5ER6A

Crystal structure of an oxidoreductase from brucella ovis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
HMELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
publication title Crystal structure of an oxidoreductase from Brucella ovis
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Oxidoreductase
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5er6A00
1ZW1A 3VZQA 4BKQA 3U0BA 3T7CA 4YVFA 2XF8A 3EW7A 5CEJA 5IN4A 1YGYA 2B5VA 3WGGA 4XYLA 5EESA 5L3ZA 1XLTA 3JQ7B 4BB5A 4BO4A 5COQA 2HK7A 2H5LA 4GMGA 4Z6KA 1KOLA 1NP3A 3H9JA 1GQQA 3PZRA 4W9NC 2Q2QA 3JQ8B 4R69A 3RBXA 4OKNA 4WECA 4J1SA 2FSVA 1DPGA 2YYYA 2DQ4A 3I6QA 3ZWYA 5IG2A 5FWNA 1A27A 1I3KA 2Y93A 3ONDA 2OP0A 1R0KA 3JQFA 3VKVA 4BMSA 1I0ZA 3D5QA 3VC7A 3HNPA 3KBOA 2BGLA 4RQUA 1T2CA 3SJUA 3WS7A 2NNLD 4OMUA 4YCAA 1PS9A 4K26A 3GNSA 3ICPA 4UVEA 4L74A 1QYWA 3O4RA 3ZNOA 1V0JA 5CDUA 4KDEA 3RD5A 3ZWPA 1HE2A 1X7DA 3M1LA 4J7XA 4MOWA 4TZTA 1ONNA 2IEDA 3JQAD 4IQGA 3ZU2A 3U09A 2IODA 3AJRA 3PXXA 1SO8A 1OC4A 4E2YA 1E6WA 3EDMA 4O63O 1PS8A 1T1SA 1P31A 2R2GA 1IB6A 2J5QA 4WLEA 1DRWA 4J4HA 3KEQA 1DFGA 3QVXA 2Y1FA 4ND2A 1I8TA 4JP3A 3C7CB 3KRTA 3N7UA 2Y0EA 2ZQZA 1JKJA 3O8QB 5IDQA 3CKYA 1SCUA 1SPXA 4MINA 4E6PA 5JE8A 3RFTA 3IMFA 3TN7A 4ZICA 1XCBA 4BB6A 4XD2A 1F06A 1TLTA 4XQEA 5DULA 4EYEA 1WNTA 4Z9XA 4N5MA 1K89A 4S1VA 4MDHA 3B70A 1I01A 2E6UX 5JY1A 3RI3A 4NBUA 2VOJA 1I30A 8LDHA 4BNTA 1B3BA 3GRPA 4HP8A 2IYOA 3TFQA 1PEDA 4AJIA 2Y1EA 3VH1A 1HXHA 2P68A 1H9AA 2HQ1A 4XEHA 1FDUA 4RL6A 4NHEA 1E3LA 1GD1O 4EEXA 6LDHA 4RZHA 3JQDA 5B4VA 3WFJA 2JCYA 2EKQA 4CMBA 4YT4A 4IXWA 5FYDA 1HTBA 2BELA 3ZZNA 3GF4A 5I7EA 1LNQA 4YT5A 3C24A 3ZHZA 1PJQA 4EEZA 4RDHA 1J49A 2JCVA 5DBGA 4XYEA 5FI3A 2J8ZA 2UUPA 4TVBA 1I3MA 1Z75A 5TNXA 3TZ6A 2QZZA 1NM5A 4CV3A 2J5RA 3GNTA 3BAZA 1DSSG 1U3TA 1P1JA 1H5QA 3VPSA 1U3VA 2H6EA 5ENDA 3W4KA 5DBFA 3UFXA 4OIMA 5CDGA 4J43A 4E12A 4AL4A 1H2BA 4KDFA 4JJFA 2C54A 1ENZA 4CM5A 4J90A 4TWRA 5DOZA 1ZCJA 1GDHA 1X1EA 2PV7A 2DTXA 4LVUA 4IMRA 3BTVA 4YB8A 2B83A 2HK9A 2Q1WA 4GSKA 3ZWWA 4AJNA 4OSOA 4CR8A 5L7WA 3QVWA 7MDHA 5TT0A 1WMBA 1NBOA 4XJSA 3VVCA 2UV8A 3AFNA 2O3SA 2JL1A 1H2HA 3ON5A 1LSUA 3JD0A 5DBIA 4YJFA 5A9SA 3M6IA 2PKQP 1WZIA 1BXGA 4CLEA 2B37A 4LRTB 5KJEA 3VAZA 5KTKA 5THQA 1Y8QA 3EYWA 9LDBA 3H7AA 3W8DA 1DRUA 4J1TA 1T1RA 2VZ9A 4QX6A 1U4OA 4HFRA 4XA8A 2CDAA 4J0EA 1K0UA 5TRTA 1XEAA 1KEVA 4O0LA 3N74A 3ROQA 2G82A 3PYMA 3DHEA 4XB2A 1E7SA 3MEQA 2BI8A 2D2IA 4DMMA 2NVWA 3EUWA 4KZPA 1HYGA 2EERA 3Q9UA 4M87A 3DDNA 1K3TA 5G0WA 1K5HA 1HYHA 3PHIA 1BXKA 4P4LA 2P91A 1DFIA 5A03A 2O4CA 5I7VA 5KIAA 2ZJ0A 1JQBA 2R6JA 2H63A 1NVTA 3TOXA 4R3NA 2HK8A 2EGGA 3S1LA 1DO8A 3PYLA 4IS2A 2AW5A 2X58A 3AM5A 4HNGA 3D3WB 2GN4A 5HS6A 4RPLA 3FF4A 2V65A 3CPSA 4Q3DA 4IM7A 1ZBQA 4IZIA 1W8DA 2BFPA 4E5PA 2X8LA 4OOFA 2X5JO 1W73A 3AI1A 2GNAA 3RSHA 5CPFA 3V2HA 1FF9A 4XZ3A 3JYQA 1U3UA 1QYVA 1SB9A 4QQRA 1UZLA 2OBYA 3EZYA 4XYGA 3VKUA 2J3HA 2Q99A 3NKLA 2WWRA 3DHNA 1VJ0A 5IXSA 4PRLA 2O3JA 4RO0A 4UUMA 2CVZA 1EK6A 2ZJ1A 3B1KA 4MJLA 2G5CA 3P7MA 4IGEA 2OORA 4FFNA 2O7SA 1HDXA 3AWDA 5C7IO 2GZ3A 4ZQHA 3H4VA 1WMAA 3W8FA 2WD8A 1PGNA 2JFGA 2R00A 3DTYA 2ILTA 2C7VA 5JC8A 1E3EA 4R01A 1ADFA 3L6OO 1NQ5A 1QYXA 1O5IA 3A1NA 3MCVA 2D59A 3RJ9A 3BMOB 4RVFA 5HS4A 2V6BA 3QVTA 2P4HX 3C8MA 1KC1A 4ZQFA 4PLFA 1UXGA 3DMYA 4BNJA 3PWZA 1PGJA 2DUUA 3F5SA 3WJAA 1NVMB 1AXGA 3GAZA 4F46A 1IHXA 1HETA 3SX2A 3ZNPA 2NACA 1Z82A 3I6IA 2BH9A 3RFVA 2X4GA 5L9AA 1QP8A 3NJ4A 1PQUA 3H65A 5TT1A 4OGWA 3A06A 3OBBA 4FFMA 4B4VA 2GN9A 2JAHA 2XPCA 5TX7A 5JDCA 1XR3A 1VLLA 3AK4A 4RPKA 5IZCC 4XYMA 1BGVA 1C0LA 4B7CA 3PFWO 3JQ7A 4BV9A 3FI9A 1DB3A 4OSPA 2YJZA 3TQHA 2PFGA 4CR7A 1JVSA 1EE2A 3ZW8A 3JQ8A 2FR8A 4J2HA 2Q1SA 2O3RA 4ZA2A 4GPD1 3OMLA 3K2EA 3HUDA 2YW9A 4JJGA 4CMGA 4KUGA 4UULA 3IIEA 4M54A 2D4AA 5TSDA 1GL3A 3GFGA 4IXTA 3WLEA 1UR5A 3ONFA 4AJPA 4FS3A 5DNAA 1MG0A 4BKPA 1P1IA 4ZQEA 3JQCA 3N58A 4L0QA 1GEGA 4XR9A 1IZ0A 3UN1A 1QSGA 4GAEA 1SC6A 5DF1A 4WLFA 2J3KA 1NPYA 3PIIA 1HE4A 2BKAA 1YL7A 4DYDA 4K28A 1YBMA 1ZK4A 3QVOA 5AOVA 5EPOA 4KTTE 1B8UA 3MJVA 2RAFA 3L9XA 1YO6A 4XCVA 3BHIA 4OYRA 4BO7A 1F14A 3UGKA 1QLHA 1BDMA 3ROPA 3HDHA 1Y9EA 1BRMA 3OH8A 4WCFB 4RPHA 1CETA 1PX0A 3MJCA 4E2WA 3IJRA 3EK2A 3WNVA 4FFOA 3O8QA 1UH5A 1PZEA 1GUFA 1Q7GA 3I9KA 3NTOA 4IJUA 5T57A 5TF4A 4CL3A 3COSA 2OFPA 2FPGA 2HDHA 4HADA 4PLGA 2HSDA 4I8XA 3KO8A 2NTJA 4N18A 3WGZA 3WWYA 1PZFA 2P9EA 1YL6A 1R0LA 2VUSA 3QE3A 3LC1O 1XQ6A 1GFSA 2X86A 1A9ZA 3MJSA 3WGHA 4DPKA 4YAGA 3EC7A 4PZDA 3FPCA 4AJ4A 3KVOA 3OEWA 2GYYA 3LZ6A 1ENOA 2DBVO 2LDBA 1A7KA 3C1TA 4W4TA 3DBVO 5F5NA 5HBRA 2EGHA 1TXGA 1JW9B 1V6AA 1YL5A 3R1IA 3ORFA 1L7DA 4MP6A 3K5PA 2WE7A 3H5AA 3LSYA 4UUPA 4H15A 5F5LA 4D7AA 3D0OA 1JAYA 1NASA 2EJWA 3ASVA 2BLLA 1GUYA 1I2ZA 3EMKA 4YRDA 4J3FA 2VTEA 2Y05A 1E7WA 5DCYA 5T6BA 1ISMA 4Q3AA 4YQZA 5C37A 4DBVO 2QZ9A 2NU6A 1AE1A 1GZ3A 4IY1A 2DC1A 3VPFA 1B26A 1G0NA 3ZH2A 3H9GA 2GSDA 1B15A 4TKLA 2WYVA 2P5UA 1I5RA 4BO6A 1SB8A 3Q3CA 1PJCA 2VHVA 1RKXA 2FY8A 3VH4A 4DWVA 1C0IA 2O23A 3GVXA 5ES3A 3C1AA 4BNNA 4E21A 2Q45A 4FGWA 4B7XA 3F1KA 3GN2A 1GUZA 4CM4B 3O26A 3QLJA 4IDGA 4MIOA 4PCVA 1RWBA 2Q2WA 1Q0QA 1QXSA 4CLRA 2PH5A 3ZGYA 2I6TA 3DR3A 5A3VA 4YEDA 2EG9A 5TC4A 3C1OA 1Y7TA 1ZH8A 2OGUA 1AXEA 4R5HA 4B4OA 4DIBA 4ZQGA 3RVDA 4E33A 4JP2A 1D3AA 5H82A 5EINA 1NWCA 3GZ4A 3HDYA 5JBIA 2HU2A 1K2WA 3I9JA 1Y81A 2O2YA 3Q6IA 3VPGA 4RVUA 3BTUA 2PK3A 1P1FA 2PR2A 3QIVA 4GX1A 3Q2IA 4FFPA 2ZIZA 5EJ2A 