5EQJB

Crystal structure of the two-subunit trna m1a58 methyltransferase from saccharomyces cerevisiae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
373
structure length
319
Chain Sequence
NCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTFAFVHVLQPTPELWTLSLPTQIVYTPDSSYIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVGHLFSFEFHHIRYEQALEEFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHIKEGDSNYKWKEVTKMEAEIKSHTSYLTFAFKVVNRSRDDEKVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the two-subunit tRNA m(1)A58 methyltransferase TRM6-TRM61 from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase
molecule keywords tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subu
total genus 86
structure length 319
sequence length 373
ec nomenclature ec 2.1.1.220: tRNA (adenine(58)-N(1))-methyltransferase.
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 5eqjB01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5eqjB02
3B89A 3UJBA 3VSEA 3KPJA 4FP9A 2XYQA 3GU3A 3G89A 3LCVB 1RI2A 2ZULA 4RVHA 1XXLA 3DLIA 4PNEA 2AOVA 2V74B 3HVIA 2CMGA 3E23A 1BHJA 5F2KA 4GOLD 3GJYA 3PVCA 3BWMA 5GIOE 1WG8A 3HCAA 2AOUA 4XUCA 3KQWA 2O06A 4KVZA 4EK9A 3OPNA 2ADMA 4GUAA 4X41A 4POOA 5HIKA 2OYRA 3EVEA 4PCLA 1MJFA 2EX4A 3HEMA 4KRGA 3X0DA 4A6DA 5BP7A 7MHTA 1L3CA 3PB3A 1NW7A 1N7IA 2B25A 1KXZA 2A14A 3MB5A 2YXEA 3NDIA 3NVKI 3GNLA 5EHIA 5E1BA 4L7VA 4LWPA 5CCBA 1KPIA 4DCMA 4C4AA 1KYZA 2AN4A 3BWCA 4R6XA 4MHTA 4E30A 4AZWA 1QYRA 4WXHA 5DTMA 3QV2A 3GRZA 5HZMA 3M4XA 4FSXA 3I58A 3I53A 3OZRA 4RTRA 2AOTA 2YQZA 5ICGA 2FPOA 4DM3A 3LX6A 4CKCA 2YUIA 1JQ3A 2HWKA 4OA5A 4F86A 3EEOA 5EIWA 5EKUA 3GRRA 2JHAA 1RI5A 3LDGA 5EEHA 4K6MA 4NECA 3HVHA 4EKIA 2P7IA 5FADA 1RJGA 1RJFA 1Y8CA 3OU6A 1UWVA 3EVAA 5C0OE 3TR6A 3UZUA 1VP9A 2G8NA 2ZIEA 1NV9A 4O29A 5EKXA 4JXJA 1JG2A 2O57A 3BGIA 3P71T 3PFHA 2PJDA 3GO4A 2V7EA 5HILA 3G8BA 5LQKA 4RTOA 2BM8A 4EKGA 3C3YA 5LQRA 2AOTB 2JH9A 3THSA 2PSSA 3GWZA 5EGSA 4RTSA 3Q7EA 4E31A 1YZ3A 2HMYB 2JJQA 5EQJB 2JHPA 3V97A 4DZRA 1O54A 3AY0A 4E2YA 2F8LA 3A7DA 3LDFA 4KDRA 2NXNA 2NXEA 3ER8A 2PX4A 3M70A 2ZZKA 3EVDA 5GINE 1JQEA 4R6WA 1F3LA 5E1OA 2HTEA 3FRHA 4PYNA 3C6MA 2B9EA 3SX0A 2P3LA 2XVMA 5T6BA 3M6VA 4HSGA 3FZGA 4GOMD 1TW2A 4F84A 2GB4A 1BC5A 2PBFA 3I9FA 1NT2A 4Z2YA 4ER0A 4GEKA 3V8VA 2C7OA 4YUWA 4KIFA 5KS2A 3JWIA 4KWCA 4CXMA 2Z6QA 3ID6C 2YXLA 1VL5A 4PIMA 1INLA 2WA2A 1WY7A 5K0FA 5EIFA 2O05A 2HV9A 4HTFA 2ZLBA 4P7KA 3JWGA 5E9QA 5HIJA 3BXOA 3UA4A 1DL5A 2Q41A 1H1DA 2QE6A 2P1DA 3DLCA 5EMJA 4P7GA 3ERCA 3UJCA 3KPUA 3PT9A 5P8WA 1MHTA 5T64A 4U7PB 1XVAA 1P1CA 1WS6A 5EEGA 5E8JA 1EIZA 2CMHA 2PGXA 3TOSA 3UJ8A 1ZGAA 2ZIGA 4AUKA 4GBED 3F4KA 4HTFB 5GM1A 1XDZA 3FPHA 4DF3A 2H00A 2P7HA 3GGDA 3ANXA 4C07A 4FZVA 1ZQ9A 1BKYA 3IEIA 5JR3A 3AWIA 4LG1A 5FQOA 3DOUA 1EJ6A 5U4XA 4V0RA 2CWWA 2Z6AA 2Y1WA 2YTZA 3G2OA 4X60A 3K0BA 3TRKA 1QANA 5CCXA 4OX9Y 5ERGB 3HM2A 1XJ5A 2ZZNA 2PVCA 1SQGA 2VS1A 3M33A 4QPPA 4XUDA 3SM3A 3ELWA 3TM4A 3LBFA 2G72A 4LWOA 3FTFA 4RTMA 4BY9E 1RI4A 3KQSA 1RJEA 2NXJA 4CKEA 2ZWVA 5HEKA 5LQCA 3HCFA 1I1NA 4ER6A 3MHTA 3AXTA 4EMSA 2CKDA 3NTVA 5FQNA 1NW3A 1V39A 3G2MA 1AQIA 1EJ0A 3HCDA 2GLUA 4HGYA 4PINA 1ZKDA 4IV8A 4MQ4A 2VDVE 4IV0A 3UA3A 4BLVA 5K8VA 5LQNA 2AS0A 4U7TB 2UYHA 2EG5A 2VDWA 3MQ2A 5FTWA 2PWPA 2PXAA 3KQOA 1G55A 1XCLA 3CJTA 3P97A 4FSDA 2O07A 3LCUA 5C1IA 5GOZA 3C6KA 2UYQA 4GQBA 1YFJA 2IDKA 2IGTA 5DX1A 3SR4A 5E1MA 3T0IA 2G1PA 2XYRA 1G6Q1 2QYOA 5K01A 3TFWA 5DTQA 8MHTA 3FPJA 2IFTA 4YUVA 3G5TA 1SG9A 3TMAA 4RTNA 2EJTA 2XYVA 2ESRA 3S68A 3LKDA 4RVFA 3UJ6A 1VPTA 4F85A 3P9NA 2AN3A 3FUXA 1NW6A 3KPVA 4M7RA 2ZZMA 2UYOA 1R18A 3CCFA 3G8AA 3LGAA 1JG4A 1YB2A 1KP9A 2B3TA 4IWNA 4P58A 2DULA 3PX2A 1FBNA 2K4MA 1RI3A 4ISCA 2NXCA 2H1RA 4PYOA 4DA4A 4KIGA 3FUTA 3R3HA 5CIYA 1X1BA 4RVDA 3MAGA 2GS9A 3GDHA 2C7QA 2AVDA 1M6YA 2WA1A 1UIRA 3P8ZA 5BW4A 2FK7A 3ELYA 1G8SA 5CUQA 3EVGA 5BXYA 2IH2A 4AX8A 3BGDA 4DMGA 3UWPA 1KIAA 1WXWA 3DXYA 4CKBA 2ONYA 4RTPA 3CVOA 3HA3A 4DCGA 1PJZA 3ELDA 3DTNA 3EPPA 1Q0TA 4QQKA 1OR8A 3DMFA 4RX1A 1KPGA 4QPNA 5DX0A 3LSTA 5E9JA 3SSMA 5DSXA 2PT9A 3E05A 3IHTA 1TPYA 1VBFA 4QTTB 4P7FA 3OU2A 5FA8A 5EZQA 5K0NA 2ZBPA 4FS8A 4RTKA 2Y1XA 1R8YA 4IKPA 1L1EA 4XCXA 4PCAA 2I9KA 2ZCJA 3K6RA 3T7RA 2CL5A 5EOVA 1QZZA 5H02A 1BOOA 4YV0A 3GRVA 4YMGA 4E2WA 4RYLA 5MHTA 3Q87B 5DM1A 3VYWA 2ZBQA 5FHQA 5DM2A 3OFJA 3GRUA 3KQPA 2NYUA 5EVJA 4M37A 2XVAA 3P2IA 3KQYA 4RWZA 1QAQA 5LQUA 3C3PA 5EHGA 2C7RA 5K0GA 5E2BA 1X1CA 1M6EX 4BP1A 3FYDA 3G2PA 4RSRA 2GPYA 3HVKA 3MERA 3T7SA 1JSZA 3CKKA 2IDJA 3EGEA 2ZFUA 2N47A 2JHCA 2ERCA 2OB1A 2ZBRA 3DH0A 3EVCA 3HCEA 4FR0A 4C06A 4YUZA 3OE5A 1JG3A 4Y30A 4DKJA 1FP1D 2AOWA 3G88A 1ZGJA 1R6AA 3KR0A 2HR1A 2BM9A 2BR3A 1N2XA 3TPZA 5FCDA 9MHTA 1PRYA 1N7JA 3KU1A 5DTRA 1Z3CA 1SUSA 3CGGA 2GA9A 2OO3A 1P1BA 3MCZA 4PYMA 3QOXA 2UYCA 3O31A 2P3QA 2B78A 1R74A 1U2ZA 2OY0A 3BUSA 1ORIA 3KR9A 3FTCA 5HIIA 1SKMA 3DMGA 3KR2A 4X1OA 3FUWA 4C08A 4QTUB 5KQRA 4AZTA 3GCZA 3P9CA 1VIDA 4QVKA 3CBGA 5DRYA 4B17A 4ZTBA 3R6TA 4PGGA 5GM2A 3NWEA 2OZVA 1EAMA 2ZIFA 4HG2A 4PYIA 4ER7A 3NDJA 1TW3A 3P9KA 4OQDA 2OBFA 3A4TA 2JG3A 1X19A 2QRVB 3TM5A 1G8AA 5D1NA 4OBXA 