The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
86
|
sequence length |
373
|
structure length |
319
|
Chain Sequence |
b'NCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTFAFVHVLQPTPELWTLSLPTQIVYTPDSSYIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVGHLFSFEFHHIRYEQALEEFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHIKEGDSNYKWKEVTKMEAEIKSHTSYLTFAFKVVNRSRDDEKVNE'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subu
|
molecule tags |
Transferase
|
source organism |
Saccharomyces cerevisiae (strain atcc 204508 / s288c)
|
publication title |
Crystal structure of the two-subunit tRNA m(1)A58 methyltransferase TRM6-TRM61 from Saccharomyces cerevisiae.
pubmed doi rcsb |
total genus |
86
|
structure length |
319
|
sequence length |
373
|
ec nomenclature |
ec
2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase. |
pdb deposition date | 2015-11-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF08704 | GCD14 | tRNA methyltransferase complex GCD14 subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Vcp-like ATPase; Chain A, domain 2 | Vcp-like ATPase; Chain A, domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |