 A;  4ARH A;  3VG3 A;  4ZFX A;  1NP4 A;  3PH6 A;  1BWY A;  3C76 X;  1CBS A;  1U0X A;  3VG2 A;  3S26 A;  4ORR A;  5F6B A;  4MVL A;  4BQU A;  4AZO A;  2FS6 A;  1NGL A;  2XST A;  4HPD A;  1SY1 A;  4NP1 A;  4YGH A;  5EZ2 A;  2WR6 A;  1JV4 A;  2Q9S A;  3CBS A;  3T1D A;  2JN3 A;  4ORX A;  1G74 A;  1ALB A;  5IO7 A;  2HLV A;  3BY0 A;  4ZH6 A;  3PH5 A;  4YDB A;  4NNS A;  3HWF A;  3L4R A;  1JYJ A;  5F58 A;  2X46 A;  4D6B A;  1G85 A;  4I3D A;  4YKM A;  1TVQ A;  4YCH A;  1BSO A;  1OPB A;  4ZR2 A;  1TOW A;  2A3F X;  3FA9 A;  1QQS A;  3B2H A;  5H9A A;  5HA1 A;  1UZ2 X;  4A1H A;  3KFI A;  3I17 A;  1I06 A;  3PED A;  3CQR A;  1CBR A;  3NPO A;  1B0O A;  1LF7 A;  4IB8 A;  2HZQ A;  3STN A;  1MX7 A;  3TGB A;  2HZR A;  1KXO A;  1GX8 A;  3SAO A;  1FEM A;  3U9P C;  4I3B A;  5HAE A;  5AQ6 A;  4ZHF A;  2OVE A;  4LKT A;  4ORW A;  2A2G A;  2CBS A;  4YKO A;  4HPB A;  1ML7 A;  1SY2 A;  3IA8 A;  1O1V A;  2WEW A;  3P6E A;  1FDQ A;  4ORS A;  1BM5 A;  1SA8 A;  4ZHH A;  3MBT A;  2KTD A;  4Y0S A;  5L8O A;  5CE4 A;  2JU7 A;  2AT0 X;  5FAZ A;  4GH7 A;  5JR8 A;  1KZX A;  2ALL X;  3WJC A;  1VYF A;  1O8V A;  2QO6 A;  3NP1 A;  3CQN A;  1ACD A;  3FA7 A;  5H9K A;  4HPC A;  3WJB A;  5LJD A;  5K06 A;  4YDA A;  5D8J A;  1I05 A;  1KQX A;  1N0S A;  3P6G A;  1X8N A;  4IBA A;  1I04 A;  4GRJ A;  4N7C A;  4OS8 A;  2JOZ A;  5B29 A;  1G7N A;  2PY1 A;  3NX2 A;  4EEJ A;  2RCQ A;  3BS2 A;  3WBG A;  2CBR A;  1SXW A;  3EBK A;  1LNM A;  1EW3 A;  2NP1 A;  2L68 A;  4Y0R A;  4GE1 A;  1LIC A;  1PEE A;  1HMR A;  4DQ3 A;  1ZND A;  2Q2P A;  4YFR A;  1GGL A;  1EXS A;  1ZNE A;  1ZNG A;  1BEB A;  1U18 A;  4XMD A;  4ORY A;  2G79 A;  4MVI A;  4NNT A;  4YGG A;  4QYP A;  2CZT A;  1JJJ A;  4NLJ A;  3BLG A;  4OS0 A;  2FS7 A;  2R56 A;  3C78 X;  3EMM A;  5HTD A;  4HFO A;  1TXL A;  4XME A;  1HBQ A;  3CWK A;  1LIE A;  1RBP A;  3VG7 A;  2QO5 A;  1OEK A;  1YUP A;  2Q2M A; 
#chains in the Genus database with same CATH topology
 4ZGU A;  2Q39 A;  4EKV A;  1YP6 A;  3P02 A;  2RTQ B;  3OJY C;  4TQ2 A;  5DPQ A;  4Z2O A;  5IRU A;  3KFH A;  1IFC A;  3DSZ A;  1MUP A;  5F2B A;  1K3B A;  1S2P A;  2HNX A;  1Z24 A;  1SWK A;  2IZH B;  2L5P A;  4IAX A;  1SLE B;  1P6P A;  4GET A;  1VWI B;  1JJU A;  2GTL M;  2RTN B;  4YCE A;  1YIV A;  1U17 A;  4O3W A;  1VYG A;  5FFH A;  2OY1 O;  2RQ0 A;  3RE5 A;  3RY1 A;  4A8Z A;  4IB7 A;  3EM0 A;  1BRQ A;  5LJG A;  3S5V A;  3HK1 A;  3WZQ A;  3GAQ A;  2JMB A;  4GK9 A;  5HCD C;  1EQD A;  1MM9 A;  4ZGF A;  5KHP A;  3T2W A;  1SWA A;  1Y9T A;  2QM9 A;  2KT4 B;  3VG4 A;  5AEO A;  2RTJ A;  4QGV A;  2AT5 X;  2X56 A;  2FT9 A;  1X8Q A;  3MM0 A;  