3IV6A 5CD1A 1VP3A 2PXXA 1FPQA 5HOQA 3PTAA 1FJXA 1JR4A 2C7PA 4M38A 2VDUE 3HCBA 1VQ1A 5B1SA 3REOA 2QY6A 1O9HA 2R3SA 1WZNA 2PX8A 3DXZA 3E7PA 5CVUA 4E2XA 4E2ZA 1YF3A 1KYWA 4C05A 3CJQA 5K0BA 2ZTHA 3TQSA 2R6ZA 1ZG3A 3M6UA 1QAMA 3MTIA 5DM0A 5DPMA 2YX1A 5FULA 3UFBA 4YV2A 3BZBA 4UOEA 5K05A 2NP7A 3O4FA 4Y2HA 3FTEA 1IY9A 3HA5A 3NWBA 5K09A 5LQJA 2ZSUA 3GRYA 3G7UA 3OFKA 3UBTA 5FWDA 3SMQA 3T7TA 5DWQA 3KQVA 1HMYA 4PYJA 3ER9A 5CVEA 3SXJA 5ICCA 3DUWA 5LSAA 1L3BA 2I6GA 5ICFA 3R9XB 1KPHA 5ICEA 3L8DA 1RJDA 3PX3A 3IYLW 5DT2A 1F38A 1I9GA 5K0EA 2ZVJA 3M6XA 5HIMA 3HTXA 3TKAA 4C03A 1G60A 1RI1A 3B5IA 3R24A 4MIKA 2DPMA 5E9WA 5IKMA 4BLWA 1O9GA 3B3GA 1XTPA 4AZSA 1JG1A 5K0JA 1FP2A 3NW9A 3GIWA 2YR0A 5LQAA 2ONZA 4EQZA 1P39A 2FCAA 2KW5A 4WVLA 5E1DA 3QOWA 3U81A 3MCTA 4M36A 3A27A 3RODA 2G71A 3SSNA 1JSXA 1X1DA 3ELUA 3H2BA 4YUXA 5G02A 3B3FA 1NBHA 2HNKA 3DP7A 5KYGA 3P2KA 5EMKA 1DCTA 3WSTA 3CJRA 3FUUA 4FT2A 3UJAA 3EVFA 5F2NA 3FPEA 5KQSA 5DX8A 3BKWA 1D2CA 2AN5A 2P35A 3FYCA 1AF7A 3HA7A 3P9IA 1NE2A 3O7WA 4PYLA 5E8RA 5F2OA 3SVZA 4DQ0A 4A6EA 4RTQA 5EZSA 3KPYA 3HP7A 3MTEA 4ER5A 2LD4A 4QDKA 4R8SA 5EMMA 4C04A 3BT7A 2OXTA 5KVAA 3G2QA 1KR5A 4KDCA 4OQEA 5GWXA 3SSOA 4ER3A 3OZTA 5E2AA 2FHPA 1NW5A 2QM3A 4HC4A 1ORHA 4GOOD 4QQNA 5DXAA 2AOXA 2UZ4A 4CTKA 2PY6A 3NMUF 4V0QA 4R8RA 3HCCA 4E70A 2G70A 4RV9A 2P3OA 3EEYA 3CC8A 3THRA 1VE3A 3KQMA 2NP6A 1P91A 1Q0SA 3KQQA 2PX5A 3FTDA 4FT4A 2P40A 5FUBA 3TKYA 3G5LA 1QAOA 5JUWA 2E5WA 4PGHA 4CTJA 5EC8A 1IM8A 4RVGA 5DSTA 2BH2A 3VC1A 5LR6A 2IP2A 2YVLA 3DXXA 1D2GA 3DULA 4FGZA 2PWYA 2AR0A 3BWBA 3E8SA 2XBMA 3R0QA 2ZWAA 1R8XA 1XDSA 4G56A 3UJDA 3SGLA 3UJ9A 1HNNA 5EMLA 3EVZA 2PLWA 3GXOA 2JH8A 3BKXA 2BZGA 3EMDA 1UFKA 5K0CA 2AVNA 4RTJA 3B3JA 2IIPA 3KHKA 2PT6A 3B7PA 1AQJA 1AV6A 3OCJA 5FWAA 3LL7A 4RTLA 2Z6UA 4CWAA 3ORHA 4HRAA 2ZW9A 3UJ7A 1YFLA 3EGIA 5EG5A 2IH5A 1WXXA 3I5UA 1JTFA 1SQFA 3LECA 2AOUB 3KR1A 1D2HA 5K0LA 3AJDA 1XCJA 5K03A 4ATNA 1NW8A 2QRVA 2OKCA 1EG2A 3NJRA 5C9ZA 3LHDA 3OU7A 2GAFA 1IXKA 1L9KA 1YUBA 3JWJA 3M6WA 5FA5A 1NKVA 2P41A 4PWYA 2O0LA 1XDUA 4H0NA 4EVIA 2EJUA 4LECA 3NVMB 5CM2Z 3JWHA 2NNWB 2PXCA 3ME5A 1JTEA 5DLYA 2IBSA 1JQDA 3D2LA 4P7JA 3FPFA 5GP1A 2FRXA 5GIPE 5CVDA 3LPMA 3PLAE 1YZHA 4OA8A 5DRTA 3LDUA 5DXJA 1KHHA 2AZTA 1R00A 1NBIA 2OB2A 1SVUA 5IH3A 4PYQA 4MTLA 2PV0A 3I64A 4AZVA 1G38A 3A25A 1VLMA 1X1AA 3DR5A 3KKZA 4OBWA 1M0EA 3VC2A 3AXSA 2VP3A 2BR5A 2IBTA 3FUVA 3KQTA 4E33A 3BWYA 4PONA 5FHRA 3EVBA 3HNRA 2GH1A 2YXDA 1L3IA 2IH4A 3FRIA 3A26A 4KW7A 3KPWA 4QDJA 1NV8A 2BR4A 2B2CA 3FPGA 4BLUA 4YMHA 2H11A 4QVGA 5EPEA 3EGVA 2EFJA 4X63A 2I62A 5M5BA 3LCCA 4BP3A 2PX2A 4PIPA 2WK1A 3OZSA 3A7EA 3PFGA 4X61A 5CVJA 4E32A 5D1HA 5T67A 4XUEA 10MHA 2P8JA 2I7CA 2IPXA 3BGVA 3PS9A 3OE4A 4PYKA 4YV1A 2VZ9A 3MGGA 4GF5A 1SUIA 4GC9A 2FYTA 4MWZA 5DM4A 1EQAA 1ZHFA 5CVVA 4HGZA 3C0KA 3RIEA 4YUYA 2ORED 3HVJA 4GOND 3P2EA 1T43A 4R05A 4HH4A 4GC5A 3TLJA 2PKWA 3LBYA 1B42A 3DMHA 3LKZA 3EMBA 3RW9A 5BW5A 1I4WA 5HFJA 2OPBA 1DUSA 2FK8A
chains in the Genus database with same CATH superfamily
2G76A 2I2FA 2KSQA 3EQ6A 3KPJA 3L6BA 3YASA 1E0KA 5I9NA 1UCFA 2ZULA 4IF6A 2O19A 3GLFA 1GA4A 2ZIZA 4YO8A 1ZRNA 3R40A 3N7UA 3N8KA 4OQ4A 4TYMA 4XIFA 2OG1A 3PVCA 2H1VA 3CE6A 2ZJYA 2WG0A 4ASUD 5HIKA 4DMUB 3G5MA 3O94A 3EVEA 3LWZA 4BPBA 4KRGA 5EE0A 3X0DA 1U1GA 1Y82A 1X70A 1U5BA 3SLRA 3KYCB 4PZZA 3TOXA 3IIIA 2Y99A 3ZTTA 4OIMA 2ZIXB 4FONA 5DIZA 4DCMA 1C29B 1MQSA 4DMLA 3EG5A 1YRYE 2C2BA 3NWPA 3OKAA 2H2HA 4LJ7A 4G5RA 2W6JD 1T3LA 4BS9A 4U9IS 3ILSA 1NVAA 4PV7A 2J30A 5CLFA 4JI2B 1R0ZA 2FPOA 4HNQA 1ZMTA 4OJQA 4L0QA 1X7DA 4PQYA 3FUCA 3QKWA 4UC4A 1LPAB 2GUGA 1OZFA 2RHBA 4Q6WA 1EVIA 3V9AA 3B9BA 1H1TA 3M4JA 1GRRA 3L9WA 4OREX 3GA7A 3TZEA 3FHTA 4I55B 1N7GA 2FPGA 3QUQA 4JLDA 1H6DA 1AZSC 2B21A 3LT5A 4OK6A 2VPXA 4OAOA 4FC7A 3W90A 3CEAA 4N6NA 1SXJA 4B6RA 3W5CA 3RT1A 4WECA 3BORA 2VC2B 2VJQA 1T6XA 3ILHA 3WTBA 2HRCA 2PN1A 2ZYGA 5LA6B 3A1VA 2P27A 4WSOA 1AE1A 1EDOA 3FNHA 3AW9A 1OLOA 1J49A 3IKMB 4CIBA 3VR4H 1BEZA 3WOHA 2HMWA 3D1JA 4GPD1 3QMVA 3HL4A 2ZJOA 3JALA 3ZDRA 4QYWA 1ZH2A 1KI3A 4BFYA 1XJ0A 4QBHA 1EE9A 1I3KA 3RM3A 4X1YB 2B9EA 3CF2A 2FMHA 3MGCA 4Y98A 2VA8A 3SX0A 3B9RA 3JQEA 1G3MA 4DEXA 3QVXA 1MB9A 5C1BA 2WWXA 1TO1E 2PWBA 1SC9A 3S44A 3KJGA 4Z4IA 3DVAB 3QWAA 4KIFA 5H59A 2C7OA 1GTJ1 4W1RA 1HNXB 4YLYA 1BA3A 1VGRA 2BEKA 1BVRA 2QMOA 3DAPA 4JXZA 4D3SA 1PWHA 4EUKA 2GBLC 5TY0A 2EL7A 1T4BA 3JWGA 3RC8A 2XDQA 2PRIA 4LXTA 2QE6A 3FBGA 4WGFA 3D6TB 4WPGA 5TXGA 1Q5PA 2G7ZA 4FHEA 1FVOA 1MKYA 3KLPX 4LI3X 4Q18A 2XUQA 5E4TA 2NG1A 5IVHA 1DAHA 1M1NA 2V4UA 1GXSB 3EAFA 2GERA 6REQA 4CGZA 1WS6A 2ILVA 3PUJA 1NPYA 2R6R1 3FOBA 3LGXA 1DC3A 2ATCA 5FUXA 3RTCA 3U6BA 2W83A 1PTJC 2C8KA 3GFSA 4RHUA 1U6IA 3EY4A 4GBED 5KSZA 3C4QA 2ZJ7A 4P3YA 3IPLA 1JKMA 4MYRA 2XXAB 3R5KA 1XDZA 3ROZA 1JDSA 5B1YA 2CZCA 5K3FA 2JDID 4EMUA 3QM1A 1DKLA 3M3PA 2C4VA 1FFDA 3NEYA 3ORQA 3RWBA 3WWEA 3OQHA 4F96A 2QVLA 4I3GA 2Z6AA 1JIJA 2Y1WA 1U5CA 4ZA2A 3Q9UA 4CEIA 2GAJA 3LI2A 3AHEA 1YZVA 4IFIA 1C3LA 1W4RA 5JMTA 3AO0B 4AKSA 2VNKA 3DT6A 4DTCA 4YCNA 3QUCA 3TM4A 3IPYA 1E9DA 2G72A 3PXGA 4ZAZA 5FPQA 4BY9E 3ZOZA 1N3LA 3DNPA 1X7WB 5HEKA 5BYJA 5EP3A 4P3NA 3MGAA 