3RC1A 4CM1A 4XQGA 5JS6A 3IL2A 3O03A 1UZMA 3GC6A 1WAMA 4A03A 2DTDA 4RF3A 4XIYA 3S2EA 3INTA 4B8ZA 4RVSA 2NU7A 3ZWCA 4NDNE 3ZV4A 4BL5A 2OZPA 2Y0CA 3V2GA 2ZQYA 1ZKMA 3JD2A 4ND5A 5DT9A 5KJ1A 2IE0A 1U2GA 2CNBA 3HFGA 1DC4A 5GZ1A 1YQGA 3DMTC 3G3EA 2F1KA 3ASUA 2NU8A 2YV3A 5L7TA 4JXKA 1P0FA 2P2SA 4DLBA 2HMWA 3OF2A 1PJTA 4AJJA 2W4QA 1KVUA 1ZZEA 3PGXA 2DM6A 4JGBA 2X0JA 3E5RA 3PGJA 4L8VA 5A9SB 1CQIA 4XQCA 3FTPA 4A7PA 2VN8A 4Y9DA 4A73A 3TFOA 4BMVA 3AU8A 4MVJE 2FZWA 5KJCA 3RBZA 2Q1UA 3D3WA 4DPMA 2YFHA 3RUCA 1LJ8A 4XGKA 1BVRA 4IIUA 2H1SA 3WXBA 3WSVA 4FQ8A 4QO7A 2Y0DA 1E7RA 1IE3A 4O59O 2EW2A 3KB6A 3VPHA 3CZMA 4Z0PA 3OECA 3GVPA 2D5AA 4ROSA 5JDIC 1T4BA 1P74A 4LRSB 2GZ2A 4MVJF 4AJLA 4YRAA 2Y66A 4CM8B 3GVCA 3WIDA 4DLLA 4YXFA 4PG4A 1XG5A 4URFA 3MWEB 1R4NB 1ONPA 4J0FA 4UEJA 1DDOA 2VHZA 3JCZA 3UICA 4P8RA 3VDQA 1N1EA 4MP8A 4FBGA 4ND3A 2PLAA 5L45A 4BOYA 1NHGA 4II3A 4MVJH 1RM0A 3K96A 1X0VA 5CEFA 5U4QA 5K6AA 4F6LA 3DZIA 2C5AA 2OL4A 3AUUA 4LISA 5BSEA 1A4IA 3UAGA 5G2OA 3LF2A 4FD3A 1MXHA 4G5HA 1ZSVA 4TRJA 5EMHA 4AJKA 2FPPA 1VE9A 2P9GA 2JCXA 1E3SA 1IPEA 1Z7BA 5HWSA 2O48X 4EUHA 1QR6A 1BDBA 3PK0A 3GY0A 1KVQA 4JLWA 5H83A 1ZVMA 1OBFO 4L4SA 4EDFA 2J6IA 2QRKA 3K9QO 4I5EA 1KBZA 4YJGB 3PHJA 3JQFC 2PKRA 1GR0A 3BMOA 1WXDA 4IJKA 1WDLA 1I3NA 2EJVA 4TMFA 4NU5A 1QG6A 1ZO8A 3B20A 4XRGA 4UVHA 2X0IA 3NYWA 4NMHA 1HDOA 3Q0EA 3F4BA 1KVTA 2UUOA 4G81A 3TL3A 5C7OO 5ICMA 1GADO 3GDFA 3DWFA 1UXIA 3U9LA 3PLNA 1C1XB 4BO2A 3S2IA 4CJXA 2D0IA 2VCYA 3LU1A 4J6FA 4XRRA 2HLPA 1XQ1A 2GRAA 3S2GA 3GUYA 3K73O 3AOGA 1NAHA 3PJFA 1O6ZA 2B69A 2QX7A 3QVSA 4GVXA 1HE5A 1PJ3A 4MO2A 2DPGA 1U8XX 1T2DA 2W2LA 4IPTA 1KY4A 3MOGA 3WMXA 2J3JA 3GGGA 2PZJA 4GX2A 4J7UA 3L6EA 4UVGA 4IMPA 2AMFA 4DGSA 2FOIA 3H2ZA 2PGDA 3WB9A 4DL9A 3RFXA 1UDAA 1HZZA 3F47A 2WTBA 1ZFNA 1DFHA 