1SWH A;  2P8G A;  4GZV A;  1LFO A;  1OBQ A;  4I9R A;  3EW1 A;  4KC7 A;  1NC9 A;  2G5L A;  4DCB A;  2W2A A;  1SLG B;  3NX1 A;  1QY0 A;  3BX7 A;  1GT5 A;  1VWE B;  2OVS A;  3VHI A;  1HQP A;  1RXJ A;  5H8T A;  2G8C O;  1SY3 A;  2WQ9 A;  3FYF A;  4WFV A;  3VPJ E;  2GTL N;  1EUO A;  4RUN A;  3ZUO A;  4KCA A;  3TGA A;  1A57 A;  5LKE A;  3WVM A;  5HZ8 A;  4ZCB A;  1SLD B;  3HWG A;  3P6F A;  5EEE A;  1Y9L A;  3OD9 A;  2AKQ A;  4YBU A;  4YH0 A;  2A8G A;  2RCT A;  5D4A A;  4AZQ A;  3HOL A;  1BJ7 A;  1HN2 A;  4ZHD A;  1KT3 A;  2G78 A;  1LKE A;  3FLL A;  2LBA A;  1SWD A;  3EYC A;  4WHI A;  1QG5 A;  3CR6 A;  1ZNL A;  2RTE B;  3RWX A;  1LPJ A;  1E06 A;  1PM1 X;  4O4U A;  1S7D A;  1Y53 X;  2HMB A;  2RTL A;  1YP7 A;  3SLJ A;  5HZ6 A;  3ZQ3 A;  4M6S A;  1NQM A;  5F6Z A;  1SWE A;  4HPA A;  2MF6 A;  1DF8 A;  3N91 A;  4LKP A;  3WJF A;  3NQK A;  5L8N A;  3WZN A;  4Z6J A;  2WWP A;  5B2A O;  2LB6 A;  4NYQ A;  3D4R A;  4BX5 B;  2LA7 A;  5HCC C;  4QGX A;  4WFU A;  3D95 A;  2IZF B;  4AZM A;  3ELZ A;  2F73 A;  1CRB A;  4JNJ A;  4AZN A;  4WBK A;  3BU1 A;  4IMO A;  1DZP A;  1RXK A;  3KQ0 A;  4GJV A;  3KFF A;  5LJC A;  1DZM A;  1FE3 A;  1KQW A;  1N7Y A;  2OFM X;  3F6Z B;  2A0A A;  1WUB A;  1GXA A;  1HMT A;  4XMH A;  3UEW A;  3BRN A;  1GKA B;  4FGI B;  3ZZV A;  3AUM O;  5EED A;  5CHK A;  5JD2 A;  2Y3F A;  3PK2 A;  2R74 A;  2GJ5 A;  4AZP A;  1AB0 A;  4Z2P A;  2RTG B;  1KT6 A;  2FKJ A;  1LDQ A;  2X8F A;  3GE2 A;  5L3Y A;  3EBW A;  1W5R A;  1X89 A;  2ACP X;  2AT3 X;  2RTO B;  1ADL A;  4BX5 A;  2NNE A;  3RY2 A;  4OMX A;  1MK5 A;  3KZA A;  3Q34 A;  1JIW I;  3AKN A;  1SWU A;  2OZQ A;  3FW5 A;  2GTF X;  1RST B;  4GDZ A;  4TKH A;  4IRW A;  3RDX A;  5IO6 A;  1URE A;  3AKM A;  4CPH B;  1LCV A;  1HMS A;  1VWA B;  3KFG A;  1VWQ B;  4GKC A;  2LKK A;  4QZU A;  4ZHC A;  2VDF A;  3FEL A;  1W6F A;  1D3S A;  2KD2 A;  2JGS A;  5H9N A;  2FTB A;  2AH7 X;  1GKA A;  2AVI A;  2X4M A;  1ERB A;  1D2U A;  2CZU A;  2NND A;  1YWC A;  3FID A;  4IB6 A;  1JMX A;  1SWT A;  2M4L A;  4HWM A;  4C5P A;  2WUT A;  4GGZ A;  3JS1 A;  1IFB A;  1PMP A;  1SRI A;  2RTC B;  5C0N A;  1YWB A;  2IZK A;  2RD7 C;  3QKG A;  4XMC A;  2L9C A;  4INN A;  3FEK A;  2QOM A;  5EPQ A;  3TZS A;  5H9L A;  1VPR A;  1SXX A;  3RKG A;  1SWP A;  3AEH A;  3F8A A;  3Q6L A;  1N9Y A;  1N43 A;  2E4J A;  3VE1 A;  2X45 A;  3WZP A;  2IZL B;  1LDO A;  1EAL A;  1SY0 A;  1SMP I;  3HOE A;  1WBI A;  3SOT A;  1OBP A;  3WJG A;  4M7M A;  5HZ5 A;  1E00 A;  5LJK A;  2ASN X;  2EU7 X;  3IFB A;  3PPT A;  4U8U O;  4ZJ0 A;  1QFV A;  4I3C A;  1IJ8 A;  1B56 A;  2QMI A;  3P6D A;  4GD9 A;  5IO5 A;  2MM3 A;  1UYO X;  5FQ7 E;  4TLJ A;  1RLB E;  4QAE A;  1SWO A;  4IAW A;  1T68 X;  2OFR X;  3PDF A;  3HWD A;  3ELX A;  1HXL A;  1OEE A;  3E3C A;  2BSZ A;  1IIU A;  3ZW0 B;  2FHN X;  5HZ9 A;  3CKF A;  2LFO A;  3FR4 A;  5F1E A;  1TOU A;  5FQ8 E;  5D45 A;  2OVA A;  3BSZ E;  4PJ2 A;  1STP A;  3SLO A;  5BVT A;  3WXQ A;  1KZW A;  2MO5 A;  4LQZ A;  4TJZ A;  2HYS A;  1AQB A;  4I9S A;  4O4O A;  4EDE A;  3SZJ A;  3SLT A;  5HZQ A;  4TKB A;  2MJI A;  1LEL A;  1SXU A;  3K3L A;  1X71 A;  1QAB E;  1MEP A;  3P6H A;  3EW2 A;  2F01 A;  4UU3 A;  3RDS A;  4FQB B;  3APU A;  4N7D A;  4FBV A;  4Y0Q A;  3FMZ A;  3TGC A;  1IKJ A;  4GNW A;  4O49 A;  5B5F A;  2OL6 O;  1VWL B;  1DV9 A;  4Y59 A;  3D9W A;  2L67 A;  5LJH A;  4Y0P A;  3ZW0 A;  1B8E A;  1JYD A;  4MVK A;  1SRG A;  3STM X;  3T6F A;  1GX9 A;  2K62 A;  3D97 A;  1A18 A;  2ZSC A;  4TNN A;  2Y32 A;  1IKE A;  2RA6 A;  1GM6 A;  4OS3 A;  4U8U N;  4YBP A;  5B27 A;  2GC9 A;  3STK A;  4ES7 A;  3PP6 A;  4ORU A;  1JBH A;  2AT8 X;  1OPA A;  2IZI A;  4QGW A;  2RTM A;  3BU9 A;  3FA8 A;  3ZI8 A;  2FR3 A;  1L6M A;  4Y5D A;  2WEX A;  3B2J A;  2Q4N A;  2O62 A;  2XKL A;  2OYB O;  1QY2 A;  1T8V A;  2VFC A;  1QFT A;  1LIF A;  2AT6 X;  3I0A A;  3KVN A;  5D48 A;  3ZW1 B;  2A5C A;  5EDC A;  2I5Z O;  2CM9 A;  4IB9 A;  3WZO A;  1A3Y A;  1ERX A;  2OL8 O;  4AW8 A;  4JO6 A;  4KC8 A;  4ZH9 A;  4COT A;  3VU1 A;  2JW1 A;  3VHH A;  3HTY A;  1CBI A;  3FDC A;  1SWF A;  1EIO A;  2Y3E A;  5D47 A;  2R73 A;  5BVQ A;  2JU8 A;  3MG5 A;  4U46 A;  1VWR B;  5K67 A;  1SWJ A;  2QOS C;  5HTE A;  1SLF B;  3D96 A;  1KOI A;  1BSY A;  1GX3 A;  2IZE B;  1CBQ A;  4FBR A;  1HBP A;  4O9S A;  1NDJ A;  1KT4 A;  1DZK A;  4YFP A;  1W4T A;  1DC9 A;  3B2I A;  1YWD A;  3JSQ A;  1IW2 A;  3ZW1 A;  2OY8 A;  1JZU A;  4Z27 A;  2IFB A;  1X8P A;  3CMP A;  3DTQ A;  3F9D A;  1OBU A;  2CM4 A;  4CDD A;  5BVS A;  2A13 A;  1K24 A;  1TW4 A;  3MVF A;  1EPA A;  1HY2 A;  1QY1 A;  5AJB A;  1B4M A;  3VHM A;  3HPE A;  2FR2 A;  3C77 X;  3NR3 A;  2AL0 X;  5IRW A;  1ZRY A;  3O2Y A;  1E02 A;  3RSW A;  2G7B A;  4QYN A;  2QCB A;  3U03 A;  1BSQ A;  3APX A;  1MX8 A;  1MDC A;  2MWH A;  1SRF A;  5CSE A;  5KIC A;  1ZNH A;  1Y55 X;  3HWE A;  2OVD A;  1I78 A;  2QO4 A;  1O1U A;  3APV A;  2RTK A;  2BHV A;  3RBY A;  3RDU A;  5FEN A;  3ZW2 A;  2C1S A;  1RXH A;  4ALB A;  3UEV A;  2RTD B;  1T0V A;  4YMY A;  3RDQ A;  1GT1 A;  4R0B A;  1A2D A;  4A1Y A;  4ODD A;  5L8I A;  1H91 A;  2X55 A;  3WJD A;  4IAB A;  4DNE A;  3TF6 A;  1VWO B;  2FGS A;  4OMW A;  4I95 A;  4LZV A;  3CBC A;  4BOE A;  2BLG A;  4BCS A;  1X8U A;  2FRS A;  4NV7 A;  1KGL A;  