5EQ8A

Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
258
Chain Sequence
QLNHFSDVANKAANAAGDVIRKYFRKNNFDLSPVTIADQSAEEAMVSVILDNFPSHAVYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGPLFGTLIALLQNGTPILGIIDQPVLKERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRVRDKVKIPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASPLSIATSFNVVAAGDKQIHQQALDSLQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Structural Studies of Medicago truncatula Histidinol Phosphate Phosphatase from Inositol Monophosphatase Superfamily Reveal Details of Penultimate Step of Histidine Biosynthesis in Plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Biosynthetic protein
total genus 82
structure length 258
sequence length 265
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eq8A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eq8A02
1NV6A 1IMDA 4FBPA 4GBVA 1EYIA 4N81A 2F3BA 3KC0A 4H45A 5A5LA 2DDKA 2CZHA 3KC1A 2FIEA 4O7IA 1FBDA 2FHYA 1FPDA 4IR8A 2WEFA 2OX3A 3KBZA 5DW8A 5ET5A 5EQ8A 4I3EA 5EYHA 1IMCA 1DBZA 4GWWA 5F24A 1FPGA 5EQ7A 1RDXA 3RPLA 1AWBA 4GWYA 2QVRA 3B8BA 5IZ3A 4HE1A 1CNQA 1NUWA 1XI6A 4MJOA 5ET7A 4I40A 1FRPA 1NUXA 1KA0A 1LBZA 4GX6A 1FSAA 1KA1A 5J16A 2BJIA 1EYJA 2FVZA 3BIGA 1LBWA 2WBBA 1FBPA 1Q9DA 1RDYA 2OWZA 4AS5A 1SPIA 4HXVA 1DK4A 4GX4A 1FPBA 5EQAA 1LEVA 2FIXA 1FBGA 2QVVA 5T3JA 1EYKA 2FBPA 4GWZA 5ESYA 2CZIA 2Y5LA 3A29A 1G0HA 5LDZA 1FPFA 4HE0A 1IMBA 1G0IA 5ET6A 1YYZA 5EYGA 5IZ3B 1JP4A 3IFCA 3RYDA 2GQ1A 1IMFA 1NV2A 1FJ9A 1IMAA 1NV1A 2F3DA 1KZ8A 2VT5A 4G61A 4GBWA 5ET8A 5IZ1A 3D1RA 1LBVA 2QFLA 2Y5KA 4GWUA 1FPJA 2HHMA 1VDWA 1FBEA 5I3SA 4PTKA 1NV3A 1DCUA 1FJ6A 1FPEA 1K9YA 4HE2A 1NV5A 2PCRA 3IFAA 3QMFA 4GWXA 3T0JA 3RPLB 1QGXA 1BK4A 3LUZA 1FBFA 1NUZA 4QXDA 5FBPA 4AS4A 2R8TA 1NI9A 1D9QA 3FBPA 4H46A 1NV0A 1FPKA 4GX3A 1FPLA 1K9ZA 2Q74A 5EQ9A 2JJKA 3BIHA 1RDZA 1NV7A 1LBXA 4KXPA 1YZ0A 4I3YA 1FBCA 4GWSA 1IMEA 2Q8MA 2WBDA 1YXIA 1FPIA 2P3VA 1NV4A 3ROJA 1FBHA 1NUYA 2CZKA 1FTAA 2QVUA 1INPA 1LBYA 2P3NA 3LV0A
chains in the Genus database with same CATH superfamily
2DQVA 2QL3A 4GBVA 3LBSA 4O7MA 5A5LA 2PFZA 3KC1A 2DWHA 1HSEA 3TCFA 3TMGA 5ET5A 1MQGA 4GWYA 1Y4CA 4FEDA 3FJMA 3B50A 1GVCA 3KG2A 2RC9A 2OWTA 1AOVA 4LONB 1B5HA 2Y7WA 4WXJA 1Q9DA 3FXRA 1B1HA 2OWZA 4HXVA 2ONRA 4I9DA 1SYHA 3LSWA 2ABHA 1LEVA 1LSTA 2GRVA 3PTYA 3TPAA 3EPEA 2Y7IA 1FQCA 1D3KA 3CHGA 3ONMA 3K1PA 5CMCA 3PPQA 4R73A 5IZ3B 4JXIA 1IMFA 4H1XA 3V8XB 2V3UA 4NWCA 4X1DA 3OSRA 1S50A 1ZJLA 5ET8A 3TUSA 2DE3A 4AQ4A 3O6IA 1UIUA 4DIGA 2V3QA 2HEUA 3Q29A 1MXUA 4R75A 3QMFA 1UTBA 4XKQA 2XX8A 4PFBA 1NUZA 2RKMA 1BKAA 4OZ9A 2NVUB 2OZZA 2OPDA 1FQDA 3IJOB 1PEBA 2QJEA 1Y3NA 1BP5A 3BFUA 4H8IA 1NV7A 3OMBA 3MZ9A 3K6WA 4XIGQ 1IIWA 2WYPA 4P47A 4MX6A 1B46A 3HO7A 4KPTA 5I57B 1OLAA 3IO6A 4KHZE 1MXZA 5CBSA 5KDTB 4PGNA 1F9BA 4IR8A 4U2RA 3V83A 5H8SA 3S9MC 2DOJA 3NOHA 4U1ZA 1MXXA 4O8MA 2ANJA 2I0CA 3QK6A 5FTIA 1EYJA 4R72A 4EXKA 5I7IA 4PCDA 4F31B 3TQLA 4PF6A 1MM6A 5TP9A 3CI8A 1ZTYA 1GR2A 4MFIA 2DYXA 3I3VA 4YB7A 5JTYB 3IOTA 2PMSA 2Q9TA 1FPFA 3G7WA 2Q89A 3PD8A 1VE4A 5AE4A 4OEUA 4FJPA 1BLFA 3C34A 4H6DA 4DI3D 1IMAA 3ILUB 1ZU0A 1QUIA 3ODBA 4ZEFA 2A5TA 3LR1A 2DXRA 5I3SA 1Y20A 2ZZWA 1FPEA 1PB7A 1D9VA 3VXBA 3IFAA 4BDLA 1NNTA 5H8QB 3OELA 1D9QA 4PFTA 3QYTA 3D4CA 1MY0A 3D4GA 1JW5A 3G3JA 5L8DA 4H0WA 3TZAA 3MYUA 4K3FA 4U23A 1P1QA 3FASA 3N6UA 3UGWA 1NUYA 5IM2A 4H67A 4FBPA 4UABA 1TT1A 2LAOA 1OIBA 4PAKA 3TDJA 4LZ5A 4O7IA 2PVUA 2V84A 2OX3A 1VSOA 3KN7A 3KOTA 4DE8A 3K6VA 4FAJA 3BKIB 4GXSB 2HXRA 4UACA 3W15C 2IEEA 4OHNA 3H4ZA 2O6AA 2I48A 1RYXA 3O9PA 3OSQA 4OWDA 4THIA 4OERA 5ICQA 1FBPA 5I59A 4FE8A 4IO7A 1O64A 2DWJA 3K1MA 4O3CA 5F7VA 4R2BA 3KSJA 5T3JA 1MDQA 4C1TA 5M2VA 3KZGA 3TCHA 4BDNA 3T96B 4JVDA 1ZKBA 5AA1A 1A54A 1ATGA 4GFRA 1MDP1 4YZZA 1MY4A 3G3IA 1H3DA 1LAGE 4R74A 3K02A 1LFGA 2OCUA 1SDXA 4MIJA 2HPGA 1N04A 3TQWA 3KFMA 4RJZA 3RPLB 3USDA 1NV0A 3HHFA 3MZ1A 2FNCA 3Q28A 3B6WA 1EH3A 3RT6B 4IY6A 1Z7NE 1NL5A 3IJXB 1UTHB 4IGTA 2VPNA 5DYHA 5IGAA 1B9JA 4O3BA 3LV0A 3ISPA 2RC7A 3OO7A 4WEDA 5FTHA 4ZECA 2H4IA 1FW0A 3EN3A 2WEFA 1DTGA 1QVSA 2PBWA 1D9YA 4LA9A 1JNFA 3VLWA 4HE1A 2KLFA 4KQPA 2XX9A 3RGYA 1LB8A 4IO2A 4P1LA 4GX6A 4RPOA 2O7UA 3W9VA 2PFYA 4F3SA 2XA5A 5TPAB 3HN0A 4X48A 1B05A 1FPBA 4PFYA 2F78A 4NF4A 2X26A 3CFXA 3MP1A 3UP9A 3VV5A 1MY1A 2NUVA 5EHMA 3PUVE 4XKRA 1JW4A 3TTLA 3IB2A 3SDFA 4F3PA 1ELJA 2XWOA 4E0WA 1LBVA 2Y5KA 3FD3A 5IZZA 1HSJA 1FQAA 4N4UA 4L17A 1IITA 4PTKA 1DCUA 5CBRA 5CMBA 4POWA 3FVNA 4ELPA 1XS5A 2ZNUA 5EQ9A 4HS7A 3DP8A 1L5TA 2XWVA 1YAEA 1YZ0A 4XEQA 1GV8A 2I0BA 1FBCA 1A7LA 3OO9A 1FPIA 2XXWA 1N84A 2Y84A 1D4NA 2DP8A 2QVUA 3H7MA 3SEVA 4OVSA 3PMXA 2QSXA 1NV6A 1IMDA 3H03A 3M3KA 4RY1A 2DDKA 3MVYA 3LC8A 4BDQA 5EYHA 5EQ8A 2UXAA 3RQTA 2YPNA 3DP6A 5EQ7A 1FTLA 1M5CA 3TYHA 2F5XA 4LQ2A 3TODA 1RYOA 4MNIA 3V5AA 2G93A 4NF5B 4OFOA 3T9UA 2VHAA 4IO5A 3TCGA 4JWXA 2DXYA 1LAXA 3VVDA 5AA4A 4AS5A 3KOSA 2KR0A 3LUYA 4P0GA 3CFLA 4OEVA 5AA2A 3EF7A 4KR5A 2Y7KA 3RUMA 4KCCA 4PGPA 3IR1A 5I84A 4ND9A 1B3HA 5DVIA 2Q8JA 5EYGA 1JP4A 3Q26A 1PDAA 2CEYA 1B7HA 2RCAA 4GLIA 3D1RA 3JYRA 3IAZA 4QSCA 1SI0A 1LLSA 2GFEA 4Z0IA 4H5FA 1OQHA 2ZYOA 4XF5A 2JJKA 1RDZA 4P8BA 3WAFA 4UA8A 2CZLA 3KJ7A 3T9HB 3GXAA 2QPQA 5H8HA 2D5WA 3B6QA 2CMOA 3QXMA 4QFLA 3OD7A 3PGFA 3PUZE 1FTJA 1EYIA 2F3BA 3RPWA 2FIEA 2B3BA 3ZS6A 3E4RA 1TFDA 2RINA 1CE2A 1FPGA 4F2OA 2ZXTA 2VOZA 4GL0A 5H8NA 2MKZA 1O7TA 1ZMGA 5ET7A 3HV1A 4ZEKA 1R9QA 1MY2A 1LBCA 1LBBA 1QKBA 4ZE8A 3C9HA 2F7BA 1IXCA 1DTZA 2ONSA 4R6YA 1POTA 1Q1KA 4MLQA 3A29A 1NNFA 4OTEA 1VFEA 3FUZA 1HSLA 3RYDA 3VVEA 1DPPA 4MNCA 1T0KA 1B3LA 1SQYA 4F29A 4I8CA 3K6XA 3OO6A 1MXWA 2P1SA 4N17A 3LUZA 4AS4A 1B51A 4GXAA 3PU5A 4FORA 3O66A 4OENA 5I58A 2GHBA 3PMVA 4F1VA 4OVTA 1GTKA 2F97A 3S9EA 2I3WA 2CEXA 3I6VA 1IMEA 2H99A 1US5A 4JSOA 4RXLA 2CZKA 1Y1MA 2Y7PA 2IA4A 3HFUA 3N6TA 1I6AA 4PFRA 2Q88A 4PDHA 1UTBB 4PE3A 1MQJA 4PAFA 4P9KA 1TXFA 3R26A 4I3EA 1A8EA 3VXCA 2QVRA 3MJNA 4R6KA 5A5XA 1M5BA 1DSNA 1ZBMA 4IB2A 1TFAA 4OA4A 1XI6A 3PPPA 4MJOA 4OXVA 3GBAA 2XXXA 1JVXA 4YKPA 3N26A 3OEKA 3F11A 3UN6A 4ESWA 2QVVA 1MS7A 1B5JA 3M8UA 1FTOA 5TU0A 1I69A 5CM6A 1POY1 5FHNA 2BJJX 4ECFA 3AXFA 4YAHX 4POXA 3CIJA 1FJ9A 4QFOA 4PDDA 2F7AA 4G61A 3C36A 3C4MA 3OXNA 1M5DA 4YB6A 2XXHA 1H45A 1XT8A 4HCWA 4F39A 5TP9B 5ICTA 4NTLA 4OETA 1MY3A 4U22A 3IOVA 3QAXA 1P1WA 3U94A 1NI9A 3MVXA 1ANFA 4N6KA 4AB5A 4MNPA 2NOOA 4JSDA 1R9LA 1LBXA 5CRYA 3RTFB 2F34A 3OENA 4MAGA 1CB6A 4QFPA 2A5TB 1RKMA 4ZZEA 1INPA 1MH3A 5JEIA 3PMWA 3O28A 4F1YA 5ITOA 1B7ZA 2DWIA 1XOCA 1URGA 5I2NA 5DT6A 1MQDA 5HBCA 4GL8A 3H6TA 3GZGA 3C33A 2OJTA 1QUKA 1Y4TA 3EHTA 3FZVA 3KBRA 3BBRA 2DSFA 1N7XA 4KYSA 3Q25A 1JQFA 4KCDA 5CC2A 4QFKA 4DCYA 3VVFA 1R6ZA 3M3LA 4ZEBA 1YTVA 4DZ1A 3E79A 2ZNTA 2PT1A 5BWJA 2H9BA 4PP0A 4HE0A 1QULA 5AA2D 3H06B 4XKPA 2QS3A 5ET6A 2O1LA 2E1SA 3A3CA 4X8RA 3IOWA 4G4PA 4P3LA 4GF8A 4JVCA 3ZKKA 2AIXA 5I59B 3FXQA 4OQOA 4HW8A 4EF2A 3PUXE 2AL4A 1FJ6A 3UIFA 2XXKA 3IB0A 1N7WA 3TELA 2V4CA 4QXDA 1FTKA 4TLMB 2HZKA 1WVJA 4RA1A 3RLFE 4I3YA 5KCJA 2ZNSA 1SBPA 2WBDA 4FEBA 4PBHA 4LQ5A 2OWSA 1DOTA 1NH8A 2QMWA 4BDMA 2UYFA 2DWAA 4OVQA 4BLAA 2Z8FA 2V93A 4DDDA 2F36A 3SEYA 1A55A 3B7DA 1DBZA 5BUUA 4RNSA 3RY3A 3RPLA 1IXIA 2A5SA 2B4LA 1FRPA 1NUXA 2QS4A 2XXVA 4NF6A 2ZYNA 3K0VA 4GWOA 2PT2A 3K00A 5EQAA 3U1OA 5K2YA 1LAHE 3ECRA 3MW0A 5I2KA 2CZIA 4Q5TA 2Y5LA 2O68A 3G3KA 1US4A 2XXUA 3ZSFA 3O2AA 1PBQA 1A99A 5IKBA 2ZZXA 1MM7A 4PQJA 4GBWA 4ONYA 2HCAA 4G8MA 1YPNA 3S2VA 3T9XB 1VDWA 4MCOA 4IO6A 4NF4B 5EYFA 1FQBA 2VPOA 2XX7A 4GIZA 4HE2A 3E78A 1QGXA 4N91A 1JW1A 3N94A 3EQ1A 1OVTA 2WX9A 4GX3A 4WEPA 1FPLA 1K9ZA 1S9TA 5EHSA 4N15A 3GBBA 4P11A 3VLVA 1B2HA 2F35A 3MP6A 4NF0A 2Q8MA 1UQWA 1NV4A 3MVWA 3PV0E 4I1DA 1R1NA 1FBHA 1B32A 3MWBA 3FVOA 4M1VA 4OMBA 1SW2A 3P7IA 2XWIA 2FHYA 3GLBA 5ISUA 3IB1A 3FJ7A 3PPRA 4WKMA 3U72A 1NNPA 4QSEA 3MP8A 1AL3A 2QS1A 4PFUA 1JVYA 4G68C 2O84X 5J16A 3K1NA 4YMAA 4LN5A 3QUJA 1RDYA 4KYEA 1B7UA 4BDRA 4QBAA 1SPIA 1H76A 2F6GA 4OFJA 4PF8A 2PYYA 2QMXA 2Y7RA 3TAJA 4ELRA 4ZEDA 3HCQA 5H8FA 2FIXA 1FBGA 1MPCA 4NQ8A 4IGRA 4XFEA 1FCKA 1N3WA 1ZIUA 3Q27A 4YKIA 3T1BA 4FECA 1YYZA 2GQ1A 3CG3A 3VE1B 3PUWE 2G29A 3SKPA 1FQFA 1ZLQA 3IK6B 4YB5A 5AA4B 2YLNA 3KEIA 4GWUA 3G3HA 4GD5A 3WAEA 3UA8A 3FGSA 4X1BA 2X7QA 5AA2B 4N07A 4Z7EA 4IO4A 5DEXA 1GGGA 2D21A 1IXHA 3FJGA 4XXUA 2HAUA 4DXBA 1BIYA 3C32A 1N76A 4EUOA 1IZ1A 2HFBA 4N13A 4N8YA 4ZS9A 1YXIA 3IL1B 4F3BA 3T9VA 2REGA 4X04A 3I5OA 1B3GA 1B1XA 2XXTA 4U21A 3DM0A 4G68A 2B3FA 1SW5A 4NAPA 2Q2AA 1AWBA 1IXGA 4QRZA 5I56A 4NF8A 4GOTA 2I4BA 3O97A 5H8HB 4OFLA 1LBZA 4NHBA 1FSAA 2BJIA 5ELVA 3BIGA 3R6UA 3C31A 1Z7ME 1EZPA 1DK4A 1AIVA 2XXRA 3DP4A 4P1EA 1QUJA 4GVOA 1IMBA 3LSLA 4NX1A 3IO4A 5H8NB 4N6DA 4ZE9A 1JEUA 1NV2A 2GH9A 2RCBA 4NWDA 1B3FA 1N0TA 4U4SA 1DPEA 4EDPA 2ZYKA 2HHMA 1MXYA 3UORA 2ONKE 5LOMA 4MMPA 2B4MA 1Y9UA 3KN3A 4GWXA 2DE2A 5FHMA 2I3VA 4XTCQ 3BFTA 1FPKA 3B6TA 2Q74A 4NGUA 3PUYE 2THIA 3MAMA 4KXPA 3KN8A 5CMMA 3DELB 3ILTB 3MC2A 4ESXA 3TTKA 3FV1A 4JWYA 1AH5A 2F6PA 3MZBA 4QFNA 1FTAA 1LBYA 1KWHA 4LVQA 2Z8EA 3JV9A 4YICA 4N81A 4RK2A 2VD2A 4DI4B 4BDOA 2WYKA 1LAFE 5I58B 5DW8A 4C1UA 5F24A 4QF9A 3CVGA 3IOUA 4M4GA 1UIVA 2RC8A 4H5GA 1B52A 5IZ3A 1CNQA 2XXQA 4I40A 1B0HA 3ZKLA 1NH7A 2Q2CA 4YMBA 4NN3A 4NMYA 3K4UA 4JBZA 4MF3A 4GX4A 2V25A 2HXWA 4R2FA 4OVPA 2O7IA 4NE4A 4QSDA 4JDFA 1P1OA 4AB6A 4PE5B 1NNKA 5A5XB 4OESA 4LP2B 4DXCA 1LCFA 1B40A 4F3GA 3MSTA 4C0RA 5I57A 4FATA 4O94A 2Z8DA 3S9NC 1BK4A 3U8QA 5KDTA 3KSXA 4JVIA 3O29A 4JWOA 1URSA 3DLNA 1B0LA 4MBPA 1M5FA 3CR9A 3VFJA 5L9MA 2OBGA 3PD9A 3TEPA 4NEDA 4ZDMA 4EQ9A 2ZYMA 4I62A 2O69A 5CI5A 4TLLB 1II5A 2H98A 3S9LC 3U92A 3U93A 4H45A 5DVJA 5HM4B 1FPDA 4R6HA 5JTYA 4PC9A 5JK4A 1VFDA 3VLUA 2VP1A 1OVBA 4N6PA 2NWJA 2QS2A 4F2QA 2UVHA 1B5IA 2HZLA 1SW4A 3TTMA 4NG7A 1LCTA 1S7YA 1B6HA 1LBWA 3TTNA 3G3FA 1PBPA 4ZZAA 3C35A 1XHYA 4U1OA 5F1QA 3FATA 1YCJA 4H65A 4ELOA 5I2NB 4TQUQ 5ESYA 3UK4A 2HAVA 5H8QA 1BTJA 2XXIA 3SETA 3O6GA 4LZ8A 1USYH 4F18A 4PFWA 1PC3A 2X7PA 1LFIA 1B4ZA 2YJPA 5DVFA 4OYVA 2VT5A 1FTMA 1NKXA 5IZ1A 1MPDA 4Q30B 4EQBA 2I58A 1SYIA 2QFLA 1P99A 2VD3A 1FPJA 3T22A 3A09A 2PX1A 1MQHA 1NV3A 1K9YA 2REJA 5J1DA 5FBPA 2XHDA 4LZ7A 3BIHA 4OVRA 4OANA 3H6VA 3SESA 4RPNA 4ZEIA 3OEMA 3FXUA 2P3VA 2H25A 3THIA 1I6BA 1A40A 1Q35A 1LB9A 3QUFA 2ZZVA 4PFIA 3L6GA 3CFZA 1QJMA 4YKKA 3KGCA 3EHSA 4QHQA 3EKIA 1IUDA 1LGBC 1QKAA 3N5LA 3MUQA 3OO8A 2HQ0A 1OMPA 3T66A 2XXPA 4E0XA 4G8HA 3K2DA 4ELQA 4Q0CA 3S4UA 5KCJB 2VGQA 3R7XA 2FVZA 3SEUA 2R6GE 4N8GA 4LATA 1JETA 4JB7A 5L9OA 1WODA 2FYIA 3W9WA 3SZPA 3MVZA 4GWZA 2NXOA 2H5YA 2QRYA 1G0HA 1SVXB 2UVGA 2D3IA 1MQIA 5HPQA 2Z23A 4PETA 4ISUA 3IFCA 5B70A 3RNNA 4KI0E 4PBQA 1URDA 2F3DA 3RN8A 1KZ8A 4NF6B 2R9JA 3CSBA 2AYSA 4XKNA 3HHGA 4DCXA 1UTHA 3M3FA 3H6UA 3SERA 2KQZA 3CG1A 4R9GA 5I2KB 3T0JA 2I6EA 2B65A 3FBPA 3A3UA 4GRKA 5L9SA 2AL5A 2OLBA 4RK9A 3FXBA 4FIMA 1JEVA 4MLVA 2FA7A 1J1NA 4EF1A 1AMFA 3FVKA 2RF1A 3SEWA 1FQEA 5K2XA 2R71A 1M5EA 2UVJA 3FVGA 4LUBA 4MHFA 2XXYA 1EU8A 5TPAA 3JZJA 4O3AA 5I5PA 1O63A 2ZMBA 3OOAA 2O51A 3KC0A 2CZHA 2DVCA 3MPKA 3RTWB 4EQ7A 3H6WA 1LFHA 3QSLA 1XVXA 1IMCA 1RDXA 2XD2A 1B58A 1XVYA 1SW1A 4HCYA 1OQGA 1OLCA 2E0SA 2DE4A 3H3GA 4G2ZA 3FV2A 4KD5A 4DLDA 2DVZA 1MG1A 3PPOA 1IEJA 2FBPA 4MEVA 5CMKA 4H8JA 3MBPA 5KZTA 3FIRA 4R9FA 1G0IA 3U65A 1Y3PA 2F8DA 1SD3A 1USYE 3IORA 1A8FA 1B3EA 4IY5A 4F1UA 1NV1A 2UVIA 1XC1A 2M8CA 4F22A 3CSGA 1MH4A 1FBEA 5H8FB 3HSTA 4G8NA 3MQ9A 3HPIA 1PB9A 5FHOA 3RT8A 3TTRA 4P0IA 5LTCA 5AA3A 3E3KA 2F7CA 3PPNA 1MPBA 3E13X 1B4HA 4NF5A 3ROJA 1QW0A 1TWYA 4KYDA 3K6UA 2I4CA 4EXLA 2P3NA 1P1NA 3G3GA 2XWKA 3TFLA 4G77A 5DEXB 1EZOA 1FBDA 4X9TA 3KBZA 4RYAA 4GWWA 4DXUA 1Y3QA 2UYEA 3B8BA 2ESNA 2XD3A 2P2AA 3E9XA 1NUWA 4GQOA 1NMUA 1KA0A 1KA1A 4YKJA 1H44A 2WBBA 1WDNA 3CRBA 5B7DA 1DMBA 2WKYA 1IQ7A 4U4XA 4F19A 3VDFA 3EHUA 1VR5A 2GHAA 2P0SA 1EYKA 2I49A 3TKDA 4G68B 1MXVA 2Z22A 1MRPA 5LDZA 3QIMA 5IAIA 3K01A 3GYYA 5I56B 1SI1A 1Y1ZA 3L6HA 4YU0A 4NF8B 3LSFB 2OPEA 2DS9A 3O6HA 4P56A 3MPLA 5DTBA 1EZ9A 2OK2A 2W7YA 4TOZA 4PAIA 2V3TA 5ITPA 1H43A 3SEXA 1NV5A 2PCRA 3LSXA 3KJTA 1FBFA 4Q8RA 2R8TA 4H46A 1P1UA 2O1MA 1N3XA 1NFTA 3IX1A 4HTGA 1I6QA 4IO3A 3V89B 4GWSA 1PB8A 2L5VA 2ALUA 4KFQA 4OVJA 3T93B 4MH5A
chains in the Genus database with same CATH topology
1NV6A 4OVQA 1IMDA 4GBVA 4O7MA 4H45A 5A5LA 2DDKA 2PFZA 3KC1A 1FPDA 4PC9A 5JK4A 5ET5A 5EYHA 5EQ8A 1DBZA 5EQ7A 3RPLA 4GWYA 2F5XA 2B4LA 3B50A 2HZLA 4MNIA 1FRPA 1NUXA 4NG7A 1LBWA 1Q9DA 2OWZA 4AS5A 4HXVA 2KR0A 5EQAA 1LEVA 3PTYA 5ESYA 2CZIA 2Y5LA 4PGPA 3CHGA 5EYGA 5IZ3B 1JP4A 4F18A 1IMFA 2CEYA 2ZZXA 2VT5A 4GBWA 5ET8A 5IZ1A 3D1RA 2DE3A 2QFLA 1FPJA 2V3QA 1VDWA 4MCOA 1NV3A 2VPOA 1K9YA 4HE2A 3QMFA 3E78A 4PFBA 1QGXA 5J1DA 5FBPA 1NUZA 4N91A 4XF5A 2WX9A 4GX3A 1FPLA 1K9ZA 2JJKA 3BIHA 4N15A 1RDZA 4OVRA 4P8BA 4OANA 1NV7A 4NF0A 2Q8MA 2P3VA 2QPQA 1NV4A 2WYPA 4P47A 4MX6A 1FBHA 2ZZVA 4PFIA 4M1VA 1EYIA 2F3BA 3EKIA 4PGNA 2FIEA 2XWIA 2FHYA 4IR8A 3NOHA 1FPGA 2MKZA 4O8MA 5ET7A 5J16A 1EYJA 2FVZA 4LN5A 4N8GA 1RDYA 4QBAA 5I7IA 1SPIA 4PCDA 4PF6A 3W9WA 4PF8A 3SZPA 2FIXA 1FBGA 4NQ8A 4GWZA 4XFEA 3A29A 2Q9TA 1G0HA 1FPFA 3T1BA 1YYZA 4PETA 3IFCA 3RYDA 2GQ1A 4MNCA 4PBQA 4DI3D 1IMAA 2F3DA 1KZ8A 4GWUA 5I3SA 2KQZA 2ZZWA 1FPEA 3T0JA 3IFAA 4N17A 3LUZA 4AS4A 1D9QA 3FBPA 4F1VA 4OVTA 3FXBA 4N8YA 2CEXA 1IMEA 1YXIA 3MYUA 4MHFA 1NUYA 2CZKA 5IM2A 3HFUA 5I5PA 4PFRA 4FBPA 4UABA 4X04A 4PDHA 4PAKA 3KC0A 4PE3A 2CZHA 4PAFA 4P9KA 4O7IA 2OX3A 4NAPA 4I3EA 1IMCA 1RDXA 1AWBA 2QVRA 2HXRA 4HCYA 4OA4A 1XI6A 4MJOA 1LBZA 4NHBA 1FSAA 2BJIA 2DE4A 3BIGA 1FBPA 2DVZA 1DK4A 2QVVA 5T3JA 2FBPA 4MEVA 4P1EA 5CM6A 1IMBA 4NX1A 1G0IA 3U65A 4N6DA 4JVDA 1NV2A 1FJ9A 4F1UA 4PDDA 1NV1A 4YZZA 4G61A 2HHMA 1FBEA 4MIJA 2HPGA 4HCWA 4MMPA 2B4MA 4GWXA 2DE2A 3RPLB 1NI9A 1NV0A 1FPKA 4N6KA 4MNPA 2Q74A 4NGUA 5LTCA 1LBXA 4KXPA 3ROJA 4MAGA 1FTAA 1INPA 2VPNA 1LBYA 5IGAA 2P3NA 2XWKA 3LV0A 3ISPA 4YICA 4N81A 4DI4B 1FBDA 2WYKA 2WEFA 4X9TA 3KBZA 5DW8A 4GWWA 5F24A 3B8BA 5IZ3A 4HE1A 1CNQA 1NUWA 4I40A 1KA0A 4P1LA 4GX6A 1KA1A 3W9VA 2PFYA 4NN3A 2WBBA 2XA5A 4GX4A 1FPBA 4F19A 3E79A 1EYKA 4OVPA 5LDZA 4HE0A 5ET6A 3GYYA 4X8RA 4P56A 4P3LA 2XWOA 1LBVA 2Y5KA 4JVCA 3MSTA 5IZZA 4N4UA 4O94A 4PAIA 4PTKA 1DCUA 1FJ6A 2XXKA 1NV5A 2PCRA 2V4CA 1BK4A 4QXDA 1FBFA 2R8TA 4H46A 4JVIA 2HZKA 5EQ9A 2XWVA 1YZ0A 4XEQA 4I3YA 1FBCA 4GWSA 4PBHA 2WBDA 1FPIA 2L5VA 2QVUA 4OVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV6 A;  1IMD A;  4FBP A;  4GBV A;  1EYI A;  4N81 A;  2F3B A;  3KC0 A;  4H45 A;  5A5L A;  2DDK A;  2CZH A;  3KC1 A;  2FIE A;  4O7I A;  1FBD A;  2FHY A;  1FPD A;  4IR8 A;  2WEF A;  2OX3 A;  3KBZ A;  5DW8 A;  5ET5 A;  5EQ8 A;  4I3E A;  5EYH A;  1IMC A;  1DBZ A;  4GWW A;  5F24 A;  1FPG A;  5EQ7 A;  1RDX A;  3RPL A;  1AWB A;  4GWY A;  2QVR A;  3B8B A;  5IZ3 A;  4HE1 A;  1CNQ A;  1NUW A;  1XI6 A;  4MJO A;  5ET7 A;  4I40 A;  1FRP A;  1NUX A;  1KA0 A;  1LBZ A;  4GX6 A;  1FSA A;  1KA1 A;  5J16 A;  2BJI A;  1EYJ A;  2FVZ A;  3BIG A;  1LBW A;  2WBB A;  1FBP A;  1Q9D A;  1RDY A;  2OWZ A;  4AS5 A;  1SPI A;  4HXV A;  1DK4 A;  4GX4 A;  1FPB A;  5EQA A;  1LEV A;  2FIX A;  1FBG A;  2QVV A;  5T3J A;  1EYK A;  2FBP A;  4GWZ A;  5ESY A;  2CZI A;  2Y5L A;  3A29 A;  1G0H A;  5LDZ A;  1FPF A;  4HE0 A;  1IMB A;  1G0I A;  5ET6 A;  1YYZ A;  5EYG A;  5IZ3 B;  1JP4 A;  3IFC A;  3RYD A;  2GQ1 A;  1IMF A;  1NV2 A;  1FJ9 A;  1IMA A;  1NV1 A;  2F3D A;  1KZ8 A;  2VT5 A;  4G61 A;  4GBW A;  5ET8 A;  5IZ1 A;  3D1R A;  1LBV A;  2QFL A;  2Y5K A;  4GWU A;  1FPJ A;  2HHM A;  1VDW A;  1FBE A;  5I3S A;  4PTK A;  1NV3 A;  1DCU A;  1FJ6 A;  1FPE A;  1K9Y A;  4HE2 A;  1NV5 A;  2PCR A;  3IFA A;  3QMF A;  4GWX A;  3T0J A;  3RPL B;  1QGX A;  1BK4 A;  3LUZ A;  1FBF A;  1NUZ A;  4QXD A;  5FBP A;  4AS4 A;  2R8T A;  1NI9 A;  1D9Q A;  3FBP A;  4H46 A;  1NV0 A;  1FPK A;  4GX3 A;  1FPL A;  1K9Z A;  2Q74 A;  5EQ9 A;  2JJK A;  3BIH A;  1RDZ A;  1NV7 A;  1LBX A;  4KXP A;  1YZ0 A;  4I3Y A;  1FBC A;  4GWS A;  1IME A;  2Q8M A;  2WBD A;  1YXI A;  1FPI A;  2P3V A;  1NV4 A;  3ROJ A;  1FBH A;  1NUY A;  2CZK A;  1FTA A;  2QVU A;  1INP A;  1LBY A;  2P3N A;  3LV0 A; 
#chains in the Genus database with same CATH topology
 2DQV A;  2QL3 A;  4GBV A;  3LBS A;  4O7M A;  5A5L A;  2PFZ A;  3KC1 A;  2DWH A;  1HSE A;  3TCF A;  3TMG A;  5ET5 A;  1MQG A;  4GWY A;  1Y4C A;  4FED A;  3FJM A;  3B50 A;  1GVC A;  3KG2 A;  2RC9 A;  2OWT A;  1AOV A;  4LON B;  1B5H A;  2Y7W A;  4WXJ A;  1Q9D A;  3FXR A;  1B1H A;  2OWZ A;  4HXV A;  2ONR A;  4I9D A;  1SYH A;  3LSW A;  2ABH A;  1LEV A;  1LST A;  2GRV A;  3PTY A;  3TPA A;  3EPE A;  2Y7I A;  1FQC A;  1D3K A;  3CHG A;  3ONM A;  3K1P A;  5CMC A;  3PPQ A;  4R73 A;  5IZ3 B;  4JXI A;  1IMF A;  4H1X A;  3V8X B;  2V3U A;  4NWC A;  4X1D A;  3OSR A;  1S50 A;  1ZJL A;  5ET8 A;  3TUS A;  2DE3 A;  4AQ4 A;  3O6I A;  1UIU A;  4DIG A;  2V3Q A;  2HEU A;  3Q29 A;  1MXU A;  4R75 A;  3QMF A;  1UTB A;  4XKQ A;  2XX8 A;  4PFB A;  1NUZ A;  2RKM A;  1BKA A;  4OZ9 A;  2NVU B;  2OZZ A;  2OPD A;  1FQD A;  3IJO B;  1PEB A;  2QJE A;  1Y3N A;  1BP5 A;  3BFU A;  4H8I A;  1NV7 A;  3OMB A;  3MZ9 A;  3K6W A;  4XIG Q;  1IIW A;  2WYP A;  4P47 A;  4MX6 A;  1B46 A;  3HO7 A;  4KPT A;  5I57 B;  1OLA A;  3IO6 A;  4KHZ E;  1MXZ A;  5CBS A;  5KDT B;  4PGN A;  1F9B A;  4IR8 A;  4U2R A;  3V83 A;  5H8S A;  3S9M C;  2DOJ A;  3NOH A;  4U1Z A;  1MXX A;  4O8M A;  2ANJ A;  2I0C A;  3QK6 A;  5FTI A;  1EYJ A;  4R72 A;  4EXK A;  5I7I A;  4PCD A;  4F31 B;  3TQL A;  4PF6 A;  1MM6 A;  5TP9 A;  3CI8 A;  1ZTY A;  1GR2 A;  4MFI A;  2DYX A;  3I3V A;  4YB7 A;  5JTY B;  3IOT A;  2PMS A;  2Q9T A;  1FPF A;  3G7W A;  2Q89 A;  3PD8 A;  1VE4 A;  5AE4 A;  4OEU A;  4FJP A;  1BLF A;  3C34 A;  4H6D A;  4DI3 D;  1IMA A;  3ILU B;  1ZU0 A;  1QUI A;  3ODB A;  4ZEF A;  2A5T A;  3LR1 A;  2DXR A;  5I3S A;  1Y20 A;  2ZZW A;  1FPE A;  1PB7 A;  1D9V A;  3VXB A;  3IFA A;  4BDL A;  1NNT A;  5H8Q B;  3OEL A;  1D9Q A;  4PFT A;  3QYT A;  3D4C A;  1MY0 A;  3D4G A;  1JW5 A;  3G3J A;  5L8D A;  4H0W A;  3TZA A;  3MYU A;  4K3F A;  4U23 A;  1P1Q A;  3FAS A;  3N6U A;  3UGW A;  1NUY A;  5IM2 A;  4H67 A;  4FBP A;  4UAB A;  1TT1 A;  2LAO A;  1OIB A;  4PAK A;  3TDJ A;  4LZ5 A;  4O7I A;  2PVU A;  2V84 A;  2OX3 A;  1VSO A;  3KN7 A;  3KOT A;  4DE8 A;  3K6V A;  4FAJ A;  3BKI B;  4GXS B;  2HXR A;  4UAC A;  3W15 C;  2IEE A;  4OHN A;  3H4Z A;  2O6A A;  2I48 A;  1RYX A;  3O9P A;  3OSQ A;  4OWD A;  4THI A;  4OER A;  5ICQ A;  1FBP A;  5I59 A;  4FE8 A;  4IO7 A;  1O64 A;  2DWJ A;  3K1M A;  4O3C A;  5F7V A;  4R2B A;  3KSJ A;  5T3J A;  1MDQ A;  4C1T A;  5M2V A;  3KZG A;  3TCH A;  4BDN A;  3T96 B;  4JVD A;  1ZKB A;  5AA1 A;  1A54 A;  1ATG A;  4GFR A;  1MDP 1;  4YZZ A;  1MY4 A;  3G3I A;  1H3D A;  1LAG E;  4R74 A;  3K02 A;  1LFG A;  2OCU A;  1SDX A;  4MIJ A;  2HPG A;  1N04 A;  3TQW A;  3KFM A;  4RJZ A;  3RPL B;  3USD A;  1NV0 A;  3HHF A;  3MZ1 A;  2FNC A;  3Q28 A;  3B6W A;  1EH3 A;  3RT6 B;  4IY6 A;  1Z7N E;  1NL5 A;  3IJX B;  1UTH B;  4IGT A;  2VPN A;  5DYH A;  5IGA A;  1B9J A;  4O3B A;  3LV0 A;  3ISP A;  2RC7 A;  3OO7 A;  4WED A;  5FTH A;  4ZEC A;  2H4I A;  1FW0 A;  3EN3 A;  2WEF A;  1DTG A;  1QVS A;  2PBW A;  1D9Y A;  4LA9 A;  1JNF A;  3VLW A;  4HE1 A;  2KLF A;  4KQP A;  2XX9 A;  3RGY A;  1LB8 A;  4IO2 A;  4P1L A;  4GX6 A;  4RPO A;  2O7U A;  3W9V A;  2PFY A;  4F3S A;  2XA5 A;  5TPA B;  3HN0 A;  4X48 A;  1B05 A;  1FPB A;  4PFY A;  2F78 A;  4NF4 A;  2X26 A;  3CFX A;  3MP1 A;  3UP9 A;  3VV5 A;  1MY1 A;  2NUV A;  5EHM A;  3PUV E;  4XKR A;  1JW4 A;  3TTL A;  3IB2 A;  3SDF A;  4F3P A;  1ELJ A;  2XWO A;  4E0W A;  1LBV A;  2Y5K A;  3FD3 A;  5IZZ A;  1HSJ A;  1FQA A;  4N4U A;  4L17 A;  1IIT A;  4PTK A;  1DCU A;  5CBR A;  5CMB A;  4POW A;  3FVN A;  4ELP A;  1XS5 A;  2ZNU A;  5EQ9 A;  4HS7 A;  3DP8 A;  1L5T A;  2XWV A;  1YAE A;  1YZ0 A;  4XEQ A;  1GV8 A;  2I0B A;  1FBC A;  1A7L A;  3OO9 A;  1FPI A;  2XXW A;  1N84 A;  2Y84 A;  1D4N A;  2DP8 A;  2QVU A;  3H7M A;  3SEV A;  4OVS A;  3PMX A;  2QSX A;  1NV6 A;  1IMD A;  3H03 A;  3M3K A;  4RY1 A;  2DDK A;  3MVY A;  3LC8 A;  4BDQ A;  5EYH A;  5EQ8 A;  2UXA A;  3RQT A;  2YPN A;  3DP6 A;  5EQ7 A;  1FTL A;  1M5C A;  3TYH A;  2F5X A;  4LQ2 A;  3TOD A;  1RYO A;  4MNI A;  3V5A A;  2G93 A;  4NF5 B;  4OFO A;  3T9U A;  2VHA A;  4IO5 A;  3TCG A;  4JWX A;  2DXY A;  1LAX A;  3VVD A;  5AA4 A;  4AS5 A;  3KOS A;  2KR0 A;  3LUY A;  4P0G A;  3CFL A;  4OEV A;  5AA2 A;  3EF7 A;  4KR5 A;  2Y7K A;  3RUM A;  4KCC A;  4PGP A;  3IR1 A;  5I84 A;  4ND9 A;  1B3H A;  5DVI A;  2Q8J A;  5EYG A;  1JP4 A;  3Q26 A;  1PDA A;  2CEY A;  1B7H A;  2RCA A;  4GLI A;  3D1R A;  3JYR A;  3IAZ A;  4QSC A;  1SI0 A;  1LLS A;  2GFE A;  4Z0I A;  4H5F A;  1OQH A;  2ZYO A;  4XF5 A;  2JJK A;  1RDZ A;  4P8B A;  3WAF A;  4UA8 A;  2CZL A;  3KJ7 A;  3T9H B;  3GXA A;  2QPQ A;  5H8H A;  2D5W A;  3B6Q A;  2CMO A;  3QXM A;  4QFL A;  3OD7 A;  3PGF A;  3PUZ E;  1FTJ A;  1EYI A;  2F3B A;  3RPW A;  2FIE A;  2B3B A;  3ZS6 A;  3E4R A;  1TFD A;  2RIN A;  1CE2 A;  1FPG A;  4F2O A;  2ZXT A;  2VOZ A;  4GL0 A;  5H8N A;  2MKZ A;  1O7T A;  1ZMG A;  5ET7 A;  3HV1 A;  4ZEK A;  1R9Q A;  1MY2 A;  1LBC A;  1LBB A;  1QKB A;  4ZE8 A;  3C9H A;  2F7B A;  1IXC A;  1DTZ A;  2ONS A;  4R6Y A;  1POT A;  1Q1K A;  4MLQ A;  3A29 A;  1NNF A;  4OTE A;  1VFE A;  3FUZ A;  1HSL A;  3RYD A;  3VVE A;  1DPP A;  4MNC A;  1T0K A;  1B3L A;  1SQY A;  4F29 A;  4I8C A;  3K6X A;  3OO6 A;  1MXW A;  2P1S A;  4N17 A;  3LUZ A;  4AS4 A;  1B51 A;  4GXA A;  3PU5 A;  4FOR A;  3O66 A;  4OEN A;  5I58 A;  2GHB A;  3PMV A;  4F1V A;  4OVT A;  1GTK A;  2F97 A;  3S9E A;  2I3W A;  2CEX A;  3I6V A;  1IME A;  2H99 A;  1US5 A;  4JSO A;  4RXL A;  2CZK A;  1Y1M A;  2Y7P A;  2IA4 A;  3HFU A;  3N6T A;  1I6A A;  4PFR A;  2Q88 A;  4PDH A;  1UTB B;  4PE3 A;  1MQJ A;  4PAF A;  4P9K A;  1TXF A;  3R26 A;  4I3E A;  1A8E A;  3VXC A;  2QVR A;  3MJN A;  4R6K A;  5A5X A;  1M5B A;  1DSN A;  1ZBM A;  4IB2 A;  1TFA A;  4OA4 A;  1XI6 A;  3PPP A;  4MJO A;  4OXV A;  3GBA A;  2XXX A;  1JVX A;  4YKP A;  3N26 A;  3OEK A;  3F11 A;  3UN6 A;  4ESW A;  2QVV A;  1MS7 A;  1B5J A;  3M8U A;  1FTO A;  5TU0 A;  1I69 A;  5CM6 A;  1POY 1;  5FHN A;  2BJJ X;  4ECF A;  3AXF A;  4YAH X;  4POX A;  3CIJ A;  1FJ9 A;  4QFO A;  4PDD A;  2F7A A;  4G61 A;  3C36 A;  3C4M A;  3OXN A;  1M5D A;  4YB6 A;  2XXH A;  1H45 A;  1XT8 A;  4HCW A;  4F39 A;  5TP9 B;  5ICT A;  4NTL A;  4OET A;  1MY3 A;  4U22 A;  3IOV A;  3QAX A;  1P1W A;  3U94 A;  1NI9 A;  3MVX A;  1ANF A;  4N6K A;  4AB5 A;  4MNP A;  2NOO A;  4JSD A;  1R9L A;  1LBX A;  5CRY A;  3RTF B;  2F34 A;  3OEN A;  4MAG A;  1CB6 A;  4QFP A;  2A5T B;  1RKM A;  4ZZE A;  1INP A;  1MH3 A;  5JEI A;  3PMW A;  3O28 A;  4F1Y A;  5ITO A;  1B7Z A;  2DWI A;  1XOC A;  1URG A;  5I2N A;  5DT6 A;  1MQD A;  5HBC A;  4GL8 A;  3H6T A;  3GZG A;  3C33 A;  2OJT A;  1QUK A;  1Y4T A;  3EHT A;  3FZV A;  3KBR A;  3BBR A;  2DSF A;  1N7X A;  4KYS A;  3Q25 A;  1JQF A;  4KCD A;  5CC2 A;  4QFK A;  4DCY A;  3VVF A;  1R6Z A;  3M3L A;  4ZEB A;  1YTV A;  4DZ1 A;  3E79 A;  2ZNT A;  2PT1 A;  5BWJ A;  2H9B A;  4PP0 A;  4HE0 A;  1QUL A;  5AA2 D;  3H06 B;  4XKP A;  2QS3 A;  5ET6 A;  2O1L A;  2E1S A;  3A3C A;  4X8R A;  3IOW A;  4G4P A;  4P3L A;  4GF8 A;  4JVC A;  3ZKK A;  2AIX A;  5I59 B;  3FXQ A;  4OQO A;  4HW8 A;  4EF2 A;  3PUX E;  2AL4 A;  1FJ6 A;  3UIF A;  2XXK A;  3IB0 A;  1N7W A;  3TEL A;  2V4C A;  4QXD A;  1FTK A;  4TLM B;  2HZK A;  1WVJ A;  4RA1 A;  3RLF E;  4I3Y A;  5KCJ A;  2ZNS A;  1SBP A;  2WBD A;  4FEB A;  4PBH A;  4LQ5 A;  2OWS A;  1DOT A;  1NH8 A;  2QMW A;  4BDM A;  2UYF A;  2DWA A;  4OVQ A;  4BLA A;  2Z8F A;  2V93 A;  4DDD A;  2F36 A;  3SEY A;  1A55 A;  3B7D A;  1DBZ A;  5BUU A;  4RNS A;  3RY3 A;  3RPL A;  1IXI A;  2A5S A;  2B4L A;  1FRP A;  1NUX A;  2QS4 A;  2XXV A;  4NF6 A;  2ZYN A;  3K0V A;  4GWO A;  2PT2 A;  3K00 A;  5EQA A;  3U1O A;  5K2Y A;  1LAH E;  3ECR A;  3MW0 A;  5I2K A;  2CZI A;  4Q5T A;  2Y5L A;  2O68 A;  3G3K A;  1US4 A;  2XXU A;  3ZSF A;  3O2A A;  1PBQ A;  1A99 A;  5IKB A;  2ZZX A;  1MM7 A;  4PQJ A;  4GBW A;  4ONY A;  2HCA A;  4G8M A;  1YPN A;  3S2V A;  3T9X B;  1VDW A;  4MCO A;  4IO6 A;  4NF4 B;  5EYF A;  1FQB A;  2VPO A;  2XX7 A;  4GIZ A;  4HE2 A;  3E78 A;  1QGX A;  4N91 A;  1JW1 A;  3N94 A;  3EQ1 A;  1OVT A;  2WX9 A;  4GX3 A;  4WEP A;  1FPL A;  1K9Z A;  1S9T A;  5EHS A;  4N15 A;  3GBB A;  4P11 A;  3VLV A;  1B2H A;  2F35 A;  3MP6 A;  4NF0 A;  2Q8M A;  1UQW A;  1NV4 A;  3MVW A;  3PV0 E;  4I1D A;  1R1N A;  1FBH A;  1B32 A;  3MWB A;  3FVO A;  4M1V A;  4OMB A;  1SW2 A;  3P7I A;  2XWI A;  2FHY A;  3GLB A;  5ISU A;  3IB1 A;  3FJ7 A;  3PPR A;  4WKM A;  3U72 A;  1NNP A;  4QSE A;  3MP8 A;  1AL3 A;  2QS1 A;  4PFU A;  1JVY A;  4G68 C;  2O84 X;  5J16 A;  3K1N A;  4YMA A;  4LN5 A;  3QUJ A;  1RDY A;  4KYE A;  1B7U A;  4BDR A;  4QBA A;  1SPI A;  1H76 A;  2F6G A;  4OFJ A;  4PF8 A;  2PYY A;  2QMX A;  2Y7R A;  3TAJ A;  4ELR A;  4ZED A;  3HCQ A;  5H8F A;  2FIX A;  1FBG A;  1MPC A;  4NQ8 A;  4IGR A;  4XFE A;  1FCK A;  1N3W A;  1ZIU A;  3Q27 A;  4YKI A;  3T1B A;  4FEC A;  1YYZ A;  2GQ1 A;  3CG3 A;  3VE1 B;  3PUW E;  2G29 A;  3SKP A;  1FQF A;  1ZLQ A;  3IK6 B;  4YB5 A;  5AA4 B;  2YLN A;  3KEI A;  4GWU A;  3G3H A;  4GD5 A;  3WAE A;  3UA8 A;  3FGS A;  4X1B A;  2X7Q A;  5AA2 B;  4N07 A;  4Z7E A;  4IO4 A;  5DEX A;  1GGG A;  2D21 A;  1IXH A;  3FJG A;  4XXU A;  2HAU A;  4DXB A;  1BIY A;  3C32 A;  1N76 A;  4EUO A;  1IZ1 A;  2HFB A;  4N13 A;  4N8Y A;  4ZS9 A;  1YXI A;  3IL1 B;  4F3B A;  3T9V A;  2REG A;  4X04 A;  3I5O A;  1B3G A;  1B1X A;  2XXT A;  4U21 A;  3DM0 A;  4G68 A;  2B3F A;  1SW5 A;  4NAP A;  2Q2A A;  1AWB A;  1IXG A;  4QRZ A;  5I56 A;  4NF8 A;  4GOT A;  2I4B A;  3O97 A;  5H8H B;  4OFL A;  1LBZ A;  4NHB A;  1FSA A;  2BJI A;  5ELV A;  3BIG A;  3R6U A;  3C31 A;  1Z7M E;  1EZP A;  1DK4 A;  1AIV A;  2XXR A;  3DP4 A;  4P1E A;  1QUJ A;  4GVO A;  1IMB A;  3LSL A;  4NX1 A;  3IO4 A;  5H8N B;  4N6D A;  4ZE9 A;  1JEU A;  1NV2 A;  2GH9 A;  2RCB A;  4NWD A;  1B3F A;  1N0T A;  4U4S A;  1DPE A;  4EDP A;  2ZYK A;  2HHM A;  1MXY A;  3UOR A;  2ONK E;  5LOM A;  4MMP A;  2B4M A;  1Y9U A;  3KN3 A;  4GWX A;  2DE2 A;  5FHM A;  2I3V A;  4XTC Q;  3BFT A;  1FPK A;  3B6T A;  2Q74 A;  4NGU A;  3PUY E;  2THI A;  3MAM A;  4KXP A;  3KN8 A;  5CMM A;  3DEL B;  3ILT B;  3MC2 A;  4ESX A;  3TTK A;  3FV1 A;  4JWY A;  1AH5 A;  2F6P A;  3MZB A;  4QFN A;  1FTA A;  1LBY A;  1KWH A;  4LVQ A;  2Z8E A;  3JV9 A;  4YIC A;  4N81 A;  4RK2 A;  2VD2 A;  4DI4 B;  4BDO A;  2WYK A;  1LAF E;  5I58 B;  5DW8 A;  4C1U A;  5F24 A;  4QF9 A;  3CVG A;  3IOU A;  4M4G A;  1UIV A;  2RC8 A;  4H5G A;  1B52 A;  5IZ3 A;  1CNQ A;  2XXQ A;  4I40 A;  1B0H A;  3ZKL A;  1NH7 A;  2Q2C A;  4YMB A;  4NN3 A;  4NMY A;  3K4U A;  4JBZ A;  4MF3 A;  4GX4 A;  2V25 A;  2HXW A;  4R2F A;  4OVP A;  2O7I A;  4NE4 A;  4QSD A;  4JDF A;  1P1O A;  4AB6 A;  4PE5 B;  1NNK A;  5A5X B;  4OES A;  4LP2 B;  4DXC A;  1LCF A;  1B40 A;  4F3G A;  3MST A;  4C0R A;  5I57 A;  4FAT A;  4O94 A;  2Z8D A;  3S9N C;  1BK4 A;  3U8Q A;  5KDT A;  3KSX A;  4JVI A;  3O29 A;  4JWO A;  1URS A;  3DLN A;  1B0L A;  4MBP A;  1M5F A;  3CR9 A;  3VFJ A;  5L9M A;  2OBG A;  3PD9 A;  3TEP A;  4NED A;  4ZDM A;  4EQ9 A;  2ZYM A;  4I62 A;  2O69 A;  5CI5 A;  4TLL B;  1II5 A;  2H98 A;  3S9L C;  3U92 A;  3U93 A;  4H45 A;  5DVJ A;  5HM4 B;  1FPD A;  4R6H A;  5JTY A;  4PC9 A;  5JK4 A;  1VFD A;  3VLU A;  2VP1 A;  1OVB A;  4N6P A;  2NWJ A;  2QS2 A;  4F2Q A;  2UVH A;  1B5I A;  2HZL A;  1SW4 A;  3TTM A;  4NG7 A;  1LCT A;  1S7Y A;  1B6H A;  1LBW A;  3TTN A;  3G3F A;  1PBP A;  4ZZA A;  3C35 A;  1XHY A;  4U1O A;  5F1Q A;  3FAT A;  1YCJ A;  4H65 A;  4ELO A;  5I2N B;  4TQU Q;  5ESY A;  3UK4 A;  2HAV A;  5H8Q A;  1BTJ A;  2XXI A;  3SET A;  3O6G A;  4LZ8 A;  1USY H;  4F18 A;  4PFW A;  1PC3 A;  2X7P A;  1LFI A;  1B4Z A;  2YJP A;  5DVF A;  4OYV A;  2VT5 A;  1FTM A;  1NKX A;  5IZ1 A;  1MPD A;  4Q30 B;  4EQB A;  2I58 A;  1SYI A;  2QFL A;  1P99 A;  2VD3 A;  1FPJ A;  3T22 A;  3A09 A;  2PX1 A;  1MQH A;  1NV3 A;  1K9Y A;  2REJ A;  5J1D A;  5FBP A;  2XHD A;  4LZ7 A;  3BIH A;  4OVR A;  4OAN A;  3H6V A;  3SES A;  4RPN A;  4ZEI A;  3OEM A;  3FXU A;  2P3V A;  2H25 A;  3THI A;  1I6B A;  1A40 A;  1Q35 A;  1LB9 A;  3QUF A;  2ZZV A;  4PFI A;  3L6G A;  3CFZ A;  1QJM A;  4YKK A;  3KGC A;  3EHS A;  4QHQ A;  3EKI A;  1IUD A;  1LGB C;  1QKA A;  3N5L A;  3MUQ A;  3OO8 A;  2HQ0 A;  1OMP A;  3T66 A;  2XXP A;  4E0X A;  4G8H A;  3K2D A;  4ELQ A;  4Q0C A;  3S4U A;  5KCJ B;  2VGQ A;  3R7X A;  2FVZ A;  3SEU A;  2R6G E;  4N8G A;  4LAT A;  1JET A;  4JB7 A;  5L9O A;  1WOD A;  2FYI A;  3W9W A;  3SZP A;  3MVZ A;  4GWZ A;  2NXO A;  2H5Y A;  2QRY A;  1G0H A;  1SVX B;  2UVG A;  2D3I A;  1MQI A;  5HPQ A;  2Z23 A;  4PET A;  4ISU A;  3IFC A;  5B70 A;  3RNN A;  4KI0 E;  4PBQ A;  1URD A;  2F3D A;  3RN8 A;  1KZ8 A;  4NF6 B;  2R9J A;  3CSB A;  2AYS A;  4XKN A;  3HHG A;  4DCX A;  1UTH A;  3M3F A;  3H6U A;  3SER A;  2KQZ A;  3CG1 A;  4R9G A;  5I2K B;  3T0J A;  2I6E A;  2B65 A;  3FBP A;  3A3U A;  4GRK A;  5L9S A;  2AL5 A;  2OLB A;  4RK9 A;  3FXB A;  4FIM A;  1JEV A;  4MLV A;  2FA7 A;  1J1N A;  4EF1 A;  1AMF A;  3FVK A;  2RF1 A;  3SEW A;  1FQE A;  5K2X A;  2R71 A;  1M5E A;  2UVJ A;  3FVG A;  4LUB A;  4MHF A;  2XXY A;  1EU8 A;  5TPA A;  3JZJ A;  4O3A A;  5I5P A;  1O63 A;  2ZMB A;  3OOA A;  2O51 A;  3KC0 A;  2CZH A;  2DVC A;  3MPK A;  3RTW B;  4EQ7 A;  3H6W A;  1LFH A;  3QSL A;  1XVX A;  1IMC A;  1RDX A;  2XD2 A;  1B58 A;  1XVY A;  1SW1 A;  4HCY A;  1OQG A;  1OLC A;  2E0S A;  2DE4 A;  3H3G A;  4G2Z A;  3FV2 A;  4KD5 A;  4DLD A;  2DVZ A;  1MG1 A;  3PPO A;  1IEJ A;  2FBP A;  4MEV A;  5CMK A;  4H8J A;  3MBP A;  5KZT A;  3FIR A;  4R9F A;  1G0I A;  3U65 A;  1Y3P A;  2F8D A;  1SD3 A;  1USY E;  3IOR A;  1A8F A;  1B3E A;  4IY5 A;  4F1U A;  1NV1 A;  2UVI A;  1XC1 A;  2M8C A;  4F22 A;  3CSG A;  1MH4 A;  1FBE A;  5H8F B;  3HST A;  4G8N A;  3MQ9 A;  3HPI A;  1PB9 A;  5FHO A;  3RT8 A;  3TTR A;  4P0I A;  5LTC A;  5AA3 A;  3E3K A;  2F7C A;  3PPN