4R9SA 5DP2A 4IDEA 3VH3A 5JYEA 4ALKA 2OUIA 5A5FA 1PWZA 1ZMOA 4YA6A 2PD6A 4WEOA 3UKOA 2ZYDA 1BVUA 4EJ6A 3RUAA 1LLCA 1VM6A 3D4PA 1GCOA 3AUTA 4CR6A 3WGTA 1OZAA 1Q0HA 1B3RA 1PGQA 4Z9FA 4J2OA 3VPXA 1LEHA 1Y5RA 3MJTA 1KIFA 4XJTA 3DO5A 4LK3A 1ZK3A 3IUSA 3JQ6A 1B16A 2QQ5A 3H9EO 4UVIA 5BSHA 3NDIA 1PR9A 3KM0A 4RDIA 2PWZA 3E6AA 1YQDA 1I32A 4PLVA 2W98A 1T25A 4ITUA 5JFOA 5F1PA 2WE8A 2UDPA 3E9QA 3WBBA 1F0YA 3HDJA 4TVOA 3OP4A 3WGQA 1E3IA 1R6DA 1R15A 1H6BA 5BR7A 3VTFA 4EI2A 1A9YA 4HXYA 4WCFA 1PU2A 3KYCB 1P77A 3MJEA 4YJDA 1EQ2A 3JQGB 1JDJA 1AHHA 3JSAA 2Q1TA 3NT2A 2BRUA 4Y6PA 4WE3A 1B8PA 1AHIA 1RPNA 3MJ4A 2SCUA 2P5YA 2ET6A 5I8WA 1MXFA 3V5NA 4IS3A 5BSFA 1C3VA 2YQ4A 1XSEA 2X9GA 3GHYA 2AEMA 4HNHA 4PLWA 1TB4A 3JD4A 3WTBA 5KNLA 4E5NA 4Z0TA 4IQ8A 2WSBA 4WASA 1HLPA 2FR0A 2LDXA 4KWIA 1Q1NA 5L7YA 3ZU5A 3BMQB 2IRWA 1LDBA 4Y8VA 1X1TA 2DLDA 2CY0A 4UUOA 1ULSA 2NTNA 1LDMA 3QWFA 1R37A 2W8ZA 4NPCA 2Z95A 3ZU3A 3ZWAA 4CV0A 5ICSA 4I9NA 3T4XA 3TZHA 2AQ8A 2IYPA 3GEMA 2AQKA 4EJMA 5DCUA 5GY7A 4HWKA 4A2CA 1T26A 3BA1A 5IDYA 5TLSA 3AU9A 2AA3A 3DFZA 2VHXA 4ZD6A 3ULKA 4NBWA 1EVIA 3GAFA 2QG4A 3D5TA 1R4MB 3WDSA 4YAKA 1DHTA 1YVEI 3WIEA 2VYND 1SOVA 2O3QA 3GOHA 4CMEA 3OFSA 3SLKA 4BNGA 1FDWA 1ADCA 1GYRA 2JD1A 3GK3A 3JQBA 2D8AA 3ZHYA 4XR4A 1P0CA 2ZTUA 4BV8A 2VT3A 5JPIA 2DU8A 5AXCA 4RF4A 3FPLA 3RC9A 3S55A 1XKQA 1J4AA 2J5KA 5IF3A 4CM4A 4CLOB 1KY5A 1U2DA 2BGMA 4AVYA 5L40A 5FF9A 2CF6A 3D64A 1YQXA 3BMNB 3WFIA 3GFBA 4GBJA 1CWUA 1HSOA 3KHUA 4CQLB 1GQYA 3KV3O 1FXSA 3G49A 4ZVVA 1IHYA 3VHRA 4CODB 3ANNA 1DC3A 3F1LA 1TA4A 3DL2A 2B4TO 1ADGA 1N2SA 2NM0A 4GL4A 1UAGA 3OETA 4IUYA 3IKVA 4FW8A 1ZJZA 1GYPA 1MC5A 1ISHA 4JROA 3DQPA 1LC3A 4IINA 4LN1A 2CZCA 1R12A 1O8CA 3JTMA 3TZQA 1Y8RB 4MPDA 4Q3BA 1EDOA 3IOYA 4L75A 5G4LA 4M86A 3F6YA 4BGIA 1K6JA 3QP9A 3ZW9A 