1SWL A;  1GT4 A;  1KL4 A;  4EXZ A;  1JQP A;  3NQ9 A;  5LKF A;  1OEJ A;  3BX8 A;  4QQ1 A;  2K23 A;  4RUU A;  2ACO A;  3NAD A;  2DM5 A;  4CDE A;  4GNY A;  1VWP B;  3UEX A;  4ZHG A;  5HBS A;  1VWJ B;  4MVE A;  4PSQ A;  5HCE C;  2LBV A;  1EPB A;  2POA A;  2A2U A;  4XMF A;  3VG6 A;  3G7X A;  1FTP A;  1VWB B;  3P6C A;  1ZNK A;  2OFA A;  3QQ2 A;  3ZUI A;  4DQ4 A;  5KID A;  3U0D A;  1CJ5 A;  1FJ1 E;  1SRE A;  1SWS A;  1MVG A;  4I60 A;  4BJ8 A;  1BRP A;  4CPF A;  3NQ3 A;  5DG4 A;  5K68 A;  3EC5 A;  3FEN A;  5HWZ A;  3O19 A;  2ANS A;  1NBX A;  2A5B A;  1NP1 A;  3RZY A;  3FA6 A;  3V8U A;  4UU2 A;  4NLI A;  1STS B;  1FEN A;  3FR5 A;  4LZU A;  4NW4 A;  1LID A;  1AEL A;  5LJE A;  4YFQ A;  2WQA E;  1QWD A;  4O3Z A;  1LCW A;  1PTS A;  3RDO A;  3S60 A;  1LIB A;  4AZR A;  1I4U A;  1BLR A;  2BS6 A;  1KT7 A;  1PBY A;  1AVG I;  1I9H A;  3JQO A;  4Z28 A;  4D6A A;  3B2L A;  1JJX A;  2W2B A;  5HA0 A;  2IZA A;  2VFB A;  2Z4H A;  2WSJ A;  4KII A;  3FEP A;  1R0U A;  1SWQ A;  2RTR B;  1FEL A;  2IZC B;  3O22 A;  3VE2 A;  1PBO A;  4ALO A;  3FIQ A;  1VWG B;  4OKA A;  4KT5 A;  5IXG A;  2FKG A;  2N93 A;  4ID2 A;  3UEU A;  1HQQ A;  1XKI A;  4TKJ A;  2F09 A;  1KT5 A;  1DFV A;  3LHN A;  3PQU A;  1XCA A;  3UAQ A;  2NNQ A;  4AYH A;  5B29 A;  4EFG A;  1ICN A;  2GH7 A;  2YG2 A;  1SWC A;  1E5P A;  2RTB B;  3RE6 A;  3PQS A;  1S44 A;  2RTF B;  4IMN A;  4JHQ A;  4CSB A;  4GDA A;  1EII A;  4OEL A;  2IZB A;  2W2F A;  1VWM B;  3VG5 A;  1HXZ A;  1GT3 A;  2C4I A;  4K19 A;  5EDB A;  3SZI A;  1YWA A;  3WYQ A;  5F7G A;  4ML7 B;  2HKD A;  4NYR A;  4BVM A;  4QZT A;  4MIS A;  3BDR A;  3WJE A;  2AMM X;  1ICM A;  4XMG A;  1DZJ A;  3APW A;  3FR2 A;  3LV4 A;  4YGZ A;  3PEC A;  4BX6 B;  2JU3 A;  4QNI A;  2FWV A;  4A60 A;  1BBP A;  2FLJ A;  1X8O A;  4CK4 A;  2BS5 A;  1SXY A;  3B2K A;  1LCZ A;  1G5W A;  3FW4 A;  1VWC B;  4ARH A;  4Z2V A;  4GGT A;  3VG3 A;  2AF5 A;  1VWK B;  4ZFX A;  1NP4 A;  2X34 A;  3PH6 A;  1OSP O;  1BWY A;  3C76 X;  1CBS A;  1U0X A;  3VG2 A;  3S26 A;  4ORR A;  2FHL A;  5F6B A;  4MVL A;  4O3Y A;  5B11 O;  4BQU A;  4AZO A;  2FS6 A;  1NGL A;  2XST A;  4HPD A;  1SY1 A;  1VWF B;  2KW1 A;  4NP1 A;  4U9C A;  4KH8 A;  4BX6 A;  4GJS A;  4YGH A;  1VWN B;  3S5X A;  5EZ2 A;  2WR6 A;  1JV4 A;  2RTA A;  1STR B;  2PI3 O;  2IZG B;  4FBO A;  4CDF A;  2Q9S A;  3CBS A;  1N4J A;  4B55 A;  2KTS A;  3T1D A;  2JN3 A;  4ORX A;  1G74 A;  1ALB A;  1E2T A;  2RN4 A;  1SRH A;  5IO7 A;  2HLV A;  4NV8 A;  2OF9 A;  3BY0 A;  4ZH6 A;  1KL5 A;  3PH5 A;  4YDB A;  4NNS A;  3HWF A;  3L4R A;  1JYJ A;  4O4S A;  4O3X B;  2I5V O;  5F58 A;  2X46 A;  4D6B A;  1G85 A;  4I3D A;  2C1Q A;  4YKM A;  1TVQ A;  4YCH A;  1KL3 A;  1BSO A;  1OPB A;  4ZR2 A;  1TOW A;  2OFB A;  2A3F X;  3FA9 A;  1QQS A;  3B2H A;  1Y0G A;  2IZD B;  2Z4I A;  5H9A A;  5HA1 A;  1SWN A;  1UZ2 X;  4A1H A;  4CV7 A;  3KFI A;  1SRJ A;  3I17 A;  1I06 A;  2ZAI A;  3CKG A;  5B10 O;  3PED A;  3CQR A;  4CDC A;  1CBR A;  3NPO A;  1B0O A;  1LF7 A;  4L1N A;  2OY7 A;  4BBO A;  4IB8 A;  2HZQ A;  4JGL A;  3NBX X;  1MX7 A;  3STN A;  3T2X A;  3TGB A;  2HZR A;  1KXO A;  1LUQ A;  1GX8 A;  3SAO A;  4MEE A;  1FEM A;  3U9P C;  4I3B A;  5HAE A;  2RTI B;  5AQ6 A;  4ZHF A;  2OVE A;  4GU8 A;  4I6S A;  4LKT A;  4ORW A;  2A2G A;  2CBS A;  3LTW A;  4GUZ A;  2X32 A;  4YKO A;  4HPB A;  1ML7 A;  1SY2 A;  3IA8 A;  1O1V A;  2RTH B;  2WEW A;  3P6E A;  3WYP A;  1EI5 A;  2OY5 O;  1FDQ A;  4ORS A;  5B5G A;  1BM5 A;  1SA8 A;  2DJF A;  4ZHH A;  1SWR A;  1VYO A;  2BT9 A;  2KTD A;  3MBT A;  1SWG A;  2UZ2 A;  4Y0S A;  5L8O A;  5CE4 A;  2JU7 A;  2AT0 X;  5FAZ A;  4GH7 A;  5B3M O;  5JR8 A;  1KZX A;  2ALL X;  3WJC A;  1VYF A;  1O8V A;  4O4X A;  4YVB A;  2QO6 A;  1DF3 A;  3NP1 A;  3CQN A;  1MOY A;  4OEM A;  1ACD A;  3FA7 A;  5H9K A;  3OE3 A;  4HPC A;  5LJD A;  3WJB A;  1Y52 X;  5K06 A;  4YDA A;  5CYB A;  5D8J A;  4MIR A;  2RTP B;  1I05 A;  5LJB A;  1KQX A;  1N0S A;  3P6G A;  4CPI A;  1X8N A;  4IBA A;  2MHD A;  1I04 A;  4GRJ A;  3MX7 A;  4N7C A;  4OS8 A;  2JOZ A;  1AVD A;  1G7N A;  1VWD B;  2PY1 A;  2UYW A;  2WPU A;  3NX2 A;  5IRA A;  4EEJ A;  5FQ6 E;  2RCQ A;  3BS2 A;  3WBG A;  2CBR A;  4ON1 A;  1SXW A;  3EBK A;  1LNM A;  1EW3 A;  2NP1 A;  1N9M A;  2L68 A;  4Y0R A;  2BC3 A;  4GE1 A;  1LIC A;  2OF8 A;  1PEE A;  1HMR A;  1KFF A;  4DQ3 A;  1AVE A;  2DJG A;  4BX7 B;  1ZND A;  2Q2P A;  3OBL A;  4YFR A;  1GGL A;  1JMZ A;  1RAV A;  1EXS A;  4QRL A;  3T6L A;  3ZWE A;  1ZNE A;  1ZNG A;  3P24 A;  1BEB A;  1U18 A;  4GGR A;  4CPH A;  1UYN X;  4L3R A;  1SWB A;  4ORY A;  4XMD A;  2G79 A;  4MVI A;  2OL7 A;  4NNT A;  4YGG A;  4QYP A;  2CZT A;  1NQN A;  1JJJ A;  4NLJ A;  2X8T A;  3BLG A;  2CAM A;  2FS7 A;  2R56 A;  3C78 X;  4OS0 A;  2IZJ A;  2ZAG A;  3EMM A;  2X8S A;  4HFO A;  1TXL A;  4XME A;  2YMS A;  5HTD A;  1HBQ A;  3WOV A;  3SZH A;  4EQA C;  5BYP A;  3CWK A;  1LIE A;  4U3Q A;  3X00 A;  4BGF A;  4BX7 A;  1VWH B;  1RBP A;  1RSU B;  3H3I A;  4U8U M;  5AJC A;  3RDM A;  2GTL O;  3VGW A;  3VG7 A;  2QO5 A;  1OEK A;  1YUP A;  4CPE A;  2Q2M A; 
#chains in the Genus database with same CATH homology