2CLMB 4X54A 4OI2A 2O3QA 1M2GA 3WKEA 2H4JA 3AGPA 4FBMA 4ZYLA 5LP1A 1M6VA 2C31A 2BDEA 4YMTA 1SUCA 2PMEA 4S3MA 4HADA 2V8BA 4LGCA 4C5BA 5A2GA 1N1DA 1N34B 1YK0A 5ESDA 4QUDA 1YDHA 5AHXA 3F97A 3ESQA 3QW2A 3FTNA 1KS9A 3KZCA 3KJIA 3L43A 5I7FA 4YP5A 5C1IA 1E63A 2HQBA 4TKUB 5GOZA 1V11B 1FDRA 2HNBA 2JCBA 1N78A 1FB5A 1V8FA 2MSLA 5A5DA 3OHSX 4RANA 3EPJA 1N2EA 3D0RA 4LN1A 5B3AA 1KAEA 1V11A 3C8ZA 4CKYA 1Y3HA 3V8BA 4A92A 4GPZA 4UTRA 2BSXA 2CHVA 3JR7A 5KNBD 2DBYA 2L0XA 4A9AA 2BKAA 1N6NA 2YXPX 1CHNA 1NJGA 4LZOA 1QGZA 4IP0A 5KAPA 4BFZA 4BO0A 3PPIA 1HE5A 2IWRA 5J47A 4W6ZA 4YJ2B 4I14A 3G2JA 2XKJE 3HMQA 5E9AA 2D2IA 1XMQB 2ECPA 2ZUFA 4LCJA 3HNOA 4Y7DA 1T5DX 3IRVA 4WN3A 2ZT8A 3BK1A 3FGZA 3PC8A 4HQ0A 3A9CA 4IBOA 1P62B 3RPEA 4KIGA 2RMKA 2JL1A 2OFWA 4G0UA 2HYDA 1LFDB 4LQDA 1Z6YA 4NENA 1TAHA 2AVDA 1GG8A 5JS2A 4B83A 1U9YA 5ABPA 1LSOA 2AE2A 3OF3A 5HPYB 1UPXA 4FSHA 2H4YA 1ZNXA 2XADA 4JJ8A 4DMGA 4KXYA 1KIAA 2G3YA 1QSGA 1T29A 1UMCA 1XR3A 1E1RD 4HQOA 3VU3A 1SURA 4FMDF 4BRWA 3PVSA 4Y6PA 4ETIA 4Y3UA 3ZHQA 1X0VA 2VP2A 4Q1BA 4R0VA 4RX1A 5DX0A 1KEWA 5A3SA 3VZSA 4W5OA 3IHTA 2VZ0A 2W4MA 3AEQB 2R2AA 4QJ4A 3ZLVA 4MW6A 2CYBA 2C3UA 1R8YA 4JSYA 5EJAA 2ZCJA 3ZWKA 2A3RA 2G0TA 2HQOA 2Q0HA 1MJHA 3H8SA 3HKBA 1Q95A 4PFJA 4PHCA 3AB8A 2QORA 2PMFA 3N2EA 4FOPA 4DSZA 1Q50A 2FAXA 2VZEA 1CF4A 1LF0A 1RW4A 4J76A 3ZHVA 1WQ4A 2CMKA 1D2AA 2HF2A 2OD2A 4RFSB 4E12A 3RNOA 1WETA 1TKCA 1TZCA 3FGOA 5EJFA 2AHRA 5CDUA 3GELA 4OMDA 2K7ZA 2RKOA 1QIDA 4DBLE 4MLDA 5D3MA 4R2JA 5K0GA 4DDUA 1FUKA 1DKRA 4ROTA 3VKHA 3BWVA 2RGYA 2C84A 1Y5NA 3EEBA 4FKMA 3VYUB 1ZUWA 4JOCA 5DW0A 1YS9A 3EVCA 3SI7A 1RLJA 4R84A 1KK0A 3VH2A 3H9JA 4DKJA 4HYTA 1VJCA 2FWBA 4LHSA 3SF8A 3WGKA 3UWOA 3F0TA 4KXVA 5C1OA 3UIEA 3BL6A 3TLKA 4QICA 2O2YA 1EP2B 1ZINA 1SU4A 3PC3A 1N7JA 1SCKA 1S8NA 4PCVA 1E6MA 3AY6A 3IJRA 4K8OA 4I8XA 3T9CA 1EVJA 4CT4B 1XPJA 1ZGZA 1H9CA 3PR2B 2VAVA 5CH3A 4ZT7A 1U2ZA 3LD9A 4H0FA 3UATA 5SYMA 1E2LA 3GP5A 1BE0A 2EP7A 4UTPA 1CUZA 3FMOB 4G36A 1IXZA 2RAUA 5AW4A 3TEFA 3MW8A 2VP0A 3DDNA 3V8RA 3CBGA 2P62A 1BS9A 1EX1A 1H2AS 2XUPA 3F5SA 2OZVA 1E9EA 1QNLA 3MTJA 2Y2UA 4Q3BA 2QTWB 4RD6A 3RAFC 1A8UA 5CNMA 1FC0A 3R5XA 4X95A 3CEHA 4G5GA 4DY4A 1X19A 3L7OA 2VN8A 1XOIA 3CRW1 5GV7A 2IS6A 2ZDGA 2CNLA 3G2IA 2NAPA 1I3LA 1Q74A 5HRAA 3G23A 3HUEA 1CY8A 3NV9A 4HQRA 1BMQA 3EGCA 1R5BA 1Y63A 3CNLA 3TBHA 4MQEA 3HWX1 3AZQA 1VE5A 5MDHA 3WA6A 1WB9A 3FCOA 4KWTA 3CJQA 1E18A 4H15A 4YXFA 5I7AA 1JDBB 2ZE5A 1TJ3A 2EX0A 4NCBA 4OI1A 4IDOA 3VMMA 4DNFA 2XITA 3C87A 4RQUA 3TIXB 1X74A 3KJXA 2OESA 1E9CA 3I5YA 4F5DA 4LRTB 5EWJA 4CMEA 1JEQB 4DV5B 3AI7A 3RRMA 2Q5CA 2AG8A 4R1TA 4DGSA 2FXVA 1UK6A 1FX0B 4ZZ1A 2JRLA 2RBKA 1CZKA 2Z1MA 3H0EA 3FVVA 4NZ9A 1ONPA 1USIA 5A9TA 3MZ0A 4GNRA 4MS4A 4H3VA 3TO5A 3GEMA 3ER9A 5LPNA 3KEQA 5LSAA 3EF1A 3K0CC 3FPRA 1SIOA 1U3VA 3GV0A 4HVAA 2X4DA 1B41A 4MICA 4U6NA 1EWKA 4NHOA 1VZ2A 3EDCA 2DKFA 2Q1SA 1UM8A 4MQMA 4ZVLA 4U7HA 3E5RA 3U9TA 3TI7A 3VH3A 1GQRA 1NSTA 4IFEA 3L4KA 4QDZA 1WSAA 1IBRA 4PAQA 1QV9A 5I8ZA 5KREA 2W48A 4EUNA 3FNEA 1T2NA 1NNEA 1VFNA 2P9CA 3A3NA 1V8DA 5IARA 5AYVA 3L84A 2FPPA 1CY7A 1QLWA 3U81A 3KTFA 4RFLA 4BVFA 4L02A 2VJKA 3HQ4O 2VUHB 4LJSA 3S2EA 3UTCA 2ZJZA 1TXGA 3DP7A 3NM4A 1DCTA 2YHBA 4AJJA 3UJAA 5LQAA 2HFKA 2RDMA 1A3CA 4BLSA 1SIBE 5KWEA 3OIGA 3RTBA 5D51S 3TD2A 1OQAA 1ZI6A 3ITEA 1NVDA 2V3WA 4HXFB 1TF7A 2PL1A 2OYCA 4DQ0A 2VSNA 1AHHA 3A05A 4YJ3B 4DIMA 4CLHA 5AVXA 2HNAA 1PG5A 2C99A 2LD4A 1BDJA 5EMMA 5I5EA 2FJPA 5BYBA 1PEYA 2LRHA 4K9DA 1FNDA 3G9UA 1PL7A 4CJXA 1O3YA 2XD9A 4PC3A 3NMUF 2FB9A 4K5QA 4R8RA 4QTYA 2KE5A 2XECA 5C18A 3WIUA 3I42A 3QWBA 3AEKB 1EFLA 1XQYA 3MNFA 2IHVA 1ZN7A 3IX7A 1ABEA 1T6YA 5A4AA 5ITWA 2PLRA 5JQWA 2NGRA 3SG0A 5DBIA 2XT6A 3KKKA 4BKOA 1QQ6A 2OHJA 4RVGA 3JWEA 5JTTA 2Y4NA 4HVCA 1JX6A 1OXUA 1Z7GA 4L7QA 1BXRB 4WZBA 3UMCA 2C77A 5F52A 4AS2A 5IMBA 1CUYA 2VBIA 4OK3A 1E4EA 4KX5A 4BVGA 1IUOA 2COEA 3NM6B 2VDPB 4C01A 4YAIA 2QV0A 3ZWOA 1F2UB 3GFTA 3H97A 3P0JA 2JH8A 2I2WA 4ZMRA 4KKVA 4UTZA 5AICA 5KCZA 1ZEJA 2XYPA 3PSHA 3HDTA 4FHDA 3KRTA 3MD0A 4NBKA 1DADA 4X24A 4HFJA 3TTTA 4FHFA 4ZVQA 2QVBA 3EGIA 5CX1B 5ECWA 2H5IA 1RR6A 2DKNA 4L2IB 2VT3A 2I1QA 4P83A 4DWOA 3EUAA 2WB4A 1XZJA 3AJDA 1Z37A 1N9GA 1UOEA 4KR0A 5GJVC 3ETNA 3QELA 2QMEA 1OXTA 2XCSB 1OZ0A 1W73A 2D1RA 4BCBA 1QWOA 4MEJA 1E20A 4B40A 1JW9B 3NALA 3TQCA 3A2LA 2PG3A 2FN4A 3QXSA 1WVGA 2CLFB 2QRNA 5CT5A 2JFOA 3NVDA 5NULA 2QNBA 4NFYA 2CNBA 2QX7A 5DNDA 5FDFA 2IZ6A 3QQ7A 1EK1A 2LDBA 2PUHA 1I4LD 1QIMA 3KWJA 3CYFA 5LXTF 2NUPB 3BL5A 2QL6A 1R8JA 2EP5A 1ULUA 2BJHA 2LUOA 3I64A 3I76A 2FW1A 2ZTVA 3JQCA 4GGOA 1VLMA 2H2FA 4JJZA 3ZHBA 4C22A 1HQDA 3WLMA 1XMPA 2HHHB 2ZVPX 1JAZA 1VB5A 2VSFA 2IBTA 4BE7B 3IB3A 4Q1DA 5FYQA 3BWYA 2A86A 4ARSA 1FU8A 1Z4NA 1X9GA 1W75A 4G2NA 3WTCA 1KZ9A 3PNSA 1L8OA 1Z4JA 3FRIA 2R62A 2P4HX 2GARA 1I5EA 3FPGA 2PTHA 3H5TA 1E3QA 3COYA 3OCUA 3WK6A 3ZGOA 2KY9A 3W06A 3SPXA 3QRWA 4ML3A 3N0VA 3SLKA 1FP4B 1Z4MA 2F1OA 4H1VA 2I6UA 2BWJA 4E32A 1O6CA 1EB8A 4H9GA 4P36A 1PEAA 3LC0A 5EYPA 3L77A 4ALJA 2Y93A 1HT0A 1RXYA 5KHLB 2P69A 3KOXA 3LKBA 1DRJA 4ND3A 3MGGA 1EFVB 1YR8A 2JFZA 5DM4A 1CZ4A 4OL0A 1L4LA 1E2FA 3D4PA 4MRPA 4I4IA 1D9XA 2QUIA 3TIFA 