2X9NA 4RGBA 2GASA 4R9RA 4LCJA 1E0DA 1QYDA 4CLRB 5A4DA 1NTOA 2BHLA 3QWIA 3CINA 2IEBA 1PR3A 4E30A 1HSZA 3FWNA 3GVHA 5JCXA 4CMIA 3TSCA 3TF5A 2OO5A 3EZLA 1P3DA 3OQ6A 1DLIA 2I76A 1YS4A 4KTVE 1DIGA 2VNAA 1BMDA 2R00C 3HJAA 3JQAB 3R6DA 4J9VA 1OAAA 2AXQA 1DAOA 3VZPA 1KERA 2IXAA 2XXJA 1F17A 1NNUA 4D0RA 3FNFA 3GEGA 3I83A 4PG6A 5FFFA 5BQFA 1PTJA 3EVNA 4MIYA 3H9UA 3LLVA 2X0NA 1UDCA 2JHGA 2C82A 2JKVA 1ZMTA 3MTGA 3P19A 4G2NA 5I9MA 4E32A 3GGPA 4AFNA 2VZ8A 4ALJA 4EW6A 1RJWA 2HO5A 4E5MA 2QIOA 1WZEA 3FD8A 4CM8A 4CUJA 5KOIA 3SLGA 4BQRA 2O4UX 4AICA 5JAMA 2BFMA 2B4QA 1WDKA 1QRRA 1R4NA 3MWDB 4EGFA 4B3HA 5A04A 4Q3NA 2IDZA 1XYGA 1SNYA 4W7HA 1EE9A 2HJSA 1QORA 1VJ1A 3IAHA 4NI5A 2CDBA 1MP0A 1HYEA 4BUCA 1TEHA 1KETA 1HEUA 1XHLA 5BSGA 2PTGA 1T2FA 2NU9A 4XGNA 5B12A 4QUKA 3QA9A 4B4WA 4Y67A 3H2SA 1Q0LA 5JW6A 3HE3A 3I9NA 5HTOA 3GDOA 1N92A 3QY9A 1BHSA 3I4FA 2CUKA 2GDZA 3PLRA 5IAAA 1E1MA 2HRZA 3ADOA 1XU7A 3DOCA 3IS3A 4YJGA 3UF0A 4ND4A 3CEAA 1ZK1A 4PLTA 1DJNA 3IJPA 1I10A 2WD7B 2BFOA 3X2EA 4KP7A 4DQUA 5F3RA 3JQ9A 5KVVA 3E48A 1JA9A 5C5IA 3NTQA 1N9GA 1YWGO 1F8GA 4NFYA 4U0JA 1C1DA 3W6UA 3V1YA 2Q2VA 3WYEA 4CMHA 1GQ2A 1C1XA 1AN9A 9LDTA 4IJWA 3OJFA 3FSRA 4CM7A 2F00A 4NH4A 1V8BA 3RC7A 3WICA 1NR1A 3LT2A 3JYNA 4Z0HO 4FJ2A 4YTEA 1K6IA 1Z74A 3WYCA 4JBGA 4D3DA 2IZ0A 3CSDA 4NU6A 2DAPA 1GU7A 2QW8A 3AM4A 5HA5A 3ZV6A 2EKLA 1X7HA 1ML3A 1PIWA 2X22A 1L1FA 3DZGA 4D42A 4GWGA 2GPTA 4QT0A 1UP4A 4CM6A 3G17A 1I2CA 4E13A 3EVTA 3WMWA 4D41A 5L95A 3NUGA 4YWJA 5MDHA 3PI7A 4DUPA 5U9CA 3QWAA 3F9IA 1FDVA 4RPJA 2I67A 3PTZA 2GCGA 3DONA 4WEQA 3SXPA 1SZJG 2C29D 4W82A 5GMOA 4L73A 2FWMX 3DZJA 4ONEA 4D46A 3ADPA 3KETA 1NYTA 2GLXA 3MTJA 3BTSA 1GY8A 1LA2A 1O94A 3ICCA 2Y99A 4FOOA 1M76A 2YZ7A 4YDRA 1XA0A 4Y98A 3I1JA 4E5YA 2WYWA 4QECA 3OQBA 4XGIA 5B1YA 3I9OA 2VYVