5EQJB

Crystal structure of the two-subunit trna m1a58 methyltransferase from saccharomyces cerevisiae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
373
structure length
319
Chain Sequence
b'NCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTFAFVHVLQPTPELWTLSLPTQIVYTPDSSYIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVGHLFSFEFHHIRYEQALEEFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHIKEGDSNYKWKEVTKMEAEIKSHTSYLTFAFKVVNRSRDDEKVNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subu
publication title Crystal structure of the two-subunit tRNA m(1)A58 methyltransferase TRM6-TRM61 from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase
total genus 86
structure length 319
sequence length 373
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5eqjB01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5eqjB02
1F3LA 3UJ8A 5FTWA 2AOTA 3G2OA 4YUWA 1VP3A 3EVFA 4PINA 3U81A 3HVKA 3GXOA 2A14A 2G71A 1XCLA 4YUXA 4IV0A 2Z6QA 4LECA 2G1PA 3IYLW 3MCZA 2VDUE 5EKUA 3EPPA 2PT9A 5EZQA 3G2MA 3NTVA 1AV6A 2AS0A 2BM9A 4FGZA 3HCEA 5LQCA 3GJYA 2AOVA 1PJZA 2YVLA 1L3CA 2IP2A 3I64A 5FHQA 2NXJA 1VLMA 3DR5A 2IH5A 1KIAA 5HIIA 1JG3A 3I53A 5DM1A 4KW7A 5E8JA 5ICCA 3G8AA 2HR1A 1SQGA 4IV8A 4IWNA 5ICFA 1RI5A 5CVUA 1YUBA 4CTJA 1IXKA 3REOA 3DLIA 3UJ6A 1SVUA 3R24A 4CXMA 3KQVA 4GOMD 3RODA 4L7VA 2VDWA 1G6Q1 2VDVE 4HTFB 1XVAA 3BGIA 1ORIA 4P7FA 1EJ0A 2GB4A 1FP1D 3I5UA 5EOVA 3OFJA 4GQBA 3UZUA 1N2XA 3JWJA 5CCBA 2C7PA 4BP1A 5LQKA 3C6KA 3BUSA 5DSXA 3MQ2A 2XBMA 1RJFA 3E8SA 3HNRA 2IIPA 3M6UA 3L8DA 3NDJA 3DULA 4OBWA 5CM2Z 3M33A 5CVDA 2AOUB 2JHPA 1RI2A 3PLAE 3HCDA 1JTFA 3M4XA 2QYOA 3NVMB 3P8ZA 4CKBA 1O9HA 4DF3A 4YMGA 5K0CA 3LKZA 3TR6A 5F2OA 2YXEA 5K0NA 5LQUA 2I9KA 3BWYA 3C6MA 1KR5A 2XVMA 3CJRA 3E05A 4KDRA 5DX8A 1P1CA 3KHKA 4AX8A 2QM3A 4KWCA 2UYHA 4RTPA 4R6XA 2AN4A 2QRVA 5DRTA 3LDFA 1VIDA 4MIKA 4CTKA 4YV1A 2CKDA 3HVHA 2IBSA 3JWGA 3X0DA 4YUVA 3MTEA 1KYWA 4PYJA 1YZ3A 3LGAA 1NV9A 3PT9A 3TLJA 4C05A 4QTTB 5D1HA 1D2CA 4RVDA 5EHIA 5JR3A 4Y2HA 2OB2A 5HILA 4X41A 2PT6A 2ESRA 3FPHA 4KIGA 3WSTA 3GWZA 4XCXA 4DKJA 3EMBA 4DM3A 1N7JA 1YZHA 2YTZA 3CKKA 4MQ4A 3CC8A 2P7HA 3HA7A 4BP3A 3PTAA 3A7DA 4LG1A 1WY7A 2UYCA 3LX6A 1NW7A 2BM8A 4YV0A 3UFBA 3AJDA 1ZG3A 1KP9A 2O07A 3AXSA 3DXXA 4QPNA 2JG3A 2EFJA 3KQTA 4OQEA 3AXTA 5B1SA 3KQPA 2FYTA 3HM2A 2YX1A 1OR8A 5IKMA 5LSAA 1P91A 3G2PA 2ZZNA 3O31A 4F85A 4ER5A 4PYLA 2K4MA 2PWYA 1XDUA 2C7QA 2ZULA 2P40A 2PX5A 3UJBA 4HGZA 3GIWA 4HH4A 4PYQA 5MHTA 3OU2A 3EVCA 1INLA 5DLYA 2BR5A 3FYDA 4X61A 3BKWA 3DUWA 3P2EA 4X1OA 5HFJA 3G89A 3UBTA 2QE6A 2VP3A 4GOND 3GCZA 4PONA 3OE5A 4V0QA 2IH2A 1BC5A 3Q7EA 5HIJA 4GBED 3HCCA 4MTLA 4RTLA 5EMJA 4ER0A 5HOQA 2IPXA 2ONYA 3CBGA 3IV6A 3P9NA 3AY0A 1NW6A 3LSTA 4KIFA 2ZBQA 5GIPE 3NMUF 5P8WA 5LQRA 5EEGA 2ZWVA 3LKDA 9MHTA 1RI3A 5FCDA 1G8SA 3A25A 3T7SA 2JH8A 3LBYA 4PGGA 2ERCA 3ELUA 2OBFA 3ORHA 4EQZA 1ZGAA 3GRYA 5K05A 3MB5A 1JSXA 2AOUA 2NXCA 4KDCA 3TQSA 3R9XB 3BWCA 5EKXA 1R8YA 3HCAA 3LECA 4C06A 2AR0A 1M6EX 4PIPA 4U7PB 2CL5A 3QV2A 4MWZA 5E8RA 3TMAA 2NXEA 3EVEA 3P2KA 4FSXA 4WXHA 3VYWA 2Y1WA 3BWMA 2VZ9A 3NJRA 3KPWA 2CMHA 3IHTA 5M5BA 3F4KA 2AVDA 1XDSA 5DM2A 1KXZA 5DX0A 3DMFA 3R3HA 1I4WA 5K0FA 3M70A 2HWKA 1JQDA 3FRIA 1X1CA 2ONZA 3GO4A 3KPVA 4GC9A 1NW3A 1UIRA 2AN5A 4LWPA 5EPEA 5FADA 5T67A 3MHTA 1EQAA 3FTDA 4HC4A 3UJ7A 3UJCA 1RI1A 5LQAA 5GIOE 2AOXA 2YUIA 3SGLA 2PSSA 1NT2A 1O54A 1R8XA 3UJAA 5K8VA 3E23A 4P7KA 3TM4A 3SSOA 3BT7A 2V7EA 3P97A 3TPZA 3ELWA 3CJQA 4R6WA 4Y30A 5EGSA 4AZWA 1R6AA 3SM3A 2XVAA 2XYVA 4U7TB 4CKEA 2GH1A 2CMGA 2BR3A 3LCVB 1QZZA 2WA2A 3SSMA 4UOEA 2NP7A 5BW4A 2P3QA 2XYQA 5DRYA 3C3YA 5EHGA 3G8BA 5KS2A 2IBTA 5C9ZA 4RTOA 4DZRA 1U2ZA 2IFTA 4HRAA 1NKVA 2O0LA 3KR0A 4FSDA 5T6BA 1Q0SA 3QOXA 2N47A 2H11A 5K01A 4P7GA 2OXTA 3FTFA 3B3JA 3D2LA 4QQKA 4E33A 3HP7A 4IKPA 5K03A 7MHTA 2DPMA 3T7TA 1VE3A 3BZBA 4YMHA 1TW2A 3FRHA 2PVCA 3BXOA 2GA9A 3G7UA 3E7PA 2IGTA 3HEMA 3MTIA 5BP7A 2Z6AA 2FK7A 1UFKA 1PRYA 4RSRA 4E2WA 2PJDA 3CVOA 4PNEA 4H0NA 3T0IA 3MERA 3DXZA 4MHTA 4KRGA 5DTMA 3TFWA 2ZBRA 2C7OA 1X1BA 3FUWA 3PX2A 1P39A 2JHCA 3KKZA 1RJEA 5CIYA 4PIMA 2H1RA 4PYOA 4R05A 2CWWA 4RWZA 5CVJA 1NV8A 1ZHFA 1G55A 1VP9A 2ZCJA 4HGYA 4AZTA 5CVVA 1TPYA 3FUTA 3FYCA 3V97A 2P3OA 2PX2A 4QVKA 2V74B 2C7RA 1L3IA 5C1IA 3FUUA 5CD1A 4QDKA 5K0LA 1H1DA 1ZKDA 2G70A 2EG5A 5DT2A 4C07A 4PYKA 4ATNA 1KPIA 2AN3A 3B7PA 5DX1A 3UA4A 5E1OA 5K0JA 1X19A 4HSGA 3A4TA 2PX4A 4EMSA 1DCTA 2UYOA 4NECA 2UZ4A 3KR9A 2P1DA 2B78A 5IH3A 4YV2A 4GUAA 3OZSA 1EAMA 1G60A 3HVJA 3OU6A 3MGGA 3NDIA 4PYIA 3NW9A 3I58A 1SKMA 2P7IA 3T7RA 2ZZMA 3OE4A 4RTNA 1RJGA 4C4AA 4E2YA 1M6YA 2FRXA 2GPYA 3B5IA 5EVJA 2PXAA 2ZZKA 2PBFA 1QANA 1XXLA 1VBFA 2I62A 5FA8A 2ZVJA 3GNLA 5BW5A 2ZTHA 1WS6A 2NYUA 3O4FA 3QOWA 5E2AA 2PLWA 5FWAA 4QTUB 3NVKI 3R0QA 4K6MA 5K0GA 3H2BA 3OZTA 3B3GA 3KQOA 3M6WA 4XUCA 3IEIA 3UA3A 1JQ3A 2IDKA 3UJDA 3ME5A 1I9GA 10MHA 5BXYA 3SR4A 1SQFA 1BKYA 2P35A 2AOTB 3Q87B 5DTRA 5FWDA 3EVDA 2OYRA 3FTEA 2FK8A 2ORED 3P71T 4EKGA 2KW5A 2GAFA 1EJ6A 3EVZA 3HCBA 2Y1XA 3JWHA 4O29A 1AQJA 3BWBA 1SUSA 5FULA 4C08A 3ER8A 1R74A 2EX4A 3HA5A 4HTFA 1AF7A 1EG2A 