1MUUA 1MAAA 5HFAA 2REBA 4EJ6A 1MNQA 1EK6A 4DLWA 1AXGA 4POAA 2K2WA 3EMBA 1JDZA 1ZMXA 2N47A 1DUSA 3AF3A 2ZQZA 1QRUA 1YVPA 4NAUA 1ADGA 1RJ9B 2P1ZA 2X77A 3NHBA 1WLFA 2A1IA 1Y6GA 5CNKA 2C9ZA 4ZOAA 1VRCA 2QQ5A 4BNDA 4ES6A 2Q19X 4HGOA 2AG0A 1ZOSA 2AHOA 3GJYA 3GRKA 3CX3A 5AI4A 1NNI1 5ALZA 1P5RA 2NO4A 2D13A 1JFLA 2ZEJA 2QTAA 4GOKA 5KTSA 2AB0A 1T5SA 1W5AA 4C6RA 3HYTA 1J90A 3NC4A 4I8IA 3EC2A 3GZNB 4IKEA 1H8HD 4N3NA 4TROA 5IF3A 3NVKI 1JPJA 2JEOA 3DV9A 4F5WA 5FH9A 5JTUA 4AYXA 5ARBA 2XVYA 3CRVA 2E4XA 2R5NA 2WPDD 2PBLA 2BUBA 4B0PA 4RTRA 4CG1A 4LQ4A 1YOBA 2AOTA 3ZVRA 4HD8A 4CCWA 2CKMA 1PUXA 2GESA 4CIAA 2DUWA 4IIDA 5J63A 3Q7PA 2IYEA 3A6FA 5LOVB 4DV7B 3GRRA 1X7HA 3N28A 3Q3EA 4YJGA 5DBOA 3UT5A 2I29A 1LQTA 3QXCA 1SFRA 3I23A 3T95A 2DTXA 4ONEA 3SS9X 5K1ZA 5C0OE 3T4XA 2XCQA 2ZIEA 3O5AA 3UJHA 1AB6A 1PJTA 3VO2A 3FOFC 2VRCA 3DAOA 3Q2IA 1HTTA 1Z0JA 4M9ZA 1I1QB 1ONOA 2BM8A 1QTNA 4GIBA 4H18A 3ZWAA 3TDKA 3ND6A 5DNUA 2FQ1A 5F7JA 4EQ6A 1SVOA 3G2KA 4RTSA 3TRDA 1WXGA 1DV1A 2JHFA 5BSUA 3TSYA 1Q1QA 2R00A 2EYQA 1FRQA 4KFRA 4NSNA 4QJBA 3NGMA 2EWMA 3PR3A 1FQKA 4L8WB 5FL7A 4CT0A 4NJEA 3NFYA 1Y1LA 3HYSA 1NT4A 1UDRA 3A36A 4RAOA 2CUTA 1CY1A 4PYNA 4YN3A 2IYNA 3RTDA 3T7IA 1FFXA 1XPUA 3DUFA 2B36A 3KM0A 2HEGA 4ED9A 4QGSA 1IN8A 3DV2A 2Z83A 1ACLA 2AK2A 4N40A 1KQPA 2G9UA 4BGUA 5DMXA 2ZM6B 2BLNA 1G8MA 3ZDQA 1B0ZA 4Z2YA 5DBHX 1G4HA 2EKZA 5BT9A 3RJ9A 1FDOA 1R4MB 1RWVA 1B8PA 1NP3A 3WGGA 4NICA 4WD3A 1JL3A 2G83A 2A30A 1FVXA 4YCLA 3INTA 2OZPA 5A5VA 4DZTA 4JDPA 1WZCA 1MMFB 1FK8A 2ZLBA 3IESA 1Y6ZA 5GONB 1SXIA 3EFOA 3L4BC 3OFVA 3ESDA 3OCXA 2IVZA 2NXWA 4A6XA 2BEVB 2EDCA 2RGEA 2XKKA 1F5NA 4IJ5A 3IUSA 3WGMA 4HQFA 2OFXA 3SOPA 4PGMA 2GYVA 2AFIB 3UMYA 3SE0A 5HVNA 1JRLA 1VYTA 4LPKA 1K2WA 2MR5A 1ZUNB 1M6NA 4PZ9A 2Q8PA 2L82A 2G77B 4Q3KA 1BN7A 3EPHA 4I99A 3UJ8A 1U2DA 2CVZA 5I6DA 1P4GA 1NYLA 1WSBA 1Z0IA 4PBSA 3ANMA 3TBFA 4D96A 1LTKA 4XVCA 5HRUA 2WU1A 3IUEA 1XWWA 2YQ4A 1NVUQ 2F2TA 1KEEB 4MRAA 4YO7A 5A04A 3IP5A 2AQ8A 2P7HA 3VDNB 2HO4A 3EZGA 1AGYA 3NGLA 4D42A 1I94B 2N42A 3H17A 2H2AA 3BBLA 3SX4A 4EG7A 3UAWA 1N32B 2CWWA 1K89A 4LSWA 3A3OA 1W5EA 2IDZA 1IG0A 2GHQA 4EB3A 5JBNA 5KEIA 2XE7A 4WXRA 1O08A 2SHKA 3HM2A 2V6IA 2WSLA 1U7DA 4DS3A 4AKEA 2VS1A 1R0KA 2CLDX 4UEQA 1TT5A 3S6JA 3LYUA 4K9NA 1BW9A 1BX0A 1M1YE 2TYSB 2NXJA 4KE7A 2ZWVA 3WICA 3VO8A 4C3VA 5B7GA 4QASA 5HS4A 5DCUA 1KORA 2ERYA 4PU0A 3KKOA 3E9NA 4D8UA 3NBUA 3ZHXA 1FSFA 1V9CA 2QDXA 1NSYA 4IGEA 4EVRA 1RXVA 1HE4A 1PTJA 4EF5A 4Z3DA 3OA0A 2YCBA 2FWAA 1M7GA 1OPXA 2H59A 3BXGA 3H11A 3H87A 1P7VA 1EJBA 1WP9A 2B35A 3BK7A 3IODA 4PPYA 4UEKA 1B26A 3LZCA 4U7TB 4BLVA 4JQOA 5FOUA 3O92A 3RHSA 1FEZA 1IN7A 1XCLA 1XSEA 3I9MA 3NP9A 4F5EA 3DMTA 1VSUA 2NSYA 3L05A 1DTSA 1HNWB 1ENPA 2E4WA 1D8AA 4QJ3A 4EFKA 2E3JA 5IZCC 2I91A 4UBLA 1ICEA 1RWXA 5DK4A 2QP3A 2QYOA 4MQFA 3V1UA 2QLJA 3AR7A 3JQRA 5DTQA 5EUBA 3A6ZA 1IB6A 1N3BA 1Z22A 3FPJA 1HE8B 4NNJA 5FD8A 5EIEA 8MHTA 4QM6A 1AHIA 4AJOA 2PK3A 4EY7A 2VDJA 1PNRA 1LJ8A 4DN6A 1AGPA 4O2LA 2HXYA 4MUKA 2AEMA 2X19A 4JJEA 4R8KA 3OJEA 1E61A 5I45A 2IPNA 5CX4A 5FBRB 5KPJA 2D5CA 4WCDA 3K2IA 1A9OA 5T3YA 1IBLB 2ODAA 4OG2A 3BJZA 4BO8A 8ABPA 4S1NA 1GPJA 3NB0A 5SZIA 2QN1A 4W9RA 2R60A 2VTDA 1BXGB 4ND5A 1TM3E 4R1MA 3KOMA 1QYIA 5ELLA 5HZGA 2Q07A 3R6LA 4QRDA 3JD1A 1A4UA 2IF2A 5AXAA 5AOAA 4NBNA 2I33A 3OUUA 1FJGB 2E4ZA 3MSCA 1UIRA 4P4SB 5JCOA 3WGOA 5JI3E 3UB4A 5THXA 2I6SA 5EMNA 1HPLA 4R68A 4HAWA 2ONYA 3DE0X 3FKSD 3MS7A 2GHIA 2LBPA 4OGFA 1PJZA 5J2UF 4L72A 4NYJQ 1EXMA 4A4DA 4NNOA 2PUEA 4F9GA 3ZS8A 2HAEA 2GA8A 3EOAI 3EA5A 4JR1A 2QTCA 3ZS9A 1CY0A 4URXR 2BN4A 3GQBA 1ULBA 5DBFA 4MK4A 2QZSA 3IFSA 2ZANA 4JELA 2CFOA 5EPOA 1VSQA 1BMFD 1VKHA 5CCDA 1PJBA 1IDN1 3AU8A 3DMYA 3F9CA 3TE7A 3WKCA 4E5PA 4YV0A 4ITRC 2QAIA 4ICIA 1IY8A 1JGTA 4OGLA 3ZOKA 3L0YA 1SB9A 3MCVA 4JIMA 2HRZA 5ILGA 3HJNA 4WJZA 3G2HA 3HU3A 2C8LA 3DLTA 4ID3A 2PSEA 4DLVA 2BFNA 1J39A 1Q12A 3GFGA 1V35A 4YXWA 5KJEA 2ERXA 4RULA 1T6BY 3ENWA 3FGNA 4LRXA 3WB2A 4A2CA 1CLUA 2IHZA 4RSRA 5DN6D 1VHDA 2PDAA 4RLSA 2NU7B 3HU2A 1M8KA 3LJKA 4JSTA 3UHPA 1C1DB 2YYYA 2WWVD 4MW9A 2ID8A 2EQ5A 3IOEA 3V4VB 4HEA6 4N5IX 1VPVA 2D5LA 4JKIA 4MWSA 4IUYA 1IFXA 1VIMA 3HVRA 1R6AA 2VWHA 1CQIB 4RENA 1YQWA 2CXOA 1SUAA 3I9JA 4N5DA 2Y1CA 1SUSA 1ZLYA 3LC2O 3K1TA 2AK3A 3GBVA 5AM5A 3WHLA 1UZAA 3FFTA 3GRAA 4J0GA 4A1OA 2BSQA 1CJVC 2P3QA 1QJ4A 3S28A 5JQGB 2GDZA 1Q1GA 3CNNA 3BUSA 4FGWA 4FJ0A 4IHJB 5AW7A 3QZUA 4GM0A 1V5IA 3ZWCA 1P0FA 2DTDA 2YWGA 4ZHQB 4QSMA 4D9JA 1K68A 4QVKA 3P27A 1CEXA 3QPBA 1YKFA 4OYYA 1NY6A 1V3TA 1XMVA 4JT2A 4TV9B 5AK0A 2V0GA 3AVUA 3NDJA 4MA0A 4BO3A 1P0PA 5K3DA 2GNOA 3LQRA 3SBOA 2DLDA 2R48A 4E1VA 3NC1C 2OXIA 3HLTA 2VTBA 5LP6B 3KUCA 5JEDA 5FL7D 2W2QA 1KJZA 1UBJS 1B0UA 1RP1A 1UH5A 1ZXXA 4HB3A 1KXJA 4D9GA 4AY6A 4DCJA 1C3XA 1ENOA 2J6HA 2B8EA 3IBFA 1T1EA 2PSJA 3TSAA 4C3ZA 1AT1A 1GT6A 1O9HA 4LOIA 2BHNA 4LRQA 5HGXA 1GPMA 3NX4A 3L79A 4E2ZA 2H4HA 5DNVA 2Z8YA 1TT7A 2GXQA 4R8MA 3EIWA 5FFNA 1L6RA 1LX7A 1QAMA 3PNOA 3I9NA 1W4BA 2EF0A 4WXMA 4BV8A 1JR6A 4ZHSA 3SQWA 2OAP1 2XTMA 4X8OA 3VI3B 1KKUA 4B85A 3BS4A 3U3KA 1APBA 4ZRMA 1Y7TA 1DAIA 1A76A 3L7AA 5TS2A 2ZI5A 1ZCJA 1U7ZA 3SMQA 1NN5A 1OASA 4S2UA 1QQBA 