 4ZGU A;  2Q39 A;  1YP6 A;  3P02 A;  3OJY C;  4TQ2 A;  5DPQ A;  3KFH A;  1IFC A;  3DSZ A;  1MUP A;  1S2P A;  2HNX A;  1Z24 A;  2L5P A;  4IAX A;  1P6P A;  4GET A;  2GTL M;  4YCE A;  1YIV A;  1U17 A;  4O3W A;  1VYG A;  5FFH A;  2RQ0 A;  4A8Z A;  4IB7 A;  3EM0 A;  1BRQ A;  5LJG A;  3S5V A;  3HK1 A;  3GAQ A;  2JMB A;  4GK9 A;  5HCD C;  1EQD A;  4ZGF A;  5KHP A;  3VG4 A;  1Y9T A;  2QM9 A;  5AEO A;  2KT4 B;  4QGV A;  2AT5 X;  2FT9 A;  1X8Q A;  2P8G A;  4GZV A;  1LFO A;  1OBQ A;  4I9R A;  4KC7 A;  2W2A A;  3NX1 A;  1QY0 A;  3BX7 A;  1GT5 A;  2OVS A;  5LJB A;  1HQP A;  5H8T A;  4AZR A;  2WQ9 A;  1SY3 A;  4WFV A;  3FYF A;  3VPJ E;  2GTL N;  1EUO A;  4RUN A;  3ZUO A;  4KCA A;  3TGA A;  1A57 A;  5LKE A;  3WVM A;  5HZ8 A;  4ZCB A;  3P6F A;  3HWG A;  5EEE A;  1Y9L A;  3OD9 A;  2AKQ A;  4YBU A;  4YH0 A;  5D4A A;  2RCT A;  4AZQ A;  3HOL A;  1BJ7 A;  1HN2 A;  4ZHD A;  1KT3 A;  2G78 A;  1LKE A;  3FLL A;  2LBA A;  3EYC A;  4WHI A;  1QG5 A;  3CR6 A;  1ZNL A;  3RWX A;  1LPJ A;  1E06 A;  1PM1 X;  4O4U A;  1S7D A;  2HMB A;  5HZ6 A;  1YP7 A;  3ZQ3 A;  4M6S A;  5F6Z A;  4HPA A;  3N91 A;  4LKP A;  3WJF A;  3NQK A;  5L8N A;  2WWP A;  2LB6 A;  4NYQ A;  3D4R A;  5HCC C;  2LA7 A;  4QGX A;  4WFU A;  3D95 A;  4AZM A;  4AZN A;  3ELZ A;  2F73 A;  1CRB A;  4WBK A;  3BU1 A;  4IMO A;  1DZP A;  3KQ0 A;  3KFF A;  5LJC A;  1DZM A;  1FE3 A;  1KQW A;  2OFM X;  3F6Z B;  2A0A A;  1GXA A;  1HMT A;  4XMH A;  3UEW A;  3BRN A;  1GKA B;  4FGI B;  3ZZV A;  5EED A;  2R74 A;  2GJ5 A;  4AZP A;  1AB0 A;  1KT6 A;  2X8F A;  3GE2 A;  3EBW A;  1X89 A;  2AT3 X;  2ACP X;  1ADL A;  2NNE A;  4OMX A;  3KZA A;  1JIW I;  3AKN A;  2OZQ A;  3FW5 A;  4GDZ A;  2GTF X;  4TKH A;  5IO6 A;  1URE A;  3AKM A;  1HMS A;  3KFG A;  4GKC A;  2LKK A;  4QZU A;  4ZHC A;  3FEL A;  1D3S A;  2KD2 A;  5H9N A;  2AH7 X;  2FTB A;  1GKA A;  1ERB A;  2NND A;  1D2U A;  2CZU A;  1YWC A;  4IB6 A;  2M4L A;  4HWM A;  2WUT A;  3JS1 A;  1IFB A;  1PMP A;  5C0N A;  1YWB A;  2RD7 C;  3QKG A;  4XMC A;  2L9C A;  4INN A;  3FEK A;  5EPQ A;  3TZS A;  5H9L A;  1VPR A;  1SXX A;  3RKG A;  3F8A A;  3Q6L A;  2E4J A;  3VE1 A;  2X45 A;  1EAL A;  1SY0 A;  1SMP I;  3HOE A;  3SOT A;  1OBP A;  3WJG A;  4M7M A;  1E00 A;  5LJK A;  2ASN X;  2EU7 X;  3IFB A;  3PPT A;  4U8U O;  4ZJ0 A;  1QFV A;  4I3C A;  1B56 A;  2QMI A;  3P6D A;  5IO5 A;  2MM3 A;  5FQ7 E;  4TLJ A;  1RLB E;  4QAE A;  4IAW A;  1T68 X;  2OFR X;  3HWD A;  3ELX A;  1OEE A;  3E3C A;  1IIU A;  3ZW0 B;  5HZ9 A;  2LFO A;  3FR4 A;  5F1E A;  1TOU A;  5FQ8 E;  5D45 A;  2OVA A;  3BSZ E;  4PJ2 A;  5BVT A;  1KZW A;  3WXQ A;  2MO5 A;  4LQZ A;  4TJZ A;  2HYS A;  1AQB A;  4I9S A;  4O4O A;  4EDE A;  4TKB A;  5HZQ A;  2MJI A;  3K3L A;  1SXU A;  1X71 A;  1QAB E;  3P6H A;  4UU3 A;  4FQB B;  3APU A;  4N7D A;  4FBV A;  4Y0Q A;  3FMZ A;  3TGC A;  1IKJ A;  4GNW A;  4O49 A;  1DV9 A;  2L67 A;  5LJH A;  4Y0P A;  3ZW0 A;  1B8E A;  1JYD A;  4MVK A;  3STM X;  1GX9 A;  2K62 A;  3D97 A;  1A18 A;  4TNN A;  1IKE A;  2RA6 A;  1GM6 A;  4OS3 A;  4U8U N;  4YBP A;  5B27 A;  2GC9 A;  3STK A;  4ES7 A;  3PP6 A;  4ORU A;  1JBH A;  2AT8 X;  1OPA A;  4QGW A;  3BU9 A;  3FA8 A;  3ZI8 A;  2FR3 A;  1L6M A;  2WEX A;  3B2J A;  2Q4N A;  2O62 A;  2XKL A;  1QY2 A;  1T8V A;  1QFT A;  1LIF A;  2AT6 X;  3I0A A;  5D48 A;  3ZW1 B;  5EDC A;  2CM9 A;  4IB9 A;  1A3Y A;  1ERX A;  4AW8 A;  4KC8 A;  4ZH9 A;  4COT A;  3VU1 A;  2JW1 A;  3HTY A;  1CBI A;  1EIO A;  5D47 A;  2R73 A;  5BVQ A;  2JU8 A;  2QOS C;  5HTE A;  3D96 A;  1KOI A;  1BSY A;  1CBQ A;  4FBR A;  1HBP A;  4O9S A;  1KT4 A;  1DZK A;  4YFP A;  1DC9 A;  3B2I A;  1YWD A;  3JSQ A;  1IW2 A;  3ZW1 A;  1JZU A;  2IFB A;  1X8P A;  3CMP A;  3DTQ A;  3F9D A;  1OBU A;  2CM4 A;  5BVS A;  2A13 A;  1TW4 A;  3MVF A;  1EPA A;  1QY1 A;  5AJB A;  1B4M A;  2FR2 A;  3C77 X;  3NR3 A;  2AL0 X;  1ZRY A;  3O2Y A;  1E02 A;  3RSW A;  2G7B A;  4QYN A;  3U03 A;  1BSQ A;  3APX A;  1MX8 A;  1MDC A;  2MWH A;  5KIC A;  1ZNH A;  3HWE A;  2OVD A;  2QO4 A;  1O1U A;  3APV A;  3RBY A;  5FEN A;  3ZW2 A;  4ALB A;  3UEV A;  1T0V A;  4YMY A;  1GT1 A;  4R0B A;  1A2D A;  4A1Y A;  4ODD A;  5L8I A;  1H91 A;  3WJD A;  4IAB A;  3TF6 A;  4OMW A;  4I95 A;  4LZV A;  3CBC A;  4BOE A;  2BLG A;  1X8U A;  2FRS A;  1KGL A;  1GT4 A;  4EXZ A;  3NQ9 A;  5LKF A;  1OEJ A;  3BX8 A;  4QQ1 A;  2K23 A;  4RUU A;  2ACO A;  3NAD A;  2DM5 A;  4GNY A;  3UEX A;  4ZHG A;  5HZ5 A;  5HBS A;  4MVE A;  4PSQ A;  5HCE C;  2LBV A;  5LJE A;  1EPB A;  2POA A;  2A2U A;  4XMF A;  3VG6 A;  3G7X A;  1FTP A;  3P6C A;  1ZNK A;  3ZUI A;  3U0D A;  4DQ4 A;  1CJ5 A;  5KID A;  1MVG A;  1BRP A;  3NQ3 A;  5DG4 A;  3FEN A;  5HWZ A;  3O19 A;  2ANS A;  1NP1 A;  3RZY A;  3FA6 A;  3V8U A;  4UU2 A;  4NLI A;  1FEN A;  3FR5 A;  4LZU A;  4NW4 A;  1LID A;  1AEL A;  4YFQ A;  2WQA E;  1QWD A;  4O3Z A;  3S60 A;  1LIB A;  1I4U A;  1BLR A;  2BS6 A;  1KT7 A;  4D6A A;  1AVG I;  3JQO A;  1JJX A;  3B2L A;  2W2B A;  5HA0 A;  2Z4H A;  2WSJ A;  4KII A;  3FEP A;  1R0U A;  1DF3 A;  1FEL A;  3VE2 A;  3O22 A;  4ALO A;  1PBO A;  3FIQ A;  4KT5 A;  2N93 A;  4ID2 A;  3UEU A;  1XKI A;  4TKJ A;  2F09 A;  1KT5 A;  1DFV A;  3LHN A;  3PQU A;  1XCA A;  3UAQ A;  2NNQ A;  4AYH A;  4EFG A;  1ICN A;  2YG2 A;  1E5P A;  3PQS A;  1S44 A;  4IMN A;  4CSB A;  1EII A;  2W2F A;  3VG5 A;  4K19 A;  1GT3 A;  5EDB A;  1YWA A;  5F7G A;  4ML7 B;  4NYR A;  4BVM A;  