3B89A 3ER9A 3FZGA 4P58A 2I6GA 1O9GA 2H00A 3CGGA 1WG8A 2PGXA 3KR2A 3P9IA 2I7CA 4FR0A 5KQSA 3HVIA 3ID6C 3KPJA 5DM0A 2P3LA 3EMDA 5JUWA 2BH2A 1FBNA 4M36A 3G5LA 2B25A 4KVZA 5E9QA 2HTEA 3KQYA 3LDUA 3FPJA 3PB3A 2NP6A 2FHPA 3CJTA 3DMHA 4HG2A 1G38A 5DTQA 1QAQA 4G56A 4RTMA 2O57A 4YUZA 2ZW9A 2PXXA 4PGHA 5EEHA 5KQRA 3ERCA 3B3FA 1IY9A 3DLCA 3EGEA 2R6ZA 3A26A 2ZSUA 4AZSA 3FPFA 2LD4A 4RTJA 3KR1A 4OA8A 2OZVA 1V39A 3PVCA 5F2NA 3P9CA 2HMYB 5FUBA 3KPUA 5F2KA 4GOOD 2E5WA 5FA5A 3EGIA 1QAMA 5FQNA 2ZLBA 3RW9A 3KPYA 1VL5A 2OB1A 3O7WA 5E9JA 3LCUA 5DWQA 2R3SA 3KQQA 4E31A 1NBHA 5EMMA 3GU3A 5U4XA 3TKAA 3DOUA 5K0BA 4A6DA 2PV0A 1ZQ9A 2P41A 3DXYA 1D2HA 5HEKA 2IH4A 1JTEA 3A27A 3PS9A 1NBIA 4RTSA 4E30A 3VSEA 4RVGA 4E2ZA 1DL5A 1ZGJA 4F84A 4FP9A 4B17A 2ADMA 1XJ5A 3BKXA 4R8RA 4RTQA 3GRRA 1VPTA 4CWAA 1YB2A 1DUSA 2NXNA 4DMGA 2PX8A 4ER3A 5D1NA 3HTXA 1QAOA 1R18A 3OFKA 2Q41A 2ZIEA 3EVAA 4OA5A 2G72A 1R00A 1KYZA 1JG1A 3C3PA 3K0BA 3OCJA 5K0EA 1IM8A 1B42A 5HZMA 2PXCA 5E2BA 2FPOA 3SXJA 1AQIA 1BHJA 3TKYA 3LCCA 2WA1A 3G5TA 5FQOA 3KQWA 4POOA 3EEYA 5KVAA 3MAGA 3AWIA 1SUIA 4PCAA 5C0OE 1FJXA 4XUEA 2UYQA 2OKCA 5GM2A 5EG5A 4QPPA 3FUVA 2YXDA 3DTNA 3THSA 1NW8A 1NW5A 1JR4A 4A6EA 3V8VA 4BLUA 4WVLA 4RTKA 3OZRA 3UWPA 1X1AA 2F8LA 5DXAA 3SSNA 3M6VA 5GINE 1XTPA 4DA4A 4BLWA 5E1MA 2AOWA 2AZTA 2HNKA 2OO3A 3BGDA 3EVGA 2YQZA 3MCTA 3PFHA 4OX9Y 4OBXA 5EIFA 2YXLA 2ZIGA 2ZIFA 2BR4A 4M37A 2Z6UA 3VC1A 2IDJA 4P7JA 5GOZA 3GRVA 4OQDA 4ER7A 3FPGA 5T64A 4QVGA 4E2XA 1F38A 1KPHA 4XUDA 3LDGA 3SMQA 3P2IA 5G02A 3DP7A 1L9KA 1MJFA 4FS8A 4JXJA 3EVBA 1JG4A 4FT4A 3TRKA 4E70A 5ICEA 1JG2A 1WZNA 5LQNA 2PY6A 1Z3CA 4FT2A 3TM5A 4M38A 4EK9A 5DXJA 1T43A 3ELYA 4AZVA 5LR6A 1XCJA 4PWYA 4GC5A 1G8AA 4DCGA 5EZSA 4GEKA 1I1NA 3FUXA 2B2CA 4EKIA 4PCLA 5DSTA 5EMKA 2O05A 1L1EA 3LPMA 2NNWB 4RV9A 2O06A 2G8NA 3DH0A 1MHTA 3SVZA 1FP2A 3FTCA 2OPBA 2PWPA 4X63A 4BY9E 3OPNA 1P1BA 3GGDA 4Z2YA 3EGVA 5DPMA 4C03A 1KPGA 4QDJA 1UWVA 1HNNA 2B9EA 3M6XA 3GDHA 2PKWA 4YUYA 3JWIA 5E9WA 3S68A 2GS9A 1RI4A 4R8SA 5FHRA 2AVNA 4M7RA 3SX0A 3VC2A 3THRA 1VQ1A 3KQMA 4LWOA 4ISCA 4ZTBA 2BZGA 4E32A 5LQJA 2EJUA 2JH9A 3G88A 2JJQA 4RVFA 3RIEA 1N7IA 3LHDA 1Q0TA 3CCFA 5EMLA 1HMYA 2ZWAA 5H02A 4PYNA 3OU7A 4DCMA 1NE2A 4GOLD 5GM1A 1KHHA 2OY0A 4PYMA 1D2GA 1WXWA 1YFLA 3K6RA 3LL7A 1M0EA 3NWBA 4V0RA 2P8JA 2EJTA 5HIKA 1L3BA 3DMGA 3PFGA 4C04A 3NWEA 2ZFUA 5DM4A 5ICGA 5KYGA 1X1DA 3HA3A 5HIMA 4CKCA 4X60A 5K09A 5GP1A 3I9FA 2DULA 4RYLA 5E1BA 3FPEA 3KQSA 2JHAA 2ZBPA 4RX1A 1BOOA 5E1DA 1YF3A 5ERGB 1ORHA 1XDZA 2HV9A 2VS1A 2YR0A 5GWXA 3A7EA 4GF5A 4RTRA 4DQ0A 1FPQA 3HCFA 1QYRA 3C0KA 3ANXA 4AUKA 4RVHA 3UJ9A 3EEOA 3P9KA 4F86A 3TOSA 1RJDA 2FCAA 4BLVA 2QRVB 1Y8CA 5CVEA 1TW3A 2XYRA 5EC8A 2B3TA 8MHTA 3KU1A 1WXXA 1JQEA 5EQJB 3LBFA 3PX3A 4EVIA 4QQNA 5CUQA 1JSZA 1EIZA 1SG9A 3ELDA 3G2QA 3GRZA 5EIWA 1YFJA 3BGVA 2GLUA 5CCXA 4FZVA 3R6TA 2QY6A 4ER6A 2WK1A 3GRUA
chains in the Genus database with same CATH superfamily
4ARZB 3AL2A 4FQ8A 4ZV7A 3HSSA 1RM4A 1UBSB 2E4VA 1ZK3A 2JD0A 2WF9A 3TDKA 2CV2A 1C9YA 4C9BA 2OUIA 1TZCA 1Z2AA 2YMQA 4UVGA 2AZMA 4G23A 4IJ5A 4OHOA 4TSFD 3SC3A 1EU1A 2EKLA 2C4TA 3VM6A 1MN6A 3WGLA 1IOLA 2C42A 3URMA 1Z5ZA 4RQTA 4RAQA 1F8FA 1XNHA 1D5CA 1GR0A 4EKEA 4EL5A 4PGFA 2ZYHA 5AK6A 3UFBA 2JG3A 3RYTC 5EHNA 4JXZA 3Q6NA 1U7TA 2XDAA 2WFLB 2H65A 4FWBA 4JX9A 3L6RA 4LRSB 4YT5A 1IN5A 1BTOA 1HXHA 2FJPA 2HSZA 4DL9A 1XRRA 3JATB 2ZYTX 2A57A 2F43A 3MELA 3COWA 1ECLA 1F8XA 4D8TA 1MIOB 4DSAA 4QT4A 3EQ6A 1QVZA 3VJKA 1N7GA 3MJRA 2VDVE 5DBEX 5EE5B 2IW1A 1LKZA 2ZSBA 2BTQA 1E0DA 3ZEIA 1T9CA 2FN3A 3WHLA 3HKBB 4FDLA 4L4ZA 3EFOB 3WB1A 4DCSA 2BMDA 1O95A 1QH0A 4X62B 3HXTA 4U1RA 1H6AA 4JB0A 3ZTWA 5CFLA 3L6DA 1W7AA 1SHTX 5JJ5A 1FMFA 1MX5A 4R9SA 4FFDA 1I7PA 1O6FA 1YGPA 1UBGA 3AR7A 2DPHA 1JJAA 2HJ9A 3GLHA 3C4JA 2XMPA 4J0HA 5ICMA 4OFWA 4OMCA 1QPZA 1V16B 4PO1A 4UVEA 4AN0A 1FZQA 1V96A 3PGXA 3SK0A 4BGVA 1K75A 1JHZA 3RUHA 4JHXA 3RQIA 3QVJA 3WFZA 3PQ3A 2PDAA 4UAGA 5T8KA 4X64B 2RHHA 3RVRA 2G67A 3JQ8B 1D0SA 1EFRA 3A58B 4F5ZA 1K88A 4MUGA 4MW0A 1T29A 1AGXA 3BJZA 1I6KA 2Z5LA 3IMFA 4R6XA 4RTPA 1CV2A 4X84A 2Z8ZA 2CL7X 3N9IA 2Q3BA 4AO7A 4Q01A 2WI8A 2NVWA 5H4GA 2ZT7A 4C05A 2FW1A 5A5EA 4ZV9A 4GHWA 4I4IA 4OB7A 4Y2HA 1BS2A 4EY7A 1FXWF 3D0QA 4FFMA 2BUAA 5TQ2B 2X6RA 4AF6A 2HQ1A 3EGXB 2PX0A 3D7NA 2H7XA 3PTAA 5GY7A 1NC1A 1OFGA 2F64A 5A02A 5KYKA 1WABA 4RY2A 4D9CA 3JVUA 1YU6A 4XI9A 1AT1A 2C94A 5KNBD 1SOWA 1LF0A 2BLNA 3CZ4A 3SJ7A 2IA5A 3AT1A 5DCYA 1UAGA 2CLDX 3HM2A 1SRRA 4E5DA 4FS3A 5K1ZA 3OOHA 3GEIA 5IAJA 5CEFA 1ZK4A 2BEWA 1TU0A 1JXAA 3JR3A 2OG1A 2CXHA 1BMDA 3CZMA 4LXYA 3RFTA 4XIYA 2B7LA 2MMGA 3CNOA 5LLTA 1GPAA 2ZPAA 4L4YA 2I3GA 3WLSA 4ZEVA 1KI3A 3EVCA 1PW7A 2IYNA 4P81A 4Y6QA 1GILA 2Q1CX 1R4NB 4TUYA 1L4LA 4TRJA 2H9AA 2XD4A 3ROZA 4BNGA 4HT3B 5EWMA 5GONA 2ZG6A 4ZMRA 4D0NA 1UBEA 3IBYA 4PWZA 5IWAB 3VSDA 4DR2B 3RADC 2Q49A 3HCCA 3CLVA 3QVVA 1C30A 2XUDA 4MTLA 4RO0A 1KK3A 4RTLA 1P1JA 4XSVA 2QMHA 4GNKA 4RY9A 1BQEA 1UINA 3FROA 3K53A 3UK7A 1PUXA 3BN3A 3RKUA 4Y6RA 5HUQA 2AC7A 3D6FA 5CFRA 3AG5A 3V4VB 3WL8A 2A5LA 3AKDA 4M87A 1ZFNA 5A6SA 1P1FA 1FJHA 4F1KA 5CTAA 5FNVF 5GVRA 4B7ZA 1QB7A 2OG2A 1ZEJA 3QBTA 3U31A 2JRCA 4M0FA 3JRWA 4F45A 3TQSA 3BXHA 1B0UA 5JMOA 5GZ6A 3LECA 3MTBA 4YRLA 5ILQA 3A9UA 5C8VA 5F23A 1U63A 1Z2NX 2ODPA 3ISTA 4KE8A 1Z73A 5K0ZA 4A2WA 3P2KA 3U3RA 3X43A 4PTZA 5C1OA 2H63A 1SOVA 2IHTA 5T4FA 3F4KA 5AOCA 5DM2A 1WUHS 1XTSA 1HG0A 1XZCA 2ZVDA 4XKJA 5DX0A 1WSAA 1YC2A 1HETA 1XPJA 1CWUA 3TEJA 1NN5A 1NYLA 3TQQA 3DE0X 4KTVE 1VHWA 4RPIA 3KJZA 1RI1A 4GP7A 3SGLA 2LW7A 1VXOA 4FFBB 3TOVA 3FOEC 1H4TA 2GM3A 5C52B 2ZRGA 5C2JB 4CEIB 1T10A 3ELWA 1K86A 1PZHA 4YJHB 5BMVF 3TD6A 1A5SB 1Y3FE 1IRXA 3K0AA 1R6AA 3L02A 3FWNA 3VPCA 1NR5A 3TG2A 3W9SA 4GI2A 5A1TA 3KS9A 3S5JA 4RK0A 1UADA 2H59A 2V6BA 4LZAA 2NMVA 4IKEA 1RTTA 2XNJA 3B9PA 4M9UA 2DXIA 4RESA 1G8FA 5DM60 4UDXX 2RGNC 2H11A 5JNVA 2NPIA 3AFNA 4TV8B 3ABZA 1UPTA 4JB8A 2V3CC 1UT5A 3COSA 1ESNA 1JHXA 4DC9A 4C5BA 1WHSA 3T7TA 3EUAA 4DLSA 3U9LA 3BFPA 4CETA 1TADA 5JVDB 1VHQA 2VUHB 2Z6AA 4R9RA 3INGA 2XYPA 5HJ5A 5JU6A 3UMVA 1LVGA 3IL2A 1NVVQ 2JKYA 3CLUC 2CXRA 1O9BA 4ZU6X 4LZPA 4DEXA 3DXZA 4WBNF 5JSHA 4LFBB 821PA 4ROSA 3ITKA 4P2BA 4RHXA 3EQ9A 4QWWA 3I28A 3ZCQA 3UPTA 2AE1A 3QKRA 4NCBA 1AO0A 1HLPA 1SH7A 2Y05A 1QYIA 3VBCA 1FQJA 1RIFA 1ZIOA 1EDOA 3KC2A 4PYOA 4PX2A 4R05A 5F12A 3LQRA 3G79A 3L77A 2HPAA 4ZQGA 4EG3A 2B36A 4BN4A 1KC1A 1TECE 1Z0AA 1PK8A 2R11A 3BK7A 1G6OA 4HNHA 4QTZA 1R6VA 1W93A 4MP8A 3QPVA 4J0EA 4Z9AA 4C07A 2Y1FA 1D6JA 3QU9A 3UWDA 1R4MA 3WG9A 2A0KA 5E1OA 5AW7A 3TL3A 2H7CA 3MAAC 4NARA 5MGNA 2X4GA 2XUZA 5GPBA 4LNUB 2W6ZA 4FCWA 1RSZA 4BZQA 4C0XA 1PJTA 4JGBA 4MKXA 1YE3A 1E0SA 1MENA 1TVEA 1V1MA 3NDIA 5FO1A 1TAUA 1UJNA 1E7SA 5H3HA 3DFKA 3DA8A 1W52X 4RZUA 4E6EA 5M2QA 5J40A 4GL2A 2ZI9A 1WU8A 5EXTA 4UTZA 2OCAA 1QZXA 1LBHA 3QKIA 2WTAA 4D80A 5IABA 4XWTA 3KJXA 1E5TA 4K6MA 1RZRD 1GG5A 4JGIA 1QVRA 2R1TB 1U28C 3OQ1A 4CMJA 3SIWA 5JS6A 3C48A 4R83A 4ZO6A 3KSDO 5AW2A 2N9UA 1GUYA 3DCNA 4K9DA 5KOIA 1JEJA 3CT4A 3E18A 4JBLA 1EWYA 4L5YA 3WXBA 3SLKA 5KYUA 4P5PA 5CU7A 1GSIA 3L79A 4AG5A 2ZYGA 4MI1A 1JBQA 2KQUA 2R97A 3J81A 4I14A 3DTVD 2KW5A 5C8YF 1V3QE 2OMEA 2VNHA 2XF8A 2JW5A 3BWBA 1YL5A 3WWEA 4E2FA 3KWLA 2JIBA 4KQJA 2ZB2A 3DD1A 1LPOA 2B8WA 2F48A 3HDTA 3UF0A 2HBRA 3ACBA 3WGGA 1AGRA 2QT0A 3I4LA 4M0PA 3BIWA 1LY1A 3QEJA 3DE2X 2OC4A 3FDJA 1PHPA 3Q40A 1N34B 2IS1A 4PAWA 4RA9A 4DQXA 5FEUA 3A28A 4K9OA 4ND2A 4ZWNA 2XV1A 3WIUA 5JH7B 2QZ9A 2WYHA 3D6VA 4FFNA 4G5OA 1Q20A 2ZT8A 1Z2EA 3JV7A 5E0OA 3V1TC 1E5XA 2GHIA 2HIHA 4Y2RA 1GA6A 3O1LA 3PNSA 4JBHA 4OO3A 1L1FA 3WLLA 2AC4A 5DTQA 2ZITA 2W2LD 5JAUA 2D7JA 3I2KA 4MUHA 1E60A 4WVFA 3RTAA 1UL1X 2EF1A 2VCYA 3NT2A 3OZFA 1U5AA 4PZPA 3EWAA 4D4KA 4PBSA 3F6YA 4WHMA 3OX2A 2JIPA 3HKDA 1D4ZA 2YIVX 1UMDB 1F9EA 3E53A 4UEWA 3H1TA 2MINB 2OZLB 4C6SA 4UDOA 3C16C 1PL0A 2PZ8A 3X1JA 4WSOA 3DP9A 3W0LB 4ZCTA 4QBIA 3EGIA 1HTTA 5D5HA 3S7TA 3V7UA 4R8MA 1CJBA 4MV4A 4FIBA 2OUKA 4YJDA 5BRJA 3E7WA 2GILA 3DBRA 4JBGA 3TD9A 1MAAA 1D4AA 4YRCA 2OO7A 2EWWA 4E31A 4KC0A 2LNDA 3N07A 5AO9A 1Y8RB 5BUSA 4YVFA 4W1SA 1KJ8A 4ZVRA 3WRXC 3QI7A 3T61A 3UFXB 1QVVA 4Q3NA 5KWEA 4AICA 2YFHA 5AIBA 4F4FA 1NG9A 3DQQA 4IIFA 4K8RB 4R1OA 4REQB 1J20A 1Q21A 2GCNA 4FP9A 1MO3A 4F9TA 1RZUA 3N8NA 2NQ2C 1JNXX 4XR9A 1V5IA 1NXWA 3A11A 4ZREA 1ELOA 5D1NA 5J2UB 3STHA 5DLEA 4B74A 2EHJA 4MW7A 1Z8HA 3HDHA 3K5HA 3LQQA 4QQRA 2G72A 4AJKA 5EAIA 4FFRA 1CNFA 1QH8A 4I1OA 1UMCB 3OF3A 4OAOA 3U56A 2XIJA 4IH9A 3WL7A 3WKBA 1KH3A 2OV4A 4E22A 2J30A 1QFJA 3HFSA 3CSDA 1YI8A 3U9SA 2W4MA 2O3SA 3N0WA 5KVAA 2VWGA 1Z8NA 2WVJA 3DO6A 1SUIA 3KE8A 4PCAA 4WBXC 3DHWC 1RQRA 2CNWD 4JQCA 5GM2A 2G9NA 3PQ7A 1CJSA 1NBME 2HT6A 1CQXA 3O3MB 1YK1A 3A32A 2G04A 4JP5A 4YGXB 5FDFA 3UHOA 3L7DA 3A36A 3KB2A 4HOYA 1L5QA 4M76B 2A0UA 3HI4A 1UBRS 4RHYA 3SD7A 2DR0A 4YRMA 3C70A 1S02A 5G53C 3EVGA 4DQLA 3CG0A 1J2TA 3K5IA 2V6FA 3QBEA 5LC1A 1G66A 1XTKA 1QUFA 2O1WA 4CBVA 2XQKA 1M9NA 3TRJA 4HN9A 3L7NA 2IDJA 2D1SA 5SZHB 4QPDA 1EP9A 4Q9LA 1W44A 5JMWA 4KO1S 3WWPA 2BD0A 1RYDA 2LDBA 5ALJA 3FPGA 1PX2A 3IKVA 5SV2A 1GOTA 3RYIA 1M73E 1PQ4A 3A6GA 3FI9A 3DP7A 3W2HA 5CW2A 2P6UA 1L8LA 2QLLA 1CDDA 2MYNA 1LUAA 2AFIB 2PY6A 2EAUA 4KWIA 3HY4A 1DU4A 1E4YA 4A0QA 4IHJF 3OKAA 4QOEA 2VHXA 1E0AA 3R3UA 4PG8A 3ELYA 1K0FA 1VPDA 2I2CA 1HA3A 1N5LA 1T0UA 1HWYA 1NLFA 2G9QA 3G68A 1YHYA 1M75A 2V9PA 2XSZD 4WACA 3A4LA 3LFTA 1AS2A 1IHUA 1YVEI 1P9OA 2EJVA 1CZ4A 3NOXA 3ZVLA 1V7CA 4JT2A 4JQZA 5REQA 2I1LA 1E8NA 3EXEB 2YV4A 3LVQE 1KBQA 1PLJA 1WR8A 4C0HA 3D0KA 4LHXA 3S40A 3DHYA 2RONA 5B1DA 2HW8A 4NOJA 1J2YA 3WNZA 2Z2ZA 4O6VA 2NLOA 1KPGA 1TB4A 1VJ0A 1YB4A 2HPHA 2WLTA 3CTMA 3UATA 4HJXA 4CQJA 1YHNA 2HRZA 1CK4A 5GMOA 1IBMB 1QHGA 1TU3A 5L4SA 4XJSA 2XB6A 3EXHA 1EFCA 1RI4A 1XDBA 3HJUA 1V48A 3O8BA 3PXXA 4FEYA 4MI3A 2XNHA 3FF1A 1UKVY 3THRA 4W1PA 2BZGA 5TDHA 1QHHB 1VJRA 2J07A 4HQFA 1ZK1A 3FZYA 2VDPB 1PS8A 1N2EA 2XKBA 5ARBA 1NRXA 2H2FA 3KDPA 4WZBA 2JLQA 3NKVA 4MPJA 3N3AC 2R8YA 4BNMA 1S2IA 4P80A 4BVBA 1C2TA 3G8DA 5HUHA 1U99A 1JSCA 4RK1A 1AE1A 4IQ8A 2LWIA 1B74A 1IEQA 4OAQA 3EVNA 5HJ2A 3QA3E 1JQJC 2Q6VA 4HS9A 4XDZA 1RRPA 1EK0A 2AHRA 2ZVPX 4I1UA 3WNBA 4C2BA 2FAXA 3MWJA 5AVOA 3F7NA 5HTOA 3AVYA 3RYHA 4EJ0A 2A9KA 2ODQA 5E1DA 5LDGA 2Q62A 4W5WA 4A2QA 2VS1A 1L8OA 3ICEA 4IO0A 1XYVA 2IQ5A 4BMZA 2GK6A 3VYTB 2NU8A 1VECA 2UXCB 4YRPA 1GGEA 4TYNA 3MYYA 4LBZA 1BA3A 1U8XX 4XB2A 4BMSA 2XUQA 4CMKA 3PXAA 2D8AA 4YB8A 3FYUC 2WT9A 1RBZA 4KSYA 1WXXA 4BZXA 5I7WA 1XZEA 4WEOA 2ORIA 3TXXA 3W5AA 3FVTA 5KPDA 3C7TA 1NL3A 2OP0A 3VHRA 5C1DA 5MN6A 2VCEA 4KN9S 3ANMA 1DBVO 2D2EA 4EYQA 4G1MB 1ZRMA 5AKLA 1QH1B 3GUVA 2P0YA 2EW1A 5FTWA 3PHHA 4MZXA 4V2UA 3WRVA 3SHQA 5KVSA 1IZ0A 3LCMA 2XEDA 4MMYB 3SFTA 1HMPA 2WKWA 2WSYB 2I2XB 1VPEA 2X77A 4NZ9A 3SFZA 3EPPA 3A6FA 1RRMA 4TVOA 3WA6A 3NTVA 1SCAA 3DAYA 2W37A 4JWTA 4LHZA 4DLTA 5C8DA 4Z53A 1UT6A 1YDEA 2QRNA 4ZQIA 4PS1A 1GZDA 4XX1A 2YVLA 1NLUA 4P36A 1GGVA 1KIAA 5DW3A 3R76A 3NRCA 3TRFA 3KO8A 4E46A 5JAZA 4P93A 3AILA 2QG4A 3EA4A 2VH1A 3OQMA 2JGJA 3QVSA 3UOWA 2QNRA 4GECA 1SVUA 4QFCA 3D8TA 3HI6A 1NWHA 4Q9NA 1Q5PA 2AFHB 2CVZA 3KCNA 4H2DA 5CPBA 3L9WA 5AJHA 2Y1GA 1R66A 1YZLA 1ZU5A 4I4LA 4U7JA 1BA2A 1MGOA 2WV7A 2ZOSA 3OFJA 1CQZA 1T26A 1PYDA 2RH5A 2QTHA 4A82A 3QP9A 3UMMA 3E8SA 1KZ7B 5KO2A 4Z9FA 3K6JA 1U5BB 1W49A 4F2WA 4DB2A 4CVNA 3QG1A 4TWJA 3B7WA 1AXRA 1HL7A 3OUZA 1EP1B 1RPNA 4GMGA 5G2OA 2H7VA 5JWOA 2I9KA 4LJLA 3GCXA 2IXTA 4RKFA 4D3DA 2DY1A 3HXOA 1AN0A 1KEPA 2XVMA 3NHKA 3QC8A 2J3JA 1YQGA 1N8TA 1Z8FA 3JYPA 3KKNA 3ADKA 1IBCA 3BD9A 3KT6A 4D81A 1QHXA 2BP7A 1BJKA 2L69A 2X14A 3MJSA 4F93B 4WBSA 3T7CA 4DY6A 3PTLA 3AR4A 1WZEA 1YCFA 3MTEA 4HLQB 4MWTA 2B92A 4GI3A 1MX9A 2F1OA 2NYRA 1N5MA 4O4IF 4LC0A 1UC5B 2O8NA 3GWZA 1E59A 4H1VA 4INPA 4X65B 3U6KA 4B3SB 1CP2A 4AS3A 3DWGA 5JSYA 3CEPB 3R7BA 4FEGA 3I9MA 4IR7A 3GB9A 3WNQA 2UYCA 2A78A 4H1WA 2B3DA 1IBSA 3JQGA 1TI7A 3H13A 5AW4A 1RIIA 3NQ41 5AI4A 5THQA 4B7UA 4IXTA 5B1SA 3T34A 4DA8A 4D9MA 2YX1A 2RHOA 3OCVA 5AFSA 1TMYA 2IX9A 2R86A 1SBTA 3H3FA 4MS3B 4TLLB 4DJFC 2PPVA 3U4GA 3PCRB 2KE5A 3ZVRA 5ELMA 2IJGX 5JTTA 3A9CA 3T1VA 4ZC8A 4B9EA 5IG2A 3AETA 1CUFA 3O2JA 4HH4A 1V0JA 4HN4B 2PG3A 5MHTA 1ZDMA 4QICA 5K5EA 2R96A 1Z7WA 3ML1A 5IN5A 5DN6D 3THXB 2QE6A 4UPDA 3DEZA 2BMVA 2FZGA 3I83A 4MV5A 3WHIA 3VO9A 3ESCA 4G0UA 5FD8A 3BFKA 3Q7EA 1NVBA 1QYDA 1YQDA 3BEDA 1GG2A 1NOIA 1KERA 2QN9A 5E6SA 4II7A 5EUBA 3VOTA 3MOGA 3ZXIA 1AMNA 3UBTA 2VYQA 3C39A 3QLEA 3N2LA 2YNMD 5J47A 4PG6A 1Y6ZA 2PMCA 3NIBA 3OIYA 5GVSA 4ANFA 4H3SA 1XP5A 3NHJA 1ZVJA 3A25A 4Q1DA 2W6ID 3FPLA 4YQYA 5EQFA 3W8EA 3ZZ1A 3WDLA 2GEBA 3HKEB 3UOGA 4ZYXA 3ZTTA 4CI9A 5DHTA 2XBLA 3T0FA 4NULA 1N32B 3E82A 4G8DA 5CT8A 5DZSA 5HKAA 3KOYA 3ED1A 2JZOA 1NVFA 2ZCUA 1MOPA 2FE4A 3Q7PA 4NKRA 5K2MA 3HYCA 4I55F 4WXHA 2PANA 3FSRA 4MV6A 1NUTA 4QEZA 4BHTA 2VPIA 2WJIA 1K5HA 2B61A 4Q7KA 2FFQA 2RCYA 1ZOIA 4GVPA 4N5HX 3TUJC 4PZ9A 1OE0A 3DBHB 1ZS9A 2V8OA 4Y6GB 4U2KA 1FEZA 1LC0A 1GRNA 3E22A 3GUYA 3KEOA 1CD5A 2AN5A 3GYBA 3VU1A 3MHTA 4GD3Q 1I2CA 5ALQA 1ZK0A 2KWIA 4QBTA 1UDCA 3DO5A 4BBJA 3VVLA 4LJAA 2XGJA 4KXMA 4MQMA 2GZ2A 1SIBE 1EXMA 1RQLA 1YT5A 5B1YA 5DEOA 4TT8A 1G41A 5HF9A 4D6XA 4Y30A 5JAIA 3LKBA 1N1MA 3LPNA 1ZGHA 1UP4A 5CEJA 3GH3A 3KCQA 3SSMA 3WGKA 3BJIC 4HWTA 3LV8A 3ZDRA 4IW3B 3ASUA 2A3RA 2RARA 2NP7A 3N6RA 1U5CA 2GAIA 1BFDA 2VNSA 2PGJA 5AXBA 5C46F 4RIGA 5EINA 3VZCA 4EHFA 1S1MA 3RSCA 3BZUA 3CNNA 3K9WA 3B3JA 4DCUA 1U8YA 1H2EA 1U7PA 1NXQA 4C0KA 3RVSA 4WESB 4YMUA 3MFYA 2Q6IA 4HI0E 3BB1A 4QU0A 1J8DA 1FYXA 4TSRA 3S2IA 1Y3HA 2CXUA 1PRYA 1JDJA 3CEHA 2KX7A 3FVVA 2RGUA 3K6KA 4KLZA 4RSRA 3LUGA 3WYNA 1Z63A 2D1YA 3PUZA 2WF6A 2MTBA 3BQMB 13PKA 5D01A 5KHLB 3TR0A 2PH3A 2CJPA 1KYVA 2UV8A 3TNJA 1JH9A 3CU5A 2ZRNA 3CINA 3EDMA 3MAJA 5HE9A 1ZHOA 1W5FA 2XUKA 2VIIA 3W04A 4WLOA 3HK2A 1W76A 2GNOA 5CVVA 3D8UA 3QXXA 2G4CA 3DFFA 1B0PA 4FEEA 2R7LA 3CLTD 3DV9A 3FBGA 4PQFA 3RHZA 2IVZA 5BV2P 2PRJA 1FNMA 2BONA 4TMZA 1ZKDA 5AVRA 5ALZA 5DYWA 1AO3A 1QDUA 1RYBA 3Q15C 3TD2A 5IEJA 1J33A 1E5DA 3MTQA 1RRKA 3IP3A 3P0EA 4Z7QB 3OMXA 4ZCRA 3KR9A 2VQSA 2B78A 5IH3A 3SZRA 4YV2A 2WQ6A 2AL7A 1Y98A 4YYEA 2ZRDA 4XQEA 2ZYRA 3Q3HA 1MEJA 2NOAA 4BQIA 4PPFA 3GLGE 1EXNA 3A6HA 3OP4A 4Y2YA 3HH8A 2ZZMA 1FUUA 2PD6A 4YO8A 5AHRA 1CY8A 2RGWA 1K4YA 3N2EA 2QSZA 4A0GA 5BQFA 1WRBA 2J3KA 2O8CA 9ABPA 2ZVJA 1W5BA 4NJEB 2ZTHA 1CZLA 1R6DA 1WS6A 3WSVA 1JIQA 5C1PA 3B8EA 3VOBA 2NO0A 1OKKD 1Z45A 1G4UR 2D5IA 4O3FA 2P1RA 4H1UA 2O3TA 2DBRA 2RKBA 3ETGA 4UNQA 3ASZA 3U0VA 1GQYA 3MJCA 2F67A 2HCJB 4B7AA 2OK8A 2A1UB 1JDBB 1XEWY 5I01A 3FTEA 4EPTA 3O92A 4G37A 1J0CA 2FPMA 5KREA 4Z3DA 5EL0A 3TNLA 4FZRA 1RKBA 5D7BA 1D7AA 1TAHA 5G40A 4NZYA 4R1NA 4D2IA 3EWSA 2VNIA 5K3BA 2OHOA 3F97A 3O9MA 3E9NA 2AEEA 4EO7A 1KMHB 1M33A 1VC2A 3D4LA 4ZYVA 1OJ7A 2H1SA 1B41A 3FX2A 1NMQA 4BNFA 1E92A 1G6KA 5LBUA 3ZGVA 1T91A 1B0ZA 4R81A 2NUBA 1CFZA 2JJ2A 3S99A 5G1PA 1BIFA 3VKFA 3U3ZA 2CL0X 2Q6LA 3H86A 3PB3A 5F21A 3CJTA 1F2TB 2DPLA 1B16A 1Z56C 4H6PA 4HSEA 1VLQA 4N0PA 5KQLA 1WW8A 1IY9A 5BN3B 1HYEA 3LF1A 2R4TA 3GGGA 5AVZA 1O94C 1FP4A 3U4MA 4LV6A 4B3GA 2BDTA 4LOHA 4LZOA 4PX9A 3R7AA 4BNKA 3F9RA 3DV2A 1BCRB 3OPYB 2DQ4A 4ZJPA 5ALHA 5AVYA 2ZIUB 1XZLA 3GAAA 3F74A 4TS9A 2ASVA 2VBIA 3OPYI 4W6QA 5FQNA 5HPYB 4YAJA 4K0KB 3RLIA 4YBZA 1P31A 4MX8A 3UWOA 3A6PC 3Q2KA 4JUIA 5TJHA 1CRZA 5JJBA 1AGPA 1XQ9A 2CBXA 1ORWA 3TKAA 1NQXA 1IQPA 3UK1A 2H4JA 1J5PA 2RC6A 5DBGA 2OTCA 3W2TA 4KXXA 5BOSB 1JP7A 3C7CB 1RAIA 2XJ9A 2XPCA 4C4SA 1KQFA 3PC4A 2FF7A 2VHJA 3BE5A 4RTSA 1KF0A 3IAXA 3K0FB 4I1YA 4URWR 1YRAA 3VSEA 4KR0A 4AKHA 1DL5A 4EJFA 3T5AA 2BZ0A 3BX1A 1W87A 2YRWA 3CCBA 4LSWA 4WKBA 5AM4A 2ZI4A 1JT9A 3D02A 3DFUA 5C53B 3I05A 3KSAC 2YYZA 3UCEA 1W36B 1J00A 2OC9A 1XKQA 1LV7A 1N6NA 1WIWA 3NHSA 3OQ6A 1N9GA 1VDMA 4J0DA 2ZIEA 4MUAA 4TQGA 4YC7A 3T94A 5JNSA 4FWTA 1OXVA 1BD3A 3TVYA 5TLSA 3Q8MA 4TXLA 4PPNA 1R0WA 2ODAA 1JG1A 3AUUA 4OGKA 5AMXA 5F1YA 5K6AC 2QT9A 3JZDA 3DZFA 1IM8A 1QUEA 5EXEA 4E09A 1A9QA 3WR5A 1BMTA 1E3QA 1E79D 4G8CA 3HACA 4KH0A 1UP7A 5E2BA 2C1XA 1AQIA 3IAS1 3NWOA 4GYWA 4IQ4A 1OBVA 4LRYA 4F04A 4JP1A 1L7OA 3TUZC 3X1DA 3F7MA 3VDMA 2OL4A 4V38A 3V2UA 3OZEA 3SHOA 1WKVA 1OIVA 2QD2A 1NN3A 1LDYA 3B38A 3IAEA 4KCGA 2YXDA 5LXTA 4WI1A 3MCAA 4IF6A 1BGXT 2F8LA 3B20A 5DXAA 1L5LA 3RSFA 2B1JA 2YWDA 3I2JA 5A7GA 3PIRA 4BLWA 4F3YA 5F77A 2HSJA 3AB7A 1P17A 3UPDA 4DYVA 3BD7A 4OBXA 2AFVA 1NN0A 3EAFA 3GLQA 1D2RA 5DIFA 4EYGA 1YB1A 5KX5F 2YHIA 1NG1A 3OIFA 3IHWA 1K97A 4QU8A 4ER7A 1M1ZA 1JLLA 2VFAA 3GRPA 5BN4B 1OXTA 1OWLA 2BLLA 2D1QA 2HSEA 4E2XA 1PIWA 5IANA 3HKCA 3MOIA 3DSRA 1PD1A 3I45A 1RM5A 5DBHX 1W1UA 4FT4A 3N6XA 1G20E 2OORC 5BNIA 5CFQA 2HL6A 1LSSA 1WB6A 2Y6UA 2I8LA 3E6AA 2I5PO 5EIBC 1A27A 3QHQA 3THYB 2HXYA 1TIPA 4CFYA 4M9QA 2VAXA 4ZHQA 4YCMA 4B9AA 2H2WA 1D2EA 4GC5A 3SWWA 3VMMA 5EZSA 5C32A 5IX8A 1IVNA 2O05A 2R6GA 5DHRA 4A3SA 4ABTA 3ZU4A 4DCCA 4G5XA 1C4XA 1JHDA 4GGPA 4LXXA 2Q18X 5CNIA 1U11A 5JPCA 1P0MA 2VK1A 5BW6B 3UGKA 2HXSA 4TM7A 1TQ4A 2FZEA 1K8RA 1MPXA 2B1GA 2XHEA 1UWVA 4QDJA 4QDTA 1QC5A 2FPLA 4KR2A 1EIWA 1OZHA 1LLQA 5FOTA 2PKWA 4YUYA 2FWJA 2VSQA 4W63A 2Q1YA 4DWJA 1M1YA 5DCUA 4CF4A 2H8GA 2I8CA 2AVNA 4IGAA 5TPZD 4DV6B 4MUKA 4PR0A 3SHWA 5B12A 2DSNA 3LIIA 1K92A 3F2VA 1KZ9A 3A0RB 1Z7YA 3DDSA 3KFXA 1NVGA 4ZGBA 2Y67A 4RVFA 3UJHA 2IYQA 5CR9A 1RWQA 1U31A 5KTNA 3C6QA 2WTXA 4YAFA 3GZ4A 1RJWA 2UKDA 1NQWA 3BOSA 1E66A 2D3WA 2PA0A 4KGVA 2FU5C 3Q9SA 5F5NA 1QRDA 3M3DA 3AEQA 1U0EA 2RGNA 2IL1A 4R2HA 3LHIA 4JU9A 3V80A 4MJ7A 1VJCA 3SMVA 5ALTA 2I4RA 3DAHA 5EWLB 3GLVA 3LHKA 2IRWA 4JOQA 4X94A 5DM4A 4EGFA 4BKQA 4MKFA 3QWIA 5I7SA 5J63A 4BXOB 5BQPA 1QV6A 2CNDA 2IPLA 1GITA 1GZ3A 1ZOSA 3U1BA 5KINB 4LI0A 1N5KA 1PO7A 1KO1A 4CFSA 2O2EA 3ZGOA 3LL4A 3A7EA 1SVWA 1RR6A 4XDHA 3NTQA 4YRJA 1Z34A 1RBMA 1NNI1 2I0FA 3O7MA 2GEKA 4AUKA 1S89A 1TZBA 5CURA 4YPOA 2C20A 1D6NA 2GBGA 2JFYA 5EZYF 4ON9A 2MSWA 4P5EA 1E7QA 4W9RA 5A9SA 3IRVA 3AF1A 1K98A 8MHTA 3E7FA 2JBWA 4Z7JA 2QX7A 1JA1A 2WE8A 4N7BA 4RXUA 1I8TA 2ZWMA 2KS6A 3CPJB 4YJFB 5F51A 4DMUB 2D5AA 4TTAA 1SIOA 3A10A 4TTTS 5JATA 2DY0A 1Q1ZA 2HLHA 3GRUA 3LK6A 5B30A 3IQHX 5CXSA 3GJ3A 2A84A 1TYDE 1EXWA 4W5NA 3JASB 1X38A 4YUXA 3EG9B 2YDYA 3EXFA 4RETA 4ASUD 1FK8A 4W1RA 2JIOA 4DJTA 4OBEA 4ZK2A 1ML4A 3CF4G 4DQUA 2HU5A 2WD8A 3AHDA 3IQGX 2QZSA 1R9JA 2I2FA 3FB1A 4QNNA 1SEVA 2PRYA 1R10A 2IP2A 4WQMA 1W2WB 4EELA 4QA9A 1Z4JA 1I7DA 2J5RA 3B1VA 5LD2B 3EZ6A 4DQKA 2LIVA 5ICFA 4M1KA 2NZUG 4OUKX 1STOA 4CTJA 2I4LA 3UNXA 3U4QA 1XG5A 4WFIA 2W70A 1U28A 3MJVA 4WCVA 2WM9B 4AQYB 1F3OA 4NU0A 2Q1DX 5FF9A 2X1MA 1S1CA 2IU6A 3TGLA 2BKVA 1CHDA 4AU1A 5AESA 2HK7A 4HAXA 4XYEA 4WZ6A 3R9XB 3CLSD 3W8NA 4NHEA 5CCBA 2GFIA 1W5AA 2AEFA 3NWJA 4TL6A 3WL4A 1BX1A 4BP1A 3C6KA 4CLHA 1HL3A 1MNAA 2FPGB 3BUSA 1B76A 1CUIA 1ONOA 1RHJA 3LLVA 5DNVA 1ZOLA 4J3JA 1PF7E 4UKDA 5LMZA 3EPRA 2WWHA 4KYTA 3V7NA 2BKUA 1H65A 2R65A 3DULA 3KAQA 2XXAB 2D5LA 4BDSA 1E3TA 3GA7A 4RFLA 4KITB 3UPUA 5ALKA 4TVKA 3TNFA 4HXGA 4QT0A 1H9AA 5J2TB 1ZC3A 3IV7A 1SCDA 2DPGA 2JLUA 1JB1A 1RJ9B 2V0CA 2A1TR 5F2OA 2YXEA 1T1RA 3H65A 4IP0A 2PXHA 4DS3A 4ENTA 1XTBA 2XMQA 3MB8A 4EY6A 2RBGA 2ETXA 2PIDA 1WXFA 3AZQA 2VT3A 3R3SA 4JVNA 3ZXSA 2EFGA 1A7UA 2QENA 1HQCA 4WXMA 2C83A 2C3YA 1NTOA 2C97A 4YV1A 1XMJA 3AZPA 4IXDA 3GQBB 3LGAA 5ALWA 3ZUGA 1FSGA 4W8HA 1V71A 1GUAA 3CGWA 3CE9A 1CUAA 4G97A 1SZPA 1J90A 4OHRA 1VRVA 1V11B 4QUKA 4X8OA 3LY7A 5C81A 4M9ZA 2VQ6A 1F12A 5GLFA 1QZ3A 4BJ1A 1PG0A 4LG1A 4TMTA 5K45A 1VL1A 1WY7A 1T6XA 2G6TA 2ILVA 3LX6A 2LIPA 2OV1A 3ONNA 4PC2A 4BIIA 1KRWA 1IM2A 2AFIE 2MSCB 3CRMA 3FOCA 2G17A 2GUGA 3NM4A 2PKQO 3EULA 3KQTA 4AURA 5CDTA 5T57A 2Z2YA 3H1BA 3M3PA 1SC4A 3G2PA 4CNBA 4B4KA 3ZDAA 3MCUA 4CODB 4ZT4A 3V9AA 3PXBA 1Y7HA 4B8YA 1W75A 5LA6A 4UM9B 1X80B 2W0SA 1OTHA 1SVKA 4LYGA 5CDUA 3GLFB 1N6RA 2EZ4A 1VKNA 2JD2A 1P4JA 2PL9A 1Q0LA 4MJXA 1XCMA 4B2IA 4DDVA 3IQEA 1CRWG 4IY1A 1UBHS 3UT6A 2JLBA 3GCZA 4XARA 2NVUB 5AI6A 2YXBA 4C6HA 2HA3A 4KN8A 4R3UC 4XTRA 1C7JA 5HIJA 3CSUA 3DPIA 3Q10A 3BMQB 4GXQA 1V5WA 4NFHA 3GT7A 4GP6A 4F6RA 1COWA 2DHQA 1J0XO 4MWSA 3CMCO 4IMIB 1ZY2A 4OD0A 1I5RA 1THGA 3NFRA 1YBFA 2BGRA 3JR7A 3HE3A 4NQZA 2NT4A 3IVCA 3S8YA 2YHUA 4K86A 1E2PA 1I3CA 4B87A 1MO2A 4NF2A 3PU6A 3SLGA 4UNSA 1T5HX 1XKTA 4WFKA 1N5OX 3GMDA 2ZYAA 3OBIA 2ZJOA 2Q27A 3QVKA 3K0SA 1T35A 3ZCPA 4FM9A 4DA0A 3LUJA 1FDSA 5EKXA 2I7XA 5BW8A 3UXYA 1XJ0A 4NU5A 4PIPA 3WBKA 4URFA 4B71A 4H16A 2HA2A 4MV7A 4NU6A 4C3VA 3QTTA 4GPIB 2Y1WA 4DVJA 1GPWB 1SRQA 1NX9A 2VZ9A 3NJRA 4HTAA 4K26A 1JKJB 1JMYA 1GYRA 1PKEA 2ZUUA 4M21A 4I6GA 3KOXA 3VYVA 4JL8A 3OM1A 2FWIA 4RADA 3N0RA 5DNWA 3OTQA 3NIGB 2MSLA 3LPCA 2COKA 2NV2B 2JFGA 2ONZA 4XAQA 1F9AA 5DI3B 5EPEA 2HREA 2BTOA 4LWPA 3ZE7A 2X4DA 3QYFA 4RV5A 2DBVO 4Z3KA 4I08A 1JU9A 4M6WB 1YRLA 3WGJA 3R3YA 3WLPA 5LQAA 5IUNC 4JT4A 3P2MA 5HFNA 1UM8A 5GIOE 2C2OA 1TTPB 4TX1A 5AJYA 3D6MA 2CFTA 4GM0A 2JAWA 3NXSA 4R6WA 4J0FA 3UMYA 1HZZC 3FVQA 1E3DA 4JBIA 5KCZA 3PHGA 2WHPB 1OAAA 1U4SA 1N2ZA 2N1BA 1X1EA 2EFHB 2DBQA 2VDRB 3F7TA 3LCVB 5EQTA 3O8CA 2QTFA 2R47A 3LSYA 2X4LA 4O1IA 4B3BA 3D59A 3K8OE 5ITVA 4HDKA 1Q1AA 2O0LA 5BPHA 1A9OA 3FJOA 5K01A 4JBNA 4MPPA 4RIFA 3KZKA 4BYGA 4I9NA 3BDVA 1EFLA 5HRAA 3HWWA 3F3KA 1YWGO 4WCFB 4E1AA 4HGNA 4YP5A 2L82A 2GN9A 2J4DA 2WU4A 5TQ0B 3IJPA 4HB3A 3KZ1E 2QSYA 3BCUA 3INNA 4JJFA 4S24A 5CBPB 1XWWA 3UHPA 1T24A 3QVUA 4OV6B 3VR2A 2QP9X 3GRFA 5AI9A 5LYJB 3HCOA 1JFLA 1KJJA 2ZR8A 3RNLA 2H85A 4DWVA 3JALB 4LE2A 3H5WA 4EI7A 1Q11A 1P29A 1UKCA 2GPNA 2C9BA 4UMDA 5LZ5A 4N0MA 1T1EA 2XOEA 3EDQA 3G2KA 3UN1A 1RWNA 3D6NB 1NONA 2BE9A 2YZ2A 1JA9A 2OGUA 1N6HA 3EISA 2Z43A 4URUR 2R25B 2Y3IA 1DOZA 5AOBA 3G9ZA 3R9IA 1L4NA 4OHCA 5I7AA 2WILA 5KYXB 2GETA 4BJHB 3RHTA 2PX2A 1L7NA 3LHFA 2C7RA 4HBZA 4H7FA 3ICWA 4GMHA 4DSUA 4S1VA 1VL6A 5AW3A 4OI2A 4NMLA 4GKAA 4YP1A 5TRTA 2ZPTX 4LF8B 4R2KA 4A1FA 1KPIA 2AN3A 2GN8A 3PSAA 2ZR0A 4Y0NA 2QN8A 3RVLA 4ESVA 1USUA 1JEOA 4CDGA 5IASA 1PYOA 2DFNA 3DLBA 3RANA 3ZKWB 4C88A 3VR4A 3RUEA 3NW9A 2VF2A 3VX3A 2I6SA 5KOHA 3AJAA 1Y6RA 4BDTA 2B6HA 1MQ9A 3SC2B 1MG0A 4QARA 2J3DA 4WW0A 4G1VA 1KY5A 2Q3MA 4PCUA 1WDLA 5U9CA 3WRWA 4LE0A 2P2CA 1Z4PX 3OZVA 4HN2A 5FWAA 4QG3A 4IEIA 5DBOA 2NACA 3H8WA 5K0GA 4IGEA 2P4UA 1ZGCA 5BSRA 1CB7A 4FB4A 1F1JA 3RTBA 4HVLA 5L4NA 4DNXA 2JCYA 2IOQA 2ZIXB 5FL7A 1EDDA 1J09A 4GOKA 3ZK7A 4PYRA 1Y3DE 4XOUA 3HRKA 2FW0A 3G9TA 4A0SA 5FWXB 2RE8A 3VVBA 5FWDA 4K2AA 4R7GA 5F52A 2FX5A 5F78A 2F1HA 4HLUA 3WLIA 3FYUA 3AUKA 2BCEA 1OZ0A 3IHLA 1EJ6A 4PTLA 1P7PA 2WICA 4R2LA 4CQMB 1L5ZA 4H4DA 1Y9ZA 4HTFA 2WWVD 1IK4A 1DX9A 1Z35A 3K1JA 3ZZUA 3B89A 4IWYA 4OLJA 1NVTA 1IMJA 3AERA 1GAEO 5AHKA 1I2ZA 4KOAA 1CYEA 1O9GA 3IEPA 3R8CA 2ZJ8A 3CUEF 3P9IA 3G0DA 1RCFA 4FHGA 5D5PA 4B4DA 2YWBA 2XKJE 3HMQA 2A4KA 3P5SA 2CCJA 2XMRA 3EHEA 2Z1DA 2JEZA 3L1VA 4GMDA 2Z8YA 4LMAA 4RPLA 4ETNA 4D9EA 5CAEA 5CJ2A 3DMHA 3CRRA 1U9ZA 2WJWA 1OZGA 1ZW1A 3DNMA 1U2DC 2PRKA 1R6UA 1WJGA 3HV0A 3TLZA 4B4OA 3FPRA 2HADA 1JLKA 1LEHA 1C3OB 2FPKA 3DPUA 4OQYA 4UHFA 4ZPXA 2CZCA 6REQB 4J7XA 3AL0C 3BCRA 3WADA 3C8HA 2CF6A 1V6AA 2XXBA 3M6LA 3NP7A 4N54A 1ACLA 1JG6A 1OBCA 3A06A 4FYMA 3TNDA 2NUTB 5TIIA 4U7WA 1V39A 2CK3A 3PVCA 4RNDB 1O96A 2J3MA 1PX0A 2UVPA 4HQ6A 5CA1B 2WQ7A 4AKIA 4FGKA 1WDWB 2E5WA 4C76A 3IE1A 4ZARA 1FW8A 2XCRB 4TKUA 1QYXA 3L49A 2ECFA 2BEUA 2GHTA 2XT9A 5LMCA 3LCUA 2PJZA 4W5RA 1RZVA 2HIAA 4TL7A 1T4DA 3RVBA 3JQEA 3NG1A 3HXMA 4KRXA 3BEOA 4QQFA 1J2JA 5JYEA 5T4HA 2BFBA 2BBOA 4XYMA 1ZQ9A 2P41A 4GH5A 4YMVA 3AFGA 1MEEA 5T41A 2IH4A 2CV1A 4HYEA 5DM70 2JLYA 2GDZA 1ZBQA 4QRIA 5B57C 4X54A 2EQ5A 5IUJC 1PR0A 4E3WA 1CR4A 1V8DA 1XHLA 1GCAA 1NMZA 1VPLA 3AEUB 3I9NA 4F84A 2X5OA 4YASA 1RKVA 2Z04A 3T5CA 2FOLA 2FMTA 1L1RA 3K1YA 3WX0A 1T2UA 2PX8A 3I0NA 1TK3A 3A31A 1VYUA 4YA6A 5EIEA 2ILTA 4XIGS 5C4MA 3M4NA 1R12A 1KAQA 4N0QA 1R0RE 3PUWA 2JASA 3VNAA 5B4VA 1E1QD 3MVEA 1QIIA 5I4CA 2ATEA 3PGVA 1KWGA 1V8FA 2I29A 4K5QA 3VHXB 1JIXA 4DIFA 3Q3IA 2F6RA 2J4FA 4Q9DA 4I1SA 7AT1A 8ABPA 2FZLA 1AOXA 1DUIA 1SUWA 3FPCA 1YKGA 3AY3A 4OKSA 3DLAA 4Q1VA 3EEYA 4Z51A 4XUEA 1GCUA 1SXJB 2H0QA 3OLWA 4L0QA 1U4NA 4LBVA 1E3JA 2QMOA 3THSA 2JAUA 1PEDA 1K0UA 5ELXA 4JLVA 4EA9A 2SKEA 4J94A 4X91A 3E3OA 5KQPA 5GINE 1E2FA 4D26A 1G21B 1YQEA 3BE8A 3B1YA 4FHEA 4XPZA 1B1AA 2HNKA 3WI7A 4MDFA 2YQZA 1CQIA 3K5WA 3KXIA 4WKPA 5LZ7A 4OX9Y 5D3QA 3UB4A 3HGQA 2RGCA 4OU5A 3KL4A 3CUSA 1GKYA 3SBOA 1PT6A 1S8AA 3QOYA 5B3KA 5JI3E 4PTYA 1FDRA 3FNQA 4DEYA 3KB8A 4DCJA 2O2CA 1Z5WA 1R88A 2OCXA 2V9ZA 4YXFA 4OH1A 4IVNA 4XLTA 3U16A 1N5DA 1AKYA 4L28A 1UMBA 1LLCA 4XGQA 1GAXA 2PMKA 3O75A 5E3IA 5JAPA 1BDIA 1QH9A 3JAWB 2IZ7A 1G4AE 5FBQB 1AKTA 3WP0A 3HFJA 4IGKA 5TF4A 5I4IA 1TT5A 2AJTA 4JXKA 4F5EA 4CYMA 2Y0EA 3TOCA 4YI3A 5ER6A 1DI0A 1EVZA 1FDIA 4P4SA 4MICA 1XB2A 3Q5DA 4YDSA 2QRKA 2D6FA 1KEWA 1A7AA 2EJWA 2PU5A 2ZUVA 3EY9A 1MHTA 2M1ZA 3ZW8A 1IUKA 1LS1A 2OPBA 4X63A 3IGFA 5SYAA 1E32A 5GADl 5ALUA 1QP7A 2Q5OA 1CUVA 2G0NA 3AVOA 4JWKA 1LPMA 4QUDA 4PRZA 1MOZA 4MVXA 1ULBA 1HNNA 5FBZA 4EO4A 5DNEA 1MA3A 1TTTA 1UK9A 5A4JA 1LBIA 3BMCA 2QZJA 4K6CA 1MX3A 1LW7A 1ZCFA 3TDNA 4LGYA 3D7SA 3OOWA 3N53A 1QNLA 4BNYA 5HZGA 2P77A 3H4VA 4XA8A 1CS0A 4WDRA 4GX5A 3OLVA 4K6OA 2RHLA 4OIFA 4RD1A 3L6OO 4UFOA 3TX6A 3UAZA 5CCDA 2JJQA 4NAUA 1N0HA 3VAZA 4FX5A 4Y3UA 1REQA 1SPXA 3DC2A 1SKQA 4IVRA 2IY8A 1YKSA 1NXPA 2NZVG 2YCBA 1M3SA 3DE5X 3OAAD 3B6IA 4LDAA 2BTQB 4UUNA 3T9AA 4DMHA 5TT0A 2GN4A 1CYDA 1WZUA 1YS9A 3N86A 2TMGA 3WKCA 3W06A 2PGDA 4OUDA 4FYIA 3WXMA 1NXOA 4XFDA 3KUCA 3ZI0A 1UPUA 1DBRA 2P9FA 5LNK6 4WUVA 5BWNA 4RKRA 2VTBB 4XWGA 1A96A 1IY1A 3F90A 1L3BA 1PZFA 3GLHB 4A8PA 4RM2A 2DQKA 3O21A 4CQMD 3L0OA 1XIVA 2QF7A 3DVRX 3ITDA 4X60A 2R60A 4PPYA 1RVV1 3FI0A 2QR3A 4MUYA 4B6QA 3JAKA 2PO5A 1DG9A 3SYNA 4DV2B 2XWJI 2WPDA 1I4DD 1NFQA 2ZI6A 4N9QA 4NYIR 3TS1A 3UUGA 4DEVA 5I6DA 4FE4A 1Z15A 4PFSA 4BAGA 3CZPA 4DQ0A 4NXNB 2Y9PB 4NCNA 4K40A 2ZSJA 4EHAA 5JXGA 1KK2A 3TOSA 4QU9A 3RC7A 4M9RA 3C1TA 1RWWA 4ZOQI 4EPRA 5B55A 2B3TA 5TF0A 1Z83A 5GV7A 5EQJB 2MIIA 4EVIA 3CX6A 1ZWLA 1SG9A 2VPZA 4XWAA 5B53A 4ND8A 2HCTA 4FZVA 3L8FA 1D1SA 2PZGA 2WK1A 1DSSG 1XCOA 4KE6A 1M74A 5C31A 4NAHA 3GP5A 5AHOA 1URPA 3H5TA 5IJXA 1JEYA 2AOTA 2W6NA 1N6LA 1TZJA 4WXYB 4C01A 4YAIA 2FWNA 1RDFA 1TD9A 2D0DA 1QB8A 3GMSA 3EZLA 3B82A 4BCCA 1QYWA 4EHKA 4XM0A 5EKUA 4JCOA 1U0RA 2DQSA 1AXGA 4IDDA 4RGVA 4BMCA 2NV6A 4FGZA 3W6ZA 2BEWB 2XYHA 1Q74A 3SU8A 3WV4A 3MRXA 4AWAA 2J0EA 2HH9A 1MF7A 4LX0A 4Q7EA 3TLYA 2B4QA 2TS1A 3DBVO 2II6A 1GPH1 2IHKA 4CUKA 1SQGA 4IWNA 2ZJ6A 4BRUA 5TVGA 4TUYB 1IXKA 1A5AB 2Q5LA 2YOFA 2CJWA 4BNLA 5EWMB 4EB6A 4F60A 3Q3VA 1Z8DA 5HHTA 1DIBA 1L4BA 1NVEA 4PHTA 3AQ4A 1W581 2IHVA 5DHAA 4P7FA 4D9JA 1C30B 1EJ0A 1SVSA 4N48A 3UW1A 4CEJA 1FTNA 1LPAB 2QD3A 2Q0QA 4FOTA 5F98A 2HRQA 5I45A 4DM7A 2IHUA 4RHFA 2BMJA 3PRYA 4R84A 1RJFA 4DKXA 3EPLA 4YJ2A 3JSAA 2OOKA 5A6SB 5CEEA 1GU0A 3W3AA 5AKJA 4HJRA 2JJMA 4BFSA 3ITEA 3RYCB 2BKEA 4QZVA 5AD1A 3M33A 3HCPA 3LA6A 2XE4A 2VQDA 2JHPA 1O8BA 2IE8A 5JHHB 5HJEA 1BDJA 2QYOA 2VJQA 1A9ZA 3P8ZA 2VHUA 3WNCA 4AG3A 1RQXA 1O9HA 4U7DA 4OYYA 1TNDA 2FRDC 4YMGA 1NF9A 1WAMA 4TV8F 3AESA 1PSWA 3TR6A 2PUGA 5FI0B 3PG5A 4KVGA 3TVDA 4BNVA 4D3XA 4RM3A 4DIOA 1W8IA 2OGZA 1EK1A 3DDUA 3OUTA 3OURA 4E4TA 1SXJD 3GEPA 3II6X 5CGQB 1G0NA 3CR3C 4FDTA 4NZPA 5I8ZA 2O2YA 4BQQA 3DNPA 1HEUA 1NPYA 4F71A 1HI9A 3MIIA 4M0CA 2ZYWX 4Q24A 5EHIA 3U80A 4F06A 2GCOB 5DF1A 4PLGA 5HILA 4ZAYA 3ZY5A 2BCGY 1NFRA 4AS2A 2WYIA 1O94A 2JAOA 4JV5B 3K5PA 3AU8A 1JILA 3NUZA 2Z5GA 3K0AB 3AUJB 3GRAA 2ONKA 5EJMA 2F1JA 2JGIA 3QMVA 4DMRA 1A71A 1JFFB 1MPTA 1V5GA 2DFTA 2VWHA 3NHMA 4PAQA 4OK5A 3N8HA 1JDZA 2DWUA 1Z29A 4X24A 2G9VA 2H4WA 4F2DA 4G89A 1H6CA 1DZIA 3GYGA 1X42A 2IIVA 4DCNA 5KNDH 3NASA 1F0NA 3E9EA 4ZI2A 3ZHTA 3DZJA 3EZXA 1LPBB 4Y1EA 1OI4A 3SKVA 2I3BA 1E2EA 3ZU3A 3PC7A 5KVVA 2AI2A 2Q5JA 3DT9A 2BR5A 3IDSA 5DLYA 3KALA 4ZOLA 4EUSA 4YRNA 1WHSB 5HFJA 1QGDA 4WASA 1YA6A 2C2WA 4DPLA 4RDHA 1QZUA 3PE6A 4IFIA 1JZTA 4XR4A 4UM5A 1DEXA 1JEAA 1EHCA 2FR1A 3CBGA 2CFIA 2RGEA 3F2IA 3G17A 3L1UA 1YBAA 3OJOA 1V45E 5GIPE 4JJKA 2HK6A 4JSTA 1HKUA 3QKRB 1RI3A 5FCDA 1YE8A 3T3OA 3OCUA 4S1PA 3ZBQA 4MVJH 4U7HA 3LBYA 3AV0B 4J7AA 4AY2A 1P7WA 4N4AA 1K8ZB 5JAQA 4YHHB 5DIZA 3GRYA 4D9KA 1RPZA 3JARA 3BF8A 1Z2CA 5K6AA 2XQJA 2Z83A 1JGTA 1P81A 3I2HA 2VJAA 3DZIA 1Q7TA 1Z4QA 2DR2A 4MWZA 3ZD6A 3RASA 3VOAA 3EVEA 4HRVA 1DKPA 2IWHA 3KTAB 4EUHA 1R4MB 1KJYA 2FN4A 4MQUA 2P90A 1U9IC 1OQAA 1G2OA 3H4IA 2D7DA 2OAP1 3RI3A 2BEJA 3ASYA 2AG5A 2IYWA 3OESA 1EVIA 4Q12A 4MINA 4BEBA 2GZRA 2YY6A 3RFFA 4OGFA 2VO1A 1VHDA 2RJNA 2WIJA 3SJCA 1VSVA 1NTRA 3HS3A 3KLOA 2BFOA 4PHHA 4D9GA 1V1MB 1O5OA 2EXXA 4NMXB 4O2LA 2ZB7A 3DL4A 4GIBA 5CDYA 5BUZA 1ZR4A 5PGMA 2JI9A 3WQSB 3ZWPA 1FMJA 3H8SA 3KB1A 2Q28A 5JH7F 4ARCA 3A9WA 2XWBF 3LZCA 1L5RA 3H42B 3P97A 2GFHA 4BP9A 5CXQA 3GLKA 4KI0A 2ADFA 5EGSA 5KVQA 5AW1A 8ADHA 1Y82A 2PUBA 2WF5A 4LY3A 2DKNA 3DEAA 3I5YA 5JS1A 5WRFA 4XVRA 1QZZA 2OILA 5GOTA 5HDQA 3PVSA 4ZVMA 1V8ZA 3ZBUA 2RIPA 2VQ3A 5KS2A 1PR4A 2OORA 4KLRA 3U2QA 1OH6A 2I3ZA 3O8OA 2O3QA 1L4UA 1H3FA 2IYTA 3N1UA 2X0IA 4Y1RA 3ETHA 2VL7A 1C8LA 1IXZA 1ODKA 1P5ZB 2PV7A 5AVQA 4WNIA 3THXA 2VF7A 4N9WA 4X7MA 4BMPB 1FB5A 5KYNA 3HZZA 4RHTA 1BXKA 4TV9A 1YTUA 4LEIA 3I2YX 3SZOA 3MUEA 4UAJA 1EKXA 3CUUA 4F46A 4D9NA 3PPVA 4LJ5A 1KFCB 4JH0A 4D4HA 3HDYA 2FQYA 3GOQA 3GVXA 4Q3KA 3UMJA 4RA9B 3K9GA 4F7WA 1AZSC 2ZBRA 4MIYA 1BEUB 4NK5A 2C2KA 5KJ1A 5IKXA 2QN2A 4HKTA 4QX6A 2EFCB 3QZUA 4Z8YA 5CIYA 2Q8PA 3K9BA 3H99A 4TT3A 4BEVA 5CX1A 4XYGA 2ATXA 2ZCJA 4G1FA 3KU4A 1BU5A 2CUTA 3C87A 3IFSA 2P9HA 5CLLA 5IULC 2P3OA 3GDGA 4WZAB 5CLFA 3M6FA 4EJMA 3FUUA 3D6TB 4QRDA 5J2UF 3U3DA 1UK7A 2BT4A 3W5CA 2XE6A 3HKDB 3QU5A 3FDZA 3PQFA 3UV3A 2AT1A 1EVEA 4EYEA 4O25A 3FPBA 1BXRA 2P1DA 2X9GA 4MRRA 1VMKA 1HTBA 5JDCC 1UDAA 2CXOA 3IEUA 1EBUA 1RKXA 2XH8A 3IAHA 4JITA 3TEMA 3DBRB 3L07A 3N8DA 3OE4A 4OYHA 5IUKC 4JLJA 3NXKA 4E14A 1T4GA 1CB0A 3O47A 4CU2A 1XYYA 2B8EA 1DT5A 3O4GA 4HQ0A 2ZZKA 3RBVA 1WB5A 2I62A 1XXLA 4OHPA 5FA8A 5KQMA 1TU4A 1UXOA 1C50A 1XNGA 2QU8A 4C22A 4P08A 4AZ3A 4RA6A 1WOMA 2NPFA 3IEIA 1L5WA 2DLNA 2HXGA 1U3UA 3LYUA 1W29A 4MO2A 2Q0XA 1QNFA 4XVQA 1BKYA 4FYPA 1R6TA 3A3PA 3IEKA 2ZKIA 2J7PA 2Y0CA 3Q87B 5CB4A 3VOSA 3RWOA 1JZSA 4EKGA 5H7XA 3JQAA 4FINA 4DBZA 1HDOA 2VTDA 3E5RA 4WGFA 4CM9A 1B14A 1YR6A 2OM6A 1SZDA 5AJWA 1QH8B 4ZEWA 1EI9A 3KJQA 4W6ZA 3CKYA 1AF7A 2GEFA 3MMZA 2ZT6A 2F90A 2FMXA 2C04A 3ER9A 5AKEA 3GZNB 4TLDA 3VPSA 4O2RA 1PGPA 1JIIA 3U7FB 3OD5A 2PGXA 1CUUA 4U6NA 4XW2A 5E4TA 3W79A 1NX6A 4HQLA 5B64A 4OHMA 1H8ED 1ZD9A 3I92A 3ETCA 1H2FA 1W96A 2JFZA 4M7PA 5ALLA 3NHBA 2O5CA 1BQ4A 3FLEA 5CIWA 1U3WA 1ZZGA 4HPJB 4QELA 4U6QA 4OHKA 4Q82A 2YIDA 2NU9B 3GLFE 1GWNA 2NP6A 4DXAA 3HQ4O 3DHNA 3I8SA 4F4HA 2O57A 1M2WA 4BMNA 4JJZA 2J33A 2G8LA 4GG1A 4UUAA 721PA 2QM7A 2QN3A 4FPXA 5A0FA 5IXJA 1VDZA 2I7VA 3GT3A 3QSGA 4W4TA 2O8DA 5JC1A 1C3LA 2QAJA 4I8XA 2E1PA 2FUNB 5ITZA 1NUSA 3MXOA 3K15A 2AMJA 3PA6A 3S2SA 3HZHA 3ZDZB 2CV0A 3SQLA 5HW0A 2C8KA 3PYMA 2FSVC 4IJMA 1JEQA 4UUQA 5FA5A 4GOOD 4M83A 3RYIB 4W5QA 4ZTUB 3NDBB 1ACMA 1QAMA 1QO9A 1U9YA 3IUQA 4EVQA 1M1NA 2ISCA 2RC5A 4JK3A 4NI5A 4KSCA 1Q2UA 5BSUA 2VK2A 