3Q8LA 5A0TA 3N2LA 3I2KA 4GR4A 2VP5A 3OOEA 4BNJA 1V5EA 2OZLB 5IDWA 1MF7A 1I9GA 4OVKA 2IZ5A 5K0EA 4C4TA 1KEUA 5KYVA 1NDUA 2DWCA 3GT3A 2I5PO 3EIOA 5E9WA 1F7VA 4RMIA 3QEBZ 3I62A 4HBGA 2PSDA 1H8HA 3RO7A 4F7DA 1FP2A 3RVOA 4WOKA 3ZUPA 2C97A 2ONZA 3FLBA 3MTBA 4H7HA 3TSCA 3TUIC 2CT8A 4MWDA 2NV2B 3GLIE 2HNKA 3AV0B 3QE0A 5C5CA 1RAIA 1N5IA 5K51A 2JA2A 3LA8A 3C24A 2YJ3A 3H9UA 4D0NA 5EUQB 3DZFA 1LBEA 4W5JA 3VNVA 3BD9A 3BQ9A 1EXVA 3O7WA 1C3EA 4GP7A 3AC0A 3QEJA 1OT5A 3DQPA 2CYCA 1SU7A 3ZH2A 1Z2EA 1WL8A 3HWWA 2FLWA 3ENZA 4IINA 3VOBA 4E2FA 4P3XA 4M0MA 4MYCA 4HC4A 4QQNA 2A1UB 1WQ1R 2GZ2A 1CB0A 3U7FB 3Q0EA 4Y1GA 4V0QA 3NORA 1CVRA 1L5YA 1UZNA 3UK6A 2OFPA 1QH9A 3KK0A 3D2AA 2P91A 3RUPA 2H17A 1X15A 3UA3A 1ZO8A 5EJ2A 1CQPA 5ER6A 1M2OB 1VKOA 3QG1A 5D85A 5E0OA 2W7TA 1GM5A 4TTJA 3IP1A 2WJ3A 3OZIA 2EWWA 4LYFA 1IM8A 1TYZA 2PZFA 2BH2A 3P9QA 1L4MA 4KQKA 3BMCB 3SEAA 2XZLA 4KDEA 2I80A 2PWYA 2XMPA 3KYDB 2PPVA 1E2MA 3ZE0B 3BWBA 3WGJA 2GJ9A 3B1WA 3GGGA 5GADl 1GNSA 2DBQA 5DHUA 4MW7A 1I4OA 2HI0A 4ACBA 4AFNA 2XDWA 2PLWA 3CMCO 1CUSA 1ANKA 3I30X 1TU4A 1Y89A 2OAQ1 1NUTA 3CTPA 3PUHA 1DXYA 1GPLA 1TMGE 3M49A 3S55A 4D2IA 1K0FA 3ZWYA 3CRNA 2L2QA 4FGKA 4DCTA 2GX6A 1NF8A 4FLFA 5HZKA 2P2GA 3VR4D 1ADBA 2PRJA 1U7OA 2B8NA 4KXWA 1D2HA 3E3AA 3IA2A 4ATNA 2WSIA 4CFSA 2J5QA 4QRIA 4FWIB 2QZ9A 3RLFA 3RU9A 3N8IA 2O2IA 4ZYUA 3JVEA 4MLCA 3KG2A 1CIPA 2Z2JA 1JHRA 5IFLA 3ND7A 4QDXA 3IAHA 5TT0A 3QA3E 3GA5A 3JWHA 4RPLA 1X8KA 1XZBA 1Z2DA 5LKRA 4G1CA 3AYZB 4RA6B 1FYFA 3VR4A 4F12A 5HQ3A 1N2IA 4F9FA 1Z0UA 4Z9YA 4KC0A 5CJJA 1KH2A 4HDAA 2OGWA 3IUBA 5IM5A 4A7PA 5EZYA 1UT5A 4KPUB 1T5TA 5EINA 1WEHA 3DE1X 2BC9A 2QUAA 3OM0A 3SF0A 1XALA 4WERA 2H8GA 3BMNA 1LD3A 4LHZA 4FZ3A 3DDSA 4DLPA 1IQUA 1WV1A 3LZ6A 1D04A 4W82A 4HY3A 1XPRA 6GPBA 4QU8A 4FMPA 1NQVA 1UKVY 4H08A 4WZAE 4DR7B 3A26A 3EZYA 3GFVA 3U0VA 1XFDA 4N48A 1QZXA 3IQEA 1II9A 1QO9A 1XKQA 2XA1A 3GEHA 3AP3A 3ND8A 3O8NA 3SICE 3W3ZB 4EZIA 1NQTA 3VVMA 4FB5A 3TGLA 5DHTA 2DFTA 3NEPX 1KWKA 2J59A 1C7JA 4MVJH 3E2PA 5FB3A 2DEUA 5T67A 1QZ3A 3ZD6A 3H4IA 3K16A 3JSXA 1EB9A 3LK6A 3WMWA 4WNYA 4D3YA 1PAUA 2GN6A 4ETWA 4MV4A 4JOQA 5ENDA 5KOHA 1QLHA 1RMQA 1M2NA 1UKZA 3JQPA 4TLEA 4HAOA 2YW9A 1EXDA 4Z4FA 1OXMA 3FHJA 3HRIA 3COSA 4I6GA 3AUUA 4HGZA 4O59O 4AAYA 1BD4A 2HJSA 1YR9A 1F06A 2Q4OA 2WUDA 3KWLA 4IILA 4Q1EA 4C21A 4E03A 4GX0A 2C0CA 1B2LA 4R05A 3DCYA 2D7CA 2E5FA 3ZUGA 1ELOA 4KGZA 1TM5E 2PMCA 1JKJB 3UJBA 5G0VA 1MPTA 3ZY2A 4B6GA 2QPOA 3H6KA 2IZOA 1QB7A 3PQ4A 2QR5A 3QFRA 4PX9A 2OCDA 3LCVB 2CL6X 3AFNA 3ONNA 1FFSA 3U4IA 4G9GA 4K2AA 3QVOA 5EZYF 3TPFA 2ZDHA 1Z2PX 2J9FA 1E1NA 6Q21A 4FCVA 5L53A 1OPRA 1P75A 4ITVA 4LZNA 4BUCA 5ED0A 1R0BA 1KVQA 1G8KA 1P4RA 5SV2A 1JBKA 4R51A 1KKLA 3N75A 3X1YA 3X1DA 5I7RA 2O2DA 3JZIA 3LWDA 5HW0A 3SHOA 1C1XB 3BXZA 1KZGB 1P9LA 1N7IA 2PKYX 3O8DA 4EEZA 2EHJA 2YXEA 3GDGA 4OJYA 5K20A 4IEEA 2EYUA 3ASZA 3INRA 1AK2A 1FLVA 3RIYA 1QIJA 3LCRA 3OQNA 3WDLA 1C4KA 1RQLA 4IDFA 4OUDB 1RHQA 1EE2A 1RIFA 1Q6ZA 1BCRA 1QFSA 2FWIA 4B8ZA 3OI7A 1DBIA 3F74A 1GL3A 1NG1A 4F46A 5GZ1A 3FCCA 4Y9SA 2I22A 1BE6A 1KAOA 3SZRA 4DR1B 4PW0A 1V6SA 2FEMA 1BDHA 2FPKA 3DGEC 3FM9A 4DCOA 4C4XA 1O0SA 1TAGA 1LRLA 3Q72A 1NY5A 2DWUA 2I1WA 3ESBA 2DOKA 2P7IA 4LJ9A 4UNSA 1T9GS 4L07A 3O9MA 5B3JA 5TQ2A 4F8JA 1Y8CA 1ABBA 4F45A 5C37A 4Q37A 1VP9A 3M81A 1S4QA 1TIKA 1JHYA 3EE6A 2VJYA 3C45A 3QWIA 4L27A 4OFXA 5JCJD 1A7UA 2P9BA 2J7PA 2VBCA 1EP3B 4DCVA 1TO6A 1Z0SA 1LC0A 2NZ8A 3R5JA 1I7PA 4MJLA 4DRZA 1VB3A 3KHSA 5ITSA 5LJIA 1RJWA 3LF2A 4BBPA 4MR7B 1PQ4A 3RS9A 4GP6A 4HO1X 3Q7EA 1E1CA 1M67A 2IELA 2M6SA 1XTJA 4ZALA 2JHPA 1QIGA 4YRPA 1EH5A 2X0FA 5JYEA 3M9LA 1RHMA 5FPKA 3ER8A 2FRDC 3FHLA 1F2TA 3CLTC 3LFUA 3TLMA 4WNAA 4C4PA 2GZHA 821PA 4F11A 5JBIA 1RRMA 1V37A 3SZUA 3CR8A 1E1RA 3F2IA 3KTAA 1YGPA 1E58A 1G6OA 2A0XA 2HMVA 3KB6A 4LYGA 2QRUA 2R8ZA 4RE6A 3JQFC 4HSGA 3BRWA 4CNQA 2XB2A 1YB4A 5KI6A 3BZWA 4DXHA 4UNIA 4E5VA 3LTNC 1AXRA 3HN2A 4OF4A 4Q3DA 2HD4A 2WZQA 4NZYA 5TJ9A 3TDNA 5KMGA 1NUPA 2VBGA 1VHWA 3HFGA 2CNDA 1O5OA 4UFNA 2FMTA 4Z0TA 4OQPA 2RB5A 3V2IA 1YV9A 1QCDA 1QFJA 1TA0A 4NCIA 2XI4A 1PJCA 1IZZA 4X6YA 1JG6A 4RO0A 1DS6A 4BKUA 4H17A 3AFHA 4PLVA 1WDTA 2A2ZA 2BMAA 4ALKA 1BWSA 1TZBA 1VE1A 4FFSA 4P7GA 3RSHA 4TZ6A 4FJ2A 1USKA 4ZZIA 2JLWA 1E2UA 2JGKA 1CUFA 2XNKA 3COPA 1I6KA 2QWXA 2GFHA 4L5JA 5G1PA 5SY9A 2C2GA 1NQXA 2FR8A 2ZB2A 5TARA 4YRBA 1E1DA 3G6WA 2C5SA 4WCFB 2VLBA 2HQ1A 3AF6A 3H05A 4HSEA 2VEDA 4P5PA 4BWFB 2OCAA 2NPOA 3DPUA 2ORWA 3HXPA 5BQ3A 1S9HA 1XZIA 2PZMA 3K0FB 5EI5A 3STYA 2YXBA 3FFXA 2ZXFA 4ITUA 4ND6A 3GGDA 4M8IA 5E6SB 1JT2A 1ZQ9A 3KXLA 4K9OA 1KJYA 3TNLA 1EFPA 3WBBA 1PGOA 5U4XA 3MINA 1QE0A 1S7CA 1W30A 3DVQX 3W2FA 3W5SA 4YUAA 5CB4A 5KBYA 1ZAKA 3O84A 4B82A 1IDOA 1E3JA 5CDFA 4N5NA 2GOYA 5CFMA 1NVGA 2BZ1A 2Z6VA 3AVQA 4AJEA 4EPWA 3WQSB 3L0BA 4XUGB 4K9RA 3ST7A 3NM5A 5JZ9A 2WJAA 2I7DA 1JDUA 2ZGVA 1KZ1A 2ZJ0A 3GVXA 3VOAA 1N2OA 4Z8XA 3SKYA 3TIVA 1SBIA 5JS8A 1FYWA 3F6EX 3CH7A 3IS3A 4FEYA 4I9UA 4BC0A 2AMVA 4H31A 2NZVG 4L85A 3RSSA 1NXWA 2NVUA 2ZRMA 2GCPA 2YV1A 3G2MA 3TL2A 5M04A 1GG2A 4J0DA 1ZWKA 2QLBA 1IEWA 3HCDA 4DXDA 2MU1A 4INZA 4P38A 3V1TC 1FVHA 3UVEA 1J07A 1S9DA 3SHQA 2H1OA 1X1SA 2JLSA 