A;  1MPB A;  3E13 X;  1B4H A;  4NF5 A;  3ROJ A;  1QW0 A;  1TWY A;  4KYD A;  3K6U A;  2I4C A;  4EXL A;  2P3N A;  1P1N A;  3G3G A;  2XWK A;  3TFL A;  4G77 A;  5DEX B;  1EZO A;  1FBD A;  4X9T A;  3KBZ A;  4RYA A;  4GWW A;  4DXU A;  1Y3Q A;  2UYE A;  3B8B A;  2ESN A;  2XD3 A;  2P2A A;  3E9X A;  1NUW A;  4GQO A;  1NMU A;  1KA0 A;  1KA1 A;  4YKJ A;  1H44 A;  2WBB A;  1WDN A;  3CRB A;  5B7D A;  1DMB A;  2WKY A;  1IQ7 A;  4U4X A;  4F19 A;  3VDF A;  3EHU A;  1VR5 A;  2GHA A;  2P0S A;  1EYK A;  2I49 A;  3TKD A;  4G68 B;  1MXV A;  2Z22 A;  1MRP A;  5LDZ A;  3QIM A;  5IAI A;  3K01 A;  3GYY A;  5I56 B;  1SI1 A;  1Y1Z A;  3L6H A;  4YU0 A;  4NF8 B;  3LSF B;  2OPE A;  2DS9 A;  3O6H A;  4P56 A;  3MPL A;  5DTB A;  1EZ9 A;  2OK2 A;  2W7Y A;  4TOZ A;  4PAI A;  2V3T A;  5ITP A;  1H43 A;  3SEX A;  1NV5 A;  2PCR A;  3LSX A;  3KJT A;  1FBF A;  4Q8R A;  2R8T A;  4H46 A;  1P1U A;  2O1M A;  1N3X A;  1NFT A;  3IX1 A;  4HTG A;  1I6Q A;  4IO3 A;  3V89 B;  4GWS A;  1PB8 A;  2L5V A;  2ALU A;  4KFQ A;  4OVJ A;  3T93 B;  4MH5 A; 
#chains in the Genus database with same CATH homology
 1NV6 A;  4OVQ A;  1IMD A;  4GBV A;  4O7M A;  4H45 A;  5A5L A;  2DDK A;  2PFZ A;  3KC1 A;  1FPD A;  4PC9 A;  5JK4 A;  5ET5 A;  5EYH A;  5EQ8 A;  1DBZ A;  5EQ7 A;  3RPL A;  4GWY A;  2F5X A;  2B4L A;  3B50 A;  2HZL A;  4MNI A;  1FRP A;  1NUX A;  4NG7 A;  1LBW A;  1Q9D A;  2OWZ A;  4AS5 A;  4HXV A;  2KR0 A;  5EQA A;  1LEV A;  3PTY A;  5ESY A;  2CZI A;  2Y5L A;  4PGP A;  3CHG A;  5EYG A;  5IZ3 B;  1JP4 A;  4F18 A;  1IMF A;  2CEY A;  2ZZX A;  2VT5 A;  4GBW A;  5ET8 A;  5IZ1 A;  3D1R A;  2DE3 A;  2QFL A;  1FPJ A;  2V3Q A;  1VDW A;  4MCO A;  1NV3 A;  2VPO A;  1K9Y A;  4HE2 A;  3QMF A;  3E78 A;  4PFB A;  1QGX A;  5J1D A;  5FBP A;  1NUZ A;  4N91 A;  4XF5 A;  2WX9 A;  4GX3 A;  1FPL A;  1K9Z A;  2JJK A;  3BIH A;  4N15 A;  1RDZ A;  4OVR A;  4P8B A;  4OAN A;  1NV7 A;  4NF0 A;  2Q8M A;  2P3V A;  2QPQ A;  1NV4 A;  2WYP A;  4P47 A;  4MX6 A;  1FBH A;  2ZZV A;  4PFI A;  4M1V A;  1EYI A;  2F3B A;  3EKI A;  4PGN A;  2FIE A;  2XWI A;  2FHY A;  4IR8 A;  3NOH A;  1FPG A;  2MKZ A;  4O8M A;  5ET7 A;  5J16 A;  1EYJ A;  2FVZ A;  4LN5 A;  4N8G A;  1RDY A;  4QBA A;  5I7I A;  1SPI A;  4PCD A;  4PF6 A;  3W9W A;  4PF8 A;  3SZP A;  2FIX A;  1FBG A;  4NQ8 A;  4GWZ A;  4XFE A;  3A29 A;  2Q9T A;  1G0H A;  1FPF A;  3T1B A;  1YYZ A;  4PET A;  3IFC A;  3RYD A;  2GQ1 A;  4MNC A;  4PBQ A;  4DI3 D;  1IMA A;  2F3D A;  1KZ8 A;  4GWU A;  5I3S A;  2KQZ A;  2ZZW A;  1FPE A;  3T0J A;  3IFA A;  4N17 A;  3LUZ A;  4AS4 A;  1D9Q A;  3FBP A;  4F1V A;  4OVT A;  3FXB A;  4N8Y A;  2CEX A;  1IME A;  1YXI A;  3MYU A;  4MHF A;  1NUY A;  2CZK A;  5IM2 A;  3HFU A;  5I5P A;  4PFR A;  4FBP A;  4UAB A;  4X04 A;  4PDH A;  4PAK A;  3KC0 A;  4PE3 A;  2CZH A;  4PAF A;  4P9K A;  4O7I A;  2OX3 A;  4NAP A;  4I3E A;  1IMC A;  1RDX A;  1AWB A;  2QVR A;  2HXR A;  4HCY A;  4OA4 A;  1XI6 A;  4MJO A;  1LBZ A;  4NHB A;  1FSA A;  2BJI A;  2DE4 A;  3BIG A;  1FBP A;  2DVZ A;  1DK4 A;  2QVV A;  5T3J A;  2FBP A;  4MEV A;  4P1E A;  5CM6 A;  1IMB A;  4NX1 A;  1G0I A;  3U65 A;  4N6D A;  4JVD A;  1NV2 A;  1FJ9 A;  4F1U A;  4PDD A;  1NV1 A;  4YZZ A;  4G61 A;  2HHM A;  1FBE A;  4MIJ A;  2HPG A;  4HCW A;  4MMP A;  2B4M A;  4GWX A;  2DE2 A;  3RPL B;  1NI9 A;  1NV0 A;  1FPK A;  4N6K A;  4MNP A;  2Q74 A;  4NGU A;  5LTC A;  1LBX A;  4KXP A;  3ROJ A;  4MAG A;  1FTA A;  1INP A;  2VPN A;  1LBY A;  5IGA A;  2P3N A;  2XWK A;  3LV0 A;  3ISP A;  4YIC A;  4N81 A;  4DI4 B;  1FBD A;  2WYK A;  2WEF A;  4X9T A;  3KBZ A;  5DW8 A;  4GWW A;  5F24 A;  3B8B A;  5IZ3 A;  4HE1 A;  1CNQ A;  1NUW A;  4I40 A;  1KA0 A;  4P1L A;  4GX6 A;  1KA1 A;  3W9V A;  2PFY A;  4NN3 A;  2WBB A;  2XA5 A;  4GX4 A;  1FPB A;  4F19 A;  3E79 A;  1EYK A;  4OVP A;  5LDZ A;  4HE0 A;  5ET6 A;  3GYY A;  4X8R A;  4P56 A;  4P3L A;  2XWO A;  1LBV A;  2Y5K A;  4JVC A;  3MST A;  5IZZ A;  4N4U A;  4O94 A;  4PAI A;  4PTK A;  1DCU A;  1FJ6 A;  2XXK A;  1NV5 A;  2PCR A;  2V4C A;  1BK4 A;  4QXD A;  1FBF A;  2R8T A;  4H46 A;  4JVI A;  2HZK A;  5EQ9 A;  2XWV A;  1YZ0 A;  4XEQ A;  4I3Y A;  1FBC A;  4GWS A;  4PBH A;  2WBD A;  1FPI A;  2L5V A;  2QVU A;  4OVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...