4QZT A;  4MIS A;  3BDR A;  3WJE A;  2AMM X;  1ICM A;  4XMG A;  1DZJ A;  3APW A;  3FR2 A;  3LV4 A;  4YGZ A;  3PEC A;  2JU3 A;  4QNI A;  2FWV A;  4A60 A;  1BBP A;  2FLJ A;  1X8O A;  4CK4 A;  2BS5 A;  1SXY A;  3B2K A;  1G5W A;  3FW4 A;  4ARH A;  3VG3 A;  4ZFX A;  1NP4 A;  3PH6 A;  1BWY A;  3C76 X;  1CBS A;  1YUP A;  1U0X A;  3VG2 A;  3S26 A;  4ORR A;  5F6B A;  4MVL A;  4O3Y A;  4BQU A;  4AZO A;  2FS6 A;  1NGL A;  2XST A;  4HPD A;  1SY1 A;  4NP1 A;  2KW1 A;  4U9C A;  4KH8 A;  4YGH A;  3S5X A;  5EZ2 A;  2WR6 A;  1JV4 A;  4FBO A;  2Q9S A;  3CBS A;  2KTS A;  3T1D A;  2JN3 A;  4ORX A;  1G74 A;  1ALB A;  2RN4 A;  5IO7 A;  2HLV A;  3BY0 A;  4ZH6 A;  3PH5 A;  4YDB A;  4NNS A;  3HWF A;  3L4R A;  1JYJ A;  4O4S A;  4O3X B;  5F58 A;  2X46 A;  4D6B A;  1G85 A;  4I3D A;  4YKM A;  1TVQ A;  4YCH A;  1BSO A;  1OPB A;  4ZR2 A;  1TOW A;  2A3F X;  3FA9 A;  1QQS A;  3B2H A;  2Z4I A;  5H9A A;  5HA1 A;  1UZ2 X;  4A1H A;  4CV7 A;  3KFI A;  3I17 A;  1I06 A;  2ZAI A;  3PED A;  3CQR A;  1CBR A;  3NPO A;  1B0O A;  1LF7 A;  4L1N A;  4IB8 A;  2HZQ A;  4JGL A;  3NBX X;  1MX7 A;  3STN A;  3TGB A;  2HZR A;  1KXO A;  1GX8 A;  3SAO A;  1FEM A;  3U9P C;  4I3B A;  5HAE A;  5AQ6 A;  4ZHF A;  2OVE A;  4GU8 A;  4I6S A;  4LKT A;  4ORW A;  2A2G A;  2CBS A;  4YKO A;  4HPB A;  1ML7 A;  1SY2 A;  3IA8 A;  1O1V A;  2WEW A;  3P6E A;  1EI5 A;  1FDQ A;  4ORS A;  1BM5 A;  1SA8 A;  4ZHH A;  2BT9 A;  3MBT A;  2KTD A;  4Y0S A;  5L8O A;  5CE4 A;  2JU7 A;  2AT0 X;  5FAZ A;  4GH7 A;  5JR8 A;  1KZX A;  2ALL X;  3WJC A;  1VYF A;  1O8V A;  4O4X A;  2QO6 A;  3NP1 A;  3CQN A;  1ACD A;  3FA7 A;  5H9K A;  3OE3 A;  4HPC A;  5LJD A;  3WJB A;  5K06 A;  4YDA A;  5CYB A;  5D8J A;  4MIR A;  1I05 A;  1KQX A;  1N0S A;  3P6G A;  1X8N A;  4IBA A;  2MHD A;  1I04 A;  4GRJ A;  3MX7 A;  4N7C A;  4OS8 A;  2JOZ A;  5B29 A;  1G7N A;  2PY1 A;  3NX2 A;  4EEJ A;  5FQ6 E;  2RCQ A;  3BS2 A;  3WBG A;  2CBR A;  4ON1 A;  1SXW A;  3EBK A;  1LNM A;  1EW3 A;  2NP1 A;  2L68 A;  4Y0R A;  4GE1 A;  1LIC A;  1PEE A;  1HMR A;  4DQ3 A;  1ZND A;  2Q2P A;  3OBL A;  4YFR A;  1GGL A;  1EXS A;  4QRL A;  3ZWE A;  1ZNE A;  1ZNG A;  3P24 A;  1BEB A;  1U18 A;  4L3R A;  4XMD A;  4ORY A;  2G79 A;  4MVI A;  4NNT A;  4YGG A;  4QYP A;  2CZT A;  1JJJ A;  4NLJ A;  2X8T A;  3BLG A;  4OS0 A;  2FS7 A;  2R56 A;  3C78 X;  2ZAG A;  3EMM A;  2X8S A;  4HFO A;  1TXL A;  4XME A;  2YMS A;  5HTD A;  1HBQ A;  3WOV A;  4EQA C;  5BYP A;  3CWK A;  1LIE A;  4U3Q A;  1RBP A;  3H3I A;  4U8U M;  5AJC A;  2GTL O;  3VG7 A;  2QO5 A;  1OEK A;  2BHV A;  2Q2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...