5COAA 1TF2A 2NLOA 3ZXSA 4TZ0A 1RHKA 3P97A 1CU1A 1OCEA 1T1RA 4FSDA 5DVZA 1D6NA 1DARA 1VJTA 2G4LA 4X8LA 2I34A 3BGWA 1XYYA 2GCOB 3AUFA 1FZTA 4LOKA 4RPJA 1A2BA 2AUMA 3OKFA 4PEVA 4PRYA 3GLRA 3ZVLA 4CQMD 3P5BA 2ZYDA 5A9SA 3K8YA 1SG9A 3LKDA 4BB9A 3K9FC 1HO3A 4IDHA 2Y1KA 2R68A 1N6RA 3FMPB 1E9FA 3DM9B 3Q7RA 3DEFA 4Q4AB 2FPLA 2NVOA 3IBSA 2O8FB 5AVKA 2FSGA 1EBBA 5EHNA 3USCS 5JYDA 4K3VA 4TWZA 5JJBA 2YYAA 1M2WA 2GF2A 3CCFA 4GX1A 4OFZA 2HIAA 1T9KA 3PFKA 5FEMA 4J9VA 1HY3A 3WSVA 2YINC 3PSAA 1FBNA 1OA1A 2J4CA 4MWOA 4EVSA 1E3MA 5KU1A 4L16A 1RBQA 2C7VA 1FNCA 2FSHA 3CS3A 3DFIA 4TSFA 5AM0A 5C1PA 1I0LA 2DPYA 5CIYA 2Q7XA 2CDCA 4NBTA 4P4TA 4GFDA 3BA1A 3GDHA 1OIXA 1OZHA 2QT0A 1HZZC 2LCIA 1PR1A 2DMRA 3ELYA 3VJRA 3EC7A 1M2JA 2DPHA 2HSWA 3NTUA 4IXNA 1DEAA 4P34A 4DLUA 2QV7A 4UVIA 2OENG 4QEZA 3TLGA 3BCSA 1THMA 3L5KA 2WWWA 3DKVA 1D6JA 2AA3A 1CS0A 2F6RA 1JE0A 1MO3A 5DSXA 2PT9A 4PLPA 1OMOA 1T9BA 4LOHA 2ID4A 5T7BA 3NHMA 1X77A 5FNVF 4DBVO 5KYXA 5K6AA 4IKPA 5K8JB 1O95D 2BTOA 4HNRA 3GOQA 3N0RA 3IVGA 1J2TA 3WFZA 3RS7A 1XEAA 1QIKA 4AO8A 3DDUA 2M98A 1U81A 1U2DC 4ZQEA 3PLNA 3E4DA 4IQ4A 4L50A 5H3LA 5AW6A 5DM2A 2V7UA 4EKYA 3BD6A 4MPJA 4Q9NA 4P5DA 2NU9B 3GT0A 1CTQA 4C76A 3CWCA 1EZZA 1W2WB 3JQ7B 1UIMA 5JADA 5LQUA 4B5LA 1AJEA 4Q16A 5E2BA 3E8XA 4JHLA 3M1YA 2M6LA 4PXYA 3PWTA 2FTKE 3QA9A 4YRNA 4MUNA 3CKKA 3GAAA 3EGEA 1M2VA 2PVPA 4QGHA 3AU9A 4F4UA 3A6GA 4US1R 1RCTE 1DIBA 4ZEWA 4BX9A 3EBLA 3K70C 2N46A 2DY0A 1TUBB 4RK4A 2HWWA 1C3JA 1GFWA 3EDOA 3IJ5A 1ECLA 2B82A 3GGSA 2ZATA 4HH1A 4X00A 5D3KA 4E13A 2H4FA 3JQGB 1HGXA 2I3ZA 4G23A 1G3UA 4KVAA 4CKXA 1E0DA 2OO3A 4UMFA 3NTXA 1J9EA 3FPTA 2XAAA 3CZ4A 4UM7A 1R8SA 4X44A 5HK9A 4Q4DA 4PR3A 1MIOA 4BXOA 4E07A 3QPCA 1WLYA 2LR0A 2ROQA 4QQRA 1IAQA 2GF0A 4Q66C 1W5TA 4K03A 4EG1A 5KQRA 3B5EA 1FP6A 2J3JA 2FRDA 4R5MA 4B17A 4DQKA 2CZQA 1Z07A 1LA2A 2NTVA 2W98A 1KE2A 2X6QA 3VYSB 2Q5QA 3C43A 5IBCA 3O47A 5JH7F 1IZ7A 2F3QA 2OC4A 5TJHA 1VCHA 4HDKA 3U60B 1EX6A 1ZOOA 5L3RA 4TYQA 1OFGA 3RSGA 2BGLA 2WHXA 4PXAA 4UHDA 1M8FA 3VBCA 4BMPB 1Z2NX 1CRQA 4DMMA 1O2DA 2QY6A 3R3ZA 2I4TA 1RT9A 2D3TA 3E7PA 3N1UA 4DV1B 4O6VA 3Q7IA 1E3SA 3SD7A 1HYHA 2WE8A 4WUTA 3TQSA 1YIOA 1XN1A 2R6ZA 1U3DA 2G7MC 4LWZA 1K06A 4M0UA 4WN9B 3RYTC 4EHFA 3OM8A 4CM9A 1KYXA 1SUBA 2MSKA 3CV3A 3DM5A 5DM0A 5ETJA 1NMYA 2R1TB 2WVHA 3VXKA 4B7UA 2AYXA 4NMXB 4EUEA 5JSQA 3WA7A 1TJPB 4MV7A 1OFUA 4Q7JB 3NBFA 2PGLA 1KRHA 3ZV6A 2ODPA 3ZQKA 5GAJA 2AQIA 3D1VA 2Y2VA 4XGKA 4B4UA 4NH4A 4R98A 1NZJA 4LE2A 2QE7D 5DWQA 4JI5B 4BKMA 2B92A 2HSDA 2KM1A 1L4FA 2FSVA 2P11A 3C5CA 1BHSA 4DJFC 2VHXA 3HBNA 5JSHA 2V6MA 5KNCH 3JXEA 3L8DA 3PQ2A 2HV8A 1ZA1A 2WUFA 2R96A 1NDHA 5DT2A 5E6RB 5KWSA 1EUYA 1DV2A 3C74A 1LY1A 1P4JA 4MQ5A 1Z7EA 1V8ZA 4X90A 2ATIA 1TYEB 3D7MA 4UBMA 3SZLA 3OZDA 4W5HA 4KRXA 1WCXA 4MUYA 4JBIA 2FWJA 3SR3A 1JG1A 4GL2A 5ALDA 2R8YA 4N3GA 4ZIRA 4K0KB 1Q19A 2V9ZA 2Z8XA 1P7ZA 2BE9A 2BUAA 2ZE6A 3JQ6A 2RK3A 3ZGXA 1EUDA 3MCTA 2C03A 2KWIA 3D8SA 4M36A 3K09A 4QL3A 3SSNA 4X7BA 3WIDA 5C53B 4GVLA 2QAGA 4JB0A 2R4TA 5IZ4A 2V3CC 2RAFA 2ZI6A 3S2SA 2FEOA 2Q5JA 1QKIA 4Q4LA 3AR8A 1OFVA 1YA6A 3U16A 5EPUA 2PSHA 2XOKD 1VLVA 5K45A 5LU8A 3IA7A 1VKRA 3WLHA 4ER6A 4MWTA 2R1TA 3KQKA 1CZUA 3BH7A 3WOVA 1GTL1 3WNBA 1BSVA 4ER5A 3U31A 1N6LA 3OC0A 2ANCA 4MVXA 4H27A 5KVAA 3HJCA 4KDCA 4OQEA 2PIAA 3CN7A 1XXHA 4JS0A 3VR5D 2Q1AX 3F1KA 1FXSA 4S1TA 4W4TA 3ACDA 1VC2A 3J80A 3DT8A 3ZVMA 1KO7A 2VNAA 2XTJA 3PQ5A 3QFSA 4JB2A 4L22A 1HT1E 1AXEA 3IHWA 3PFFA 3VO1A 3WDSA 5F35A 4B32A 4Y6SA 1PX2A 3PITA 2QRLA 3T5GA 4AC9A 3ZBTA 1ADCA 1D1QA 3WRXC 1U2RA 4OYRA 1EG7A 1CEQA 4FGLA 1Y42X 2GBPA 1KFCB 1CJBA 4J7CA 3ZK9A 4COKA 4Z9XA 4XWTA 3VC1A 1ENYA 3WL4A 2B8WA 5B57C 3OTWA 5GZ6A 1KSFX 3MVEA 2FN3A 5J58A 3FPAA 4O8CA 2IU3A 1NL3A 3C6YA 2AGVA 3EGWA 4HMPA 3WHPA 2B1QA 3N59A 2CUKA 4KYUA 5IFKA 4BXOB 1OYYA 2AKEA 2FSSA 2XF2A 4BCDA 4RTJA 1VXRA 3IQDB 1MW9X 1X3LA 3IBCA 3K32A 1NWCA 3I9V6 5TEWA 2ISSD 7MDHA 2VUSA 2BGKA 2C00A 1G2IA 3CB4A 5HHTA 3UFXA 4FGSA 3RK4A 5BMOA 4PRZA 3JQAA 2NUTA 1XMSA 1AKQA 2Z9CA 4L95C 4YRMA 5DCLA 3ZQ6A 1DFIA 3EDRA 4QHYA 1VJGA 3Q85A 1TA9A 2PR2A 3FZNA 4F1WA 3L92A 1O6FA 1KEKA 2C1XA 3LE8A 1P4AA 2IUFA 3I9LA 2BKEA 3CNEA 2JJYA 4UNNA 2UZAA 4OLHA 5AKYA 3RUCA 1OWOA 3GLVA 3PZBA 3ME5A 3Q0IA 3PCTA 1JQDA 1XZFA 2EOAA 2R8PA 3KELA 4EFLA 2A9OA 2O2JA 5IYZA 1C30B 2IY9A 2DHQA 1D1SA 4UULA 1SC3A 3ZZTA 4CE6A 4QXQA 4YJKA 5SYNA 1XAJA 5IH3A 5CFZA 1Z13A 3AHCA 3PLRA 4CF5A 4M1TA 1X1AA 2Z09A 2FQXA 3KKZA 3PCRB 4ZO8A 4AS3A 5IASA 2HGSA 1T6NA 2VDLB 4O5OA 5T5QA 5TDHA 4OHYA 4NVRA 1GT91 3FIUA 4JC4A 2H48A 2R7MA 4QOSA 4GYJA 3I2YX 1DEKA 3KOWA 4W9NC 1ZOIA 2F67A 3C3JA 2FWMX 4Y0NA 3V42A 1XHFA 5IKXA 3GEPA 1SB8A 3ZNPA 1DIHA 2UZ0A 3W7BA 2FSPA 1VCNA 1WSWA 1PSZA 1HFWA 2H11A 2WVJA 3BZUA 3O4JA 4WLUA 1RAHA 4MO9A 2YIDA 4Y2XA 4EX6A 1M34E 3ISTA 5E95A 2X58A 5M5BA 1T2VA 3WZMA 3R5HA 2OP0A 1XLTC 5DHAA 1UBEA 4C0AC 1P1FA 3NXKA 3QUBA 5EA2A 1U63A 1V4VA 3UC5A 3RVJA 2YUTA 1OB2A 3GVPA 3WB0A 1IJBA 3PS9A 3M34A 3ETJA 3RK1A 5K0TA 5IDVA 1GKLA 1SUIA 1QFXA 1V7CA 4R1QA 2REOA 4YQFA 1SHUX 5GQSA 3OZEA 1X1TA 3IEKA 4D9KA 1ZITA 3A6DA 5IM4A 1QVVA 1H2EA 5JFGA 4DT1A 5MGBA 1I4WA 4AW9A 3AWDA 4LNHA 4B3RB 2XGMA 1LLCA 