2DUJA 2ZTUA 2VAPA 4P3XA 4B3TB 5C18A 2IEAA 1Y6FA 2G1KA 2Z4SA 5TT1A 1AQ6A 4JLSA 5TQVA 4IWXA 4NNPA 2IK8A 2WWTA 3LCJA 4GL4A 4OXQA 4A6DA 2PV0A 2FN8A 1A8SA 5H68A 3NI2A 4DE5A 2X9NA 3LNCA 2PMWB 2QI9C 1AM4D 3A27A 5SY9A 5REQB 4YMLA 4E30A 3AW8A 1RPTA 1TC1A 2K5UA 2QNBA 2C8VA 3B9QA 5EKSA 5GAJA 1SKYB 4TN5A 3V4OA 3WAGA 3O8RA 2HZ7A 2PX6A 4KL8S 4OP1A 3UAYA 2PT5A 4JYAB 1QLJA 4G6ZA 3T38A 4JJ4A 1KIFA 3WBFA 4BX9A 4CWAA 4AKGA 4XWOA 2IXFA 3N0XA 3GCDA 1XTJA 1QAOA 4IVPA 4Q1BA 3RC2A 1GUFA 1OIWA 1SC3A 121PA 4RSMA 4C7BA 4D0RA 5IWCA 2HBQA 3OFSA 4OA5A 2VA8A 5J4LA 1TEZA 4KWEA 3CN7A 3EXHB 2CN1A 1Q0ZA 4OATA 1B8NA 2BJHA 5CM8B 3FXAA 2X2OA 2H1HA 1DP4A 3T4XA 1XZAA 2ZXUA 3SXJA 4A03A 1LZKA 1YFZA 1GZ7A 1X0XA 1Z6GA 2Z57A 3G5TA 4P53A 3NHFA 1KYYA 5FQOA 5HE8A 2FZVA 3T7AA 1Q3TA 3QQ7A 1E6MA 2UYQA 3R6GA 4DYHA 2CW5A 5EG5A 4TLCA 3ZVKA 1E7MA 3LI2A 1I9CA 3TH5A 3V8VA 4U2EA 4Z0HO 4N8DA 2GRAA 2WSBA 6ADHA 3ILSA 2BFAA 1WB4A 1E6CA 4E11A 3EUEA 1VL8A 2E89A 4NNOA 3RC9A 3W2GA 3A1DA 4PXSA 2H29A 5KOYA 3EEFA 3BK2A 2G63A 5CLHA 4NH0A 1J8YF 4L95C 4X85A 2QQGA 4ZAFA 3GGJA 1EUZA 2HCRA 2HPZA 3RYFA 3RYHB 3LF2A 3WO1A 5A4KA 5LZ9A 1GGKA 2YHBA 3IQXA 4RACA 5ILGA 3SCZA 2XODA 3KUXA 4XUDA 2AW5A 3P2OA 1HFEL 2RB5A 2NU8B 4EARA 4QVIA 2QN6A 3SKXA 2RH9B 1JG4A 2IT1A 2WJVA 3RABA 4J0CA 2I4MA 2P8SA 2CNBA 4JLUA 1OU4A 3RV4A 1PJRA 3E1SA 4EK9A 1T43A 1P72A 1N0IA 4B6RA 4HDOB 1KR2A 2J9FA 3PNBA 4MLPA 4DR1B 3BPSA 1Y48E 5F7ZA 1TFRA 2ZUWA 2H0RA 3AJRA 4CL8A 3UH1A 3UV6A 1UH5A 3EAGA 3REFA 1FMCA 4LJRA 1W73A 1GZVA 3TPFA 4TZKA 4BY9E 3OPNA 3GT0A 4LSZA 4RCZA 3EGVA 3CUKA 3OA0A 1W4AA 2B9EA 4P98A 1Z4IA 1ZJJA 2FI1A 1JYFA 3ICVA 4L6CA 1RACA 2ZAOA 2WC1A 3RS2A 5E9WA 3AHJA 5B2EA 3Q6MA 4H7JA 4ALIA 4M7RA 2I78A 1FLAA 2W5UA 5ECWA 4MLZA 4Y2XA 1THTA 1U2EA 4OG2A 4DV5B 1JG7A 4KREA 1FXWA 4ILEA 3C3WA 5A5GA 4QOIA 3M1AA 1ZD5A 1NXVA 1HZZA 3V2HA 4Q15A 1DMSA 2HZBA 5DGCA 3IQIX 4O5OA 1HNZB 3HJBA 1KP2A 5COBA 4W5TA 2MSEB 5JOQA 3O1IC 2UUOA 1JALA 1W2HA 1RYFA 2CGEA 4FYYA 1KVUA 4HO1X 1PR3A 5C7LO 1LK7A 1HYGA 2YDXA 4D4IA 5TR9A 1DAFA 2WVHA 2AX3A 4XTCS 4ZDWA 1XRQA 4DRXB 5HIKA 1ZJWA 1KAMA 2KY9A 1C7FA 4UASA 4OQFA 1RQ7A 4Q39A 2G82A 2IC5A 5HJ7A 3JVIA 3I9FA 2FPWA 1OWOA 3C7DB 5H9WA 3OC0A 1Q57A 1UZAA 1OD6A 3VQTA 3DF7A 5EJ8A 1YF3A 2HSDA 2DERA 1KY4A 2MYTA 2JB9A 5FNZA 3IBFA 3KDAA 4D43A 1BX3A 1ZKMA 3EUFA 5H9VA 3STYA 2R4UA 3TSAA 2QTLA 1J24A 2GT1A 4FEAA 4J07A 4B45A 1V5FA 4GBJA 4BLPA 1RJDA 2BP7B 1DAMA 2FCAA 1VCNA 4AJNA 2CDNA 1UFOA 4P4TA 4UZEA 3RJMA 3A70A 1JQEA 1X7GA 3S2GA 3U3MA 2HAEA 3RC3A 3ZCXA 1KSGA 2N1MA 1JRLA 3WK8A 4MJLA 3NBYC 4FFWA 4U2GA 4EY5A 5FNVA 4GYYA 3EG5A 3CVVA 2F3RA 3RRBA 1KGSA 3IUJA 1WBJB 4NICA 4Q1FA 1BE0A 3L0ZA 5EZ5A 1J42A 4WKNA 4DGSA 4G5RA 3COYA 4GVXA 1ISJA 3FSGA 3I4CA 4L6AA 3U81A 4RTNA 1JHVA 1QKKA 4EG0A 4D4MA 2YS7A 4N6GA 4FYJA 3EPHA 3VSAA 3JQGB 1ECFA 4JLKA 4JI8B 1PNQA 2KLBA 1WCIA 1KVRA 1S2DA 3A6DA 4TMWA 5K51A 3ET5A 4PLYA 1APBA 3CWQA 1VA4A 3BVPA 3CZCA 1JR2A 2QYHA 3HHPA 1SOUA 1X7YA 2VP9A 3KKKA 3LP5A 3NBKA 3ZHXA 1G5TA 5IYZF 4MVJI 4ZODA 5EKDA 3E2IA 1PEKE 3KQKA 1H94A 1KI4A 5AW9A 2RGBA 5UKDA 2WABA 4BV2A 4UATA 4X8HA 3WGTA 4EQ6A 4MPRA 1T9AA 1A3CA 2YVQA 1PV4A 3L06A 4JOBA 2H5EA 2WTNA 3V4PB 5E6SB 3WHPA 4N40A 2FCRA 3F98A 3R41A 2NSHA 4MVWA 4RF2A 2FEXA 3PT5A 1KI6A 4P4NA 2C7PA 4KO2S 3ADDA 3G2NA 1CIJA 4FD3A 5JXIA 4KDLA 3QWHA 1QQBA 2MSDB 5A1JA 2G83A 4FYKA 3MQ2A 5HP4A 1O5IA 4U8GA 5LJLA 2J6BA 2W6MA 3NDJA 3ZVMA 2GESA 1MVLA 3RKRA 3LQKA 4DUYB 3RRMA 4FFOA 1AU9A 5AJVB 1GTSA 3HCDA 1W5EA 4WOPA 1NHWA 3SZUA 3ILVA 3OY2A 1SXJE 4MQFA 4DUPA 2O8BA 4D3YA 1J0BA 4AM8A 1AA6A 5HRUA 5LP6B 1VBKA 1FX0A 1W36D 4DLUA 3LO5A 3OSZA 3WIBA 2VP6A 2P6OA 5JANA 1P1CA 5JBNA 2CD7A 2IUSA 5ECGC 4LCJA 4E7OA 2VTVA 3PPIA 3VC3A 1G21E 1JHQA 2JI6A 2A1TS 2AG0A 1P6XA 4PC3A 2AMYA 3JWGA 1T5LA 3E22B 3L8CA 5DWVA 4C7MA 2R6JA 3PRJA 3Q7QA 3SS7X 4UTRA 1U2DA 3OO1A 1WBBA 5ALRA 4QTTB 1E98A 3IEXA 4N03A 4BFYA 4X1KA 4X41A 3B48A 2OECA 3EXIA 4PX5A 2QGNA 4YRSA 2WHRA 1IHXA 5FKJA 4B80A 3V2IA 4CLOA 2YZKA 3W05A 2NT3A 1N6IA 3OLYA 3QE0A 5H59A 1M1UA 3T1TA 3D8HA 1P3JA 3RUIA 1P9NA 2P5TB 4MB6A 4IDOA 3HA2A 4DG5A 4EPWA 2BFDB 1U3DA 1HDIA 2QQ5A 1QP8A 1YL6A 1IWPB 3P27A 4WK2B 4M46A 5EA2A 4R71A 5JQGF 1D4FA 1DAIA 3V42A 3ZW7A 5CDHA 4RH3A 1A8IA 1DQYA 2OBNA 3CUYA 2ABWA 4QXQA 1LB1B 2J3LA 2DB3A 2UZAA 1US8B 4BFCA 2LGJA 4EHIA 1XRNA 2ZRQA 3IQFA 4OMFG 1NQOA 2FMIA 4PSVA 3INTA 3SZGA 1Z06A 2HQOA 2QYTA 3VPXA 4QTYA 5IK2D 4IMPA 4K88A 5KIAA 2AWOA 2DZDA 3DVSX 1HF3A 1PGNA 5AVVA 2EZUA 1DS6A 2IPXA 4RNCA 3BGSA 2X8JA 5DFAA 1ZN9A 4ARAA 5EHZA 3RS8A 5CFZA 1NI4B 1TUBB 3PEUA 3QE2A 1LVUA 2ZRIA 2XXJA 2O9JA 3C1UA 3M4YA 3DTTA 4WJZA 5IKOA 1QHSA 2WF7A 3HUEA 2IX3A 3KQUA 2XDPA 1Z38A 4JA2A 1FNCA 4AAYA 3HG7A 4I5GA 1ZMOA 3RF7A 1YIAA 1TIBA 4JLNA 2AOUA 4ZZ2A 3WB0A 1XNQB 2F00A 1XZFA 2ZYUX 1T3ZA 1KJZA 1M2GA 1NY5A 2ZWIA 4YLGA 1X7DA 4DR7B 3WFIA 4P0QB 4MR8A 2NXEA 1M6VB 2WOJA 9LDBA 3HJAA 1E1RD 2ZGVA 4TOIA 3MJHA 4CTNA 1SQ0A 4YMIA 1IY2A 2J3QA 3PDWA 3RU2A 3MQFA 2VT7A 4KYVA 1E1MA 4FOSA 1C3EA 3G9QA 3NRJA 1OX6A 2MSNA 2V7GA 2ZJAA 2E37A 1E7YA 3FTDA 3VR5A 2A33A 2YUIA 2JZCA 1R8XA 4FMCF 1PGJA 5DW0A 2VDJA 4P7KA 4Z0NA 4X0EA 2WF8A 3IX7A 5EMHA 4N3GA 2BPOA 5I3CA