1O94C 1JXOA 1P18A 1PP4A 3CRRA 1GVNB 4C43A 3N8HA 4X7RA 2Y05A 4MVJG 4WBNF 3H65A 1GU7A 1XQXA 2Z1DA 2RBEA 1ORTA 3KB1A 1NOJA 2HL6A 4HLUA 4OYLA 4BN5A 5IVKA 4DLLA 4Q24A 3BWMA 1DB3A 1FFBA 2H1CA 2W8BA 3TVTA 3NRCA 4CQMB 2O06A 4KVZA 1QTIA 1V96A 2YNMC 3OPNA 2XA2A 1OI4A 2P9EA 4HZUA 4KBGA 3DAYA 2IE8A 5CB8A 5C4MA 1PBTA 1SBYA 4B2IA 1ADJA 2EARA 1P7YA 1UOPA 3BSWA 4BB0A 1KXZA 2UYHA 4I7EA 5F4ZA 4FFVA 2EBWA 2NSLA 1NHWA 4Z0HO 4CG0A 3VQTA 4MP3A 2Q5EA 1YRWA 4UW9A 3ZHCA 4MHTA 4FE7A 1UP7A 1A82A 3G7SA 4HS4A 5KCMA 4NBLA 2IU0A 1JA9A 1JIVA 2WAOA 4BAZA 1QDNA 4YRGA 3ND9A 4XSVA 3T3HA 3CR3C 4BEBA 3A6EA 3A2MA 4KU4A 1E4VA 1QGED 4B43A 4GI1A 1BU8A 2I71A 3HEBA 2DB3A 1MVLA 4DDHA 5EKUA 4M86A 3ZU4A 4R2HA 2Z57A 2GJAA 4EITA 1GNQA 4WBNB 3IJPA 4B7AA 1D0SA 3C85A 1RCFA 1PU2A 2RH8A 1WV0A 1QB8A 2CJYA 2I3AA 3PE3A 4F1KA 4RDXA 5JBQA 2BRUA 3WLTA 1NMEA 1E9SA 3GD5A 2MYNA 3DBLB 3KAKA 1ZVKA 4O29A 2IZ1A 1QDEA 3UHOA 4RESA 1M5UA 1JT9A 1WEKA 2XE6A 3CZRA 4KYIB 4L4YA 1ZYUA 2AL7A 4EKGA 5HM6A 1P2SA 3NHKA 2CJFA 2EDAA 1BYUA 4IXMA 1PFVA 2OMEA 4N3AA 5F1KA 2Q9UA 1ULHA 2VXOA 2ZBUA 3KYBA 2X0JA 4FCCA 4KAXA 3OF2A 4FFNA 4OSPA 5FRDA 3UAYA 1GU0A 5EFZA 3TQRA 2ILTA 2PH3A 3K0FA 3OEEA 4GM1A 3V48A 1LW7A 2JW5A 4BNFA 5ESWA 1K6XA 2V9CA 4BO4A 3A7DA 4JJGA 3RVNA 5HE8A 2H0RA 3E18A 4QFDA 3JD4A 4AXBA 1AKTA 2W2PA 3EA0A 5GINE 2WDPA 4XARA 1UKAA 3THXA 4RVOA 5BN4A 1Q91A 5F2EA 5DBEX 4GGMX 4Q9KA 3LPDA 3N2KA 4CIYA 3CZCA 4XX1A 3Q5DA 4GOMD 1JHQA 3UK7A 2FZKA 3V4PB 2FWNA 1LV8A 1R6BX 4PF1A 1NT2A 3LPAA 1PKEA 3R4CA 2I6TA 4J9UE 1GGNA 5A6SB 2C4KA 4CM4B 3T0GA 4KJXA 5KS2A 3STXA 3IE0A 4V39A 2W2MA 2P2DA 4HKTA 3DJFA 1ESCA 2V8OA 2QN2A 3BJEA 3DE4X 2WA2A 1SN7A 3MXOA 4OQZA 4QBFA 4ZCRA 5CAEB 5CDHA 4LPSA 2GXUA 4PPFA 4RCYA 5T3UA 4TWBA 3VR5A 2RGGA 3FWPA 2G9QA 4JNKA 1XNQB 2X76A 2Q6IA 1XCMA 4FNMA 3D7RA 1Z34A 4IQGA 4HF7A 3COJA 3JV7A 4INPA 3PT9A 2HA5A 3IUYA 3V7YA 1AMOA 1P31A 5BSVA 3Q9LA 1ZD5A 3OBIA 2A0YA 5E8JA 4MR9B 4LISA 1KFJB 4QXRA 3DONA 4WINA 4AUKA 2D1SA 2WAYA 4RK0A 3W7VA 3FN4A 3JQFA 4I1RA 4HAIA 3K9LA 1IVYA 1XRSB 5GLFA 3CMMA 2VT7A 3OWHA 5NLLA 2P6RA 4QYSA 3U3ZA 2Z4TA 4YJHA 1VG8A 2XMZA 2BFCA 1EFUA 4QLAA 3I01A 2QNRA 3RFUA 5ALTA 3R1IA 4XGNA 1U02A 3I9KA 1YBVA 4JCOA 3U3OA 2O5EA 5EXPA 3ZGLA 2R1VA 4GPAA 3SYKA 3HN7A 5CBKA 1AS2A 2J45A 1LNSA 1N2JA 1NWHA 1U6JA 1UKYA 5AVRA 3M33A 4CEHA 4FYKA 3LYLA 3R0VA 4D0LB 2F3UA 1Z63A 1JYFA 5TQ2B 3THXB 2XHZA 4B80A 3ORYA 1E0AA 4EG6A 3O8BA 5DEIA 2RE8A 5LB4A 1W36C 4E5YA 2EW1A 2RIRA 1E5LA 1RPJA 5CXXA 1M1UA 4EMSA 3UM9A 1ZA2A 4DJDC 5FYDA 3N0XA 1Z9BA 2AZDA 2UZIR 3QPWA 4XM0A 4BBZA 4UOZA 3N07A 1P73A 2YHAA 3WRYC 4BQRA 1KU0A 2GLUA 2ZJ5A 3AUTA 4JLOA 3NT2A 3ZNNA 4O4LF 1JUDA 2BBOA 2FY8A 3UW3A 5H70A 4HS9A 2P2YA 2PMBA 3DEZA 3I92A 3RS3A 3EA4A 4GQBA 2W6QA 3PNKA 5DX1A 3GUVA 4WBNA 1HF3A 3GI1A 3QE9Y 3HXMA 2ZB8A 3JQAD 3KZVA 4G0NA 2O8BA 3W8NA 3WLRA 4PS1A 5ESXA 5ESRA 5BRJA 4NABA 4J90A 1KC1A 3MLAA 4DREA 3JCZA 3S29A 3PD7A 3QE2A 2J5RA 4EHJA 2CJWA 2FJUA 4G8DA 1W87A 2F8MA 5BOSB 1P2BA 3IDFA 1GUFA 1RYHA 1Y7PA 5K3CA 1BJTA 5DULA 1X8LA 3HI6A 1JG4A 1VXOA 4CV0A 4IDBA 1I2DA 4IWNA 2BSAA 1PFYA 2WIKA 1LBIA 4OQLA 1RWPA 1QOZA 4M9QA 4TL9A 1BDBA 2X3YA 4UJ5A 4QELA 3TCNA 3HZOA 4BQEA 1CERA 4HNUA 4DARA 3ETEA 3K0CA 5FA6A 4OH1A 3S2ZA 4OLBA 4X91A 3ROXA 2NSDA 3QBVA 3T8YA 1C9DB 1ADFA 2WU4A 1PV1A 5CUQA 4DYDA 4LHYA 4M0PA 2IH2A 2E55A 2HDHA 4GKBA 4M8KA 5DTEA 4EP1A 5HUQA 5I4KA 1E9RA 3ELDA 3DTNA 1YFZA 3WBFA 1E0JA 4LRWA 2OFFA 4E94A 4D6YA 2FOIA 1ZCBA 3FF4A 1VA4A 1XTRA 2AZXA 4YP0A 4L8FA 1S4MA 1FUEA 3EAQA 3GPIA 4QU5A 2FZ4A 5FA8A 4C4SA 4CFZA 1WVMA 5AJXA 3WO0A 3I28A 1DEOA 4F97A 2QM7A 5GJBA 4B7XA 2BEWB 2I9KA 3A1TA 1DWQA 1OI3A 4D6PA 4MO2A 5EQFA 4FMBB 1ZH4A 1K7FB 4M1OA 1HI9A 4QUKA 3D6NB 5KTKA 1RVDA 3TGPA 1YRQA 2ETVA 1F51E 1PTKA 3ZDCA 5TV2A 1LC3A 1W8IA 4QAQA 2JFYA 4JBLA 2JIZA 4JVLA 4WNIA 3B2EA 1C1YA 5BQOA 2XAUA 5M3BA 2FE4A 2WJIA 1SCUB 2J46A 2QQEA 3F71A 3NNNA 5EWLB 3FDXA 3B3AA 3TZ6A 3TVYA 4YWJA 2MR6A 3DE2X 2NV6A 2P2NA 2QBYB 5KKNB 4CM1A 5AHRA 3LIPA 5DTIA 2JA1A 3WMXA 1ISGA 1D4FA 1DBPA 2IDJA 3PQ7A 4G67A 4OFBA 3SXJA 2F1KA 4AJNA 4YIKA 4GYKA 4E5DA 1JZSA 4Y9TA 1M2FA 4Z2AA 1ZK1A 1Q1ZA 4DHEA 4PLZA 4PC2A 1X8JA 4JLJA 2C95A 5DCYA 1UBMS 1QIEA 2B2NA 1TQ4A 4Z1OA 1OJLA 1DXHA 1DBVO 3C8UA 4M3NA 4P0QB 9MHTA 4RW0A 4TTVA 1IOWA 5A0FA 1H4SA 4LJ6A 1JQBA 3MAJA 4IIFA 2VYQA 5IC6A 4DB2A 2RHLA 4OY3A 1OBOA 2P5YA 2PIDA 4YBRA 3BF8A 3KR9A 3W05A 3D3EA 3TSZA 1N36B 4M8NE 1W36D 4QOFA 1RZVA 5KZMB 1OH6A 3K6SB 3E9DA 7YASA 4QLOA 1OD6A 5JHHB 2A9RA 5KTYA 1JLMA 2YIVX 1TW3A 1JPUA 2TECE 2OBFA 3NPMA 1GSOA 3KWMA 4OB8A 3I04M 1KAGA 1A71A 2P2ZA 3UANA 3E1GA 4O2AF 5IC4A 3PFIA 2MIIA 4NBWA 3K9HA 2EF1A 3OT1B 3PTAA 1ZIYA 5DYYA 2XNDD 1G7RA 1HE3A 4JVNA 5DP2A 3ZKWB 5A5EA 1P33A 1J8FA 3WNQA 1WLSA 2ZUEA 3JYNA 1OE0A 2BBWA 4H1UA 1WZNA 3DHEA 3I9V1 2IUSA 5TMEA 1BKSB 4CMBA 5CT8A 5TGTA 2WF6A 5FOWA 1H0SA 2WU0A 1UOOA 3UK2A 5J5VA 5B12A 4PPQA 3NRBA 4DB4A 3HB4X 2CBGA 1DO2A 4YAWA 1X42A 4TUYB 1QUEA 4YJDA 4NMLA 3D8HA 4BZWA 4Y2GA 3GAMA 4ZVSA 1FNBA 4D5GA 3QG5A 1MO2A 5ALLA 1UBLS 1YZFA 3URMA 3FTEA 4RELA 4UMDA 4MR9A 3WGTA 1WMAA 2WWRA 1PVDA 4B8YA 1U2SA 4KCGA 4ZO4A 4JBYA 4G65A 1NNUA 4JLBA 3T4EA 2ZREA 3GLQA 4YHHB 1HMYA 4AVYA 3DTTA 5CVEA 5AXDA 2OO7A 4YALA 2JKVA 2R84A 1OWPA 4A10A 1WKVA 4EJSB 5K7SA 1KY2A 2Y4OA 4N9WA 2WSYB 3J81k 1ZR2A 1ATIA 2XBUA 4M6WA 5CAEA 1RI1A 3QVMA 5T41A 4GI5A 4AN0A 3R7LA 2PLFA 3QKRA 4P2GA 3FNBA 4CMGA 2D7DA 1DCMA 2Q9AA 3O26A 1T5BA 2JC3A 3AX6A 2CFCA 3L0IB 1PNQA 4FYJA 1LLDA 5D01A 1C9NA 4EQZA 2WE7A 3HVUA 2OQ2A 4YRCA 2Y1OA 3ZD9A 4EWLA 3JYLA 3TZCA 5IMSA 1OLXB 5G02A 3OLWA 1E1KA 3P2KA 2HX1A 2O3SA 4QUHA 3UKJA 3HFRA 3EHDA 1KJJA 1ZMBA 3FUUA 3LCJA 3NP7A 1UOQA 3WGUA 1EUDB 1WOMA 3S1LA 2CCKA 3FPEA 1M34B 1UQUA 3VU1A 5KQSA 4LFAB 4NS1A 2JI9A 4ZIRB 3B6IA 4IVNA 4OQYA 4V24A 4QGFA 1EFTA 1LK0A 1TRHA 1NTOA 3K0HA 3OZWA 3TD9A 2Y71A 3AKZA 3KCNA 3PICA 1OB5A 1V95A 3EQ9A 1ORHA 3LLCA 1RFGE 3GNQA 5AXCA 4YMLA 1TZJA 5LOVF 1VKJA 3OKCA 1KQOA 4IIJB 1F8XA 2R85A 2EJVA 2QP4A 1N8TA 3I2IA 1CX9B 4PNZA 4TRJA 3EEYA 4UM9D 3RJZA 2XZDA 4JJIA 3THRA 4DCSA 3GLFE 3LOPA 2NP6A 2Y76A 1RQ7A 3KUUA 3QJYA 4O4LA 4BJHB 1E7WA 5FWYA 1UJ5A 1X80B 2C0QA 4WIAA 1P6UA 3PBKA 3KLBA 4IIUA 3G0DA 5BSKA 2O8CA 1SXGA 3GMIA 1C9KA 2WD9A 3M9XA 4MP8A 4QPJC 1EI9A 4TRNA 2ZIAA 2DQKA 2PEYA 3A9SA 4XQEA 4ZV7A 3UUWA 4A26A 1TZMA 1GN9A 1FS5A 1DPFA 2CJPA 1AU9A 2ZAOA 4LYEA 3RF7A 2ZKIA 4DDKA 2PLAA 2ZT7A 2C3YA 5JJIA 4XH9B 1NC1A 3U7GA 3EVZA 3PFCA 1CDOA 2KB0A 1AKUA 4IHJA 4JA0A 4TXLA 4ENRA 9LDTA 2R79A 3MPOA 4KXUA 4BP9A 4CKWB 1TUGA 4FNOA 2QN6A 2HLPA 3DFMA 4PM4A 3WJ1A 4ZFNA 1QPZA 1KP3A 4J1QA 5T6MA 1GLGA 1DBQA 1YJ8A 3PA8A 4ZO7A 4HZUB 4JB8A 1KNXA 3IAS6 4OXKA 3KB8A 4CQMA 1ULSA 4D9BA 1NW8A 1XVVA 2HCTA 2QSYA 5EE3A 4D25A 2CLSA 2F59A 4DLSA 3WXBA 3F7OA 4B4DA 3DT9A 3HPQA 1DTWB 1C1DA 1AGRA 1HDGO 1MX9A 1M72A 4AURA 2P2LA 3LVQE 3TK1A 1U0OC 4CNBA 4MJ7A 3JQ9C 2WAMA 4CMKA 3DF9A 1G98A 1ZH8A 1YUNA 3SBDA 3RADC 1V7PC 2BYTA 1ZRMA 2RHTA 4LC9A 3BCHA 3CLRD 3QTBA 4P0PB 1ODJA 3HJGA 3O1IC 1YL6A 1YB6A 4C7KA 1SCJA 1TJ5A 3MT8A 3PYLA 4L0DA 2VPPA 2E4UA 4G26A 4WKOA 3K0SA 3SDZA 1KA9H 4XR9A 3W8RA 1YNOA 2ZWMA 4BNLA 3R7DA 1GCUA 3I1YA 3EWAA 1JR3D 1FQWA 3TAXA 1GUYA 3HXQA 1GLNA 2RI0A 1T2EA 1TMKA 1JB9A 1XCPA 1Y7IA 1F1BA 4GI2A 4IY1A 4MINA 5AVOA 2BKUA 4LJYA 5DHQA 1N4AA 4DQXA 3DW3X 1V3VA 4CN9A 3L8CA 4DQUA 3OZSA 3IPAA 1RZRD 3F1LA 1XMIA 2XWSA 5H0IA 3QEMA 3DV0B 3B1YA 4A0HA 1CUGA 5E7IA 1SHKA 2YJ4A 4HDRA 1GGHA 4RV9A 2CHEA 3PHHA 2CL7X 3QPDA 3RT9A 5JAHA 5JO0A 1FDVA 2ZG6A 3OQBA 4AKTA 4H7KA 1O94D 4TLBA 5EZ6B 5B3LA 4GC5A 3QEMB 1BXGA 1W76A 3OJCA 3RAGA 4U7GA 5BW5A 1YE5A 2D59A 3I12A 2FK8A 3QU7A 2DJIA 3DL4A 2I03A 1ZN9A 3CVUA 1JDJA 2XCRB 3WQQA 1VE7A 3GFQA 3V2HA 2WUEA 1YQTA 4FP9A 5ALRA 4A2QA 3RKUA 2BI8A 4HZGA 1RI2A 2B4KA 2FF5A 2R6AA 1DG1G 5FI3A 1ZSYA 3OUZA 3U7EB 2SKEA 1WW3A 4IMJB 3L6RA 5GIOE 1XTUA 1TB4A 1PKXA 1ZC3A 3TRFA 1SCQA 1J5PA 1QYXA 4HAVA 3UYKA 1GILA 3NBZC 1Q57A 3QHQA 2NYRA 1XROA 4YH1A 5AI8A 5JG7A 3W78A 1VOTA 2LV8A 2W42A 4LMBA 4QFCA 2QUBA 1XL0A 5CCBA 2SKDA 4OAPA 1KYZA 1XZEA 3AR4A 4FFMA 4QPDA 3DDHA 3M1AA 1U5AA 5J4VA 4QREA 2PT5A 1L6IA 2G25A 4ZCTA 1T35A 3QU2A 4LF5B 2XUIA 1NTRA 1WKCA 2CMDA 2ZCUA 1VDMA 3OZRA 1OY1A 4UPVA 3EGOA 1CY4A 2O8EB 2QJOA 1TLLA 4DM3A 2IODA 4NCHA 3OOHA 3BE6A 1RI5A 2OGUA 5EESA 2B4QA 4NECA 1N2SA 1RRFA 3PIDA 3ETLA 1QG2A 1D1TA 1TT5B 4G41A 3TR6A 1K2VN 3F6RA 4RD1A 4FOLA 3W0LB 5EP2A 5H3CA 3DHWC 3TX2A 1E8MA 2J07A 5LWQA 3GLGA 5I8PA 5CFLA 3EF0A 3P4UA 4LZAA 2HPHA 4RZIA 1B7GO 2GGSA 4EFDA 5A9RA 5C8ZA 4Z5XA 3QLJA 3H42B 3V4RA 5SY4A 4N0MA 1RXSA 4F2DA 2X41A 3FMGA 1CNEA 3KEGA 4GSKA 1PT8A 4XTRA 5DK6A 5T4FA 2DWOA 2HXGA 3HADA 3TUJC 1FW6A 3GOHA 4C89A 2I87A 2F8LA 3QX7A 3U4GA 1H2XA 5AM2A 4ABTA 3B13B 4XPIA 5JSUA 1JS1X 3FRHA 3VOSA 3OJWA 1IY2A 3R7SA 4XM1A 4DIUA 4FDTA 3D6VA 1GSIA 1M66A 2C59A 4H7FA 1TNDA 3FZGA 4DJEC 3L7CA 3K92A 4PZLA 3KEMA 1IEVA 1KR2A 5K3EA 4W5RA 3FF1A 4IIJA 3ZW8A 5KTNA 3EFOB 2PPLA 1XVLA 2HHAA 5GONA 2V98A 2ODQA 3RVLA 1YOVB 3C1AA 3JWIA 4RM2A 5LWHA 2I54A 4TMKA 2DH6A 2D62A 1J0BA 1SOMA 2O7VA 1U0NA 3OOWA 4TWJA 4FB4A 1BJKA 2ODNA 5HXAA 1R4MA 1JEJA 1QYCA 3E3MA 1EGVB 2R5WA 1CW2B 3R23A 2VF8A 4HCJA 5JFOA 3PQEA 3ETGA 1PW7A 2UZ1A 3EIQA 4M9SA 4WW0A 5EMJA 1H3FA 1GAJA 1I6LA 1HORA 3KPUA 3DZ8A 1PJQA 1H9BA 4RDIA 3C8HA 3ETDA 3S27A 2WILA 1NVMB 4ENSA 1FLAA 2O5CA 5EERA 5C3UA 2CMHA 4Z1MD 1C9MA 1MT3A 1N0WA 1YC5A 2RCYA 2ZIGA 3C39A 4K26A 1AGNA 1X13A 1ZI9A 4F6CA 3RE1A 2JBWA 2OORA 4JLVA 5DDIP 3UHJA 5C81A 2PM8A 2X9VA 4PN7A 4UM9B 2Q50A 2Z08A 3ANXA 2YWEA 5CLIA 1RQPA 2WSBA 3E03A 1Q20A 3IIJA 1TKAA 3B6KA 1EKXA 1DLIA 4HJXA 4V0RA 4M4SA 4MGYR 5DYNA 4E5MA 5HSGA 3EGDB 4W5QA 3G2OA 1U2PA 2V4MA 4AKHA 3LW7A 3DDCA 4JBNA 4EG3A 5ERGB 2DP4E 3PNBA 4YRJA 1GPDG 2D6FA 2GBLA 2ZRJA 2NQ2C 5EXTA 1US8B 1SQGA 2F8SA 3C3XA 2WLTA 4PYRA 1L5LA 4WZ6A 4LWOA 2AJBA 2PYIA 4FS3A 3HM9A 1Z12A 3DYBA 1GZ5A 3I9OA 1N6PA 2C5LA 3E7WA 5AQEA 1H6BA 2VJBA 1TQ8A 4KR6A 3O9ZA 3IDZA 1KY3A 1DAEA 1DO8A 4XA8A 1Z7BA 5AJZA 4N39A 2W00A 3EIEA 4HX9A 1O5IA 4J49A 4DLKA 5AKEA 4EABA 1Q6YA 1AQIA 2Z4SA 4Y2UA 1EJ0A 3IAUA 1PWEA 4ZQIA 3ESZA 4IHKA 4IIEA 2E37A 2PD6A 2QT1A 4UHKA 3L07A 1IVSA 1EX7A 1NIPA 4M21A 4O63O 3VRHA 4FWBA 3K2BA 5CXUA 5L3VA 3KVRA 4BN4A 4CIDA 1TM2A 2VTVA 4D41A 3HUTA 4EECA 4P9NA 4CM3A 1UDXA 1V2GA 4MMXB 3S8EA 3M2TA 2UYQA 4GKAA 5TPWB 4CV1A 2IDKA 3R9IA 2IYFA 1KI2A 3BAZA 2J9ZB 3T0IA 1N9ZA 2GZDA 2X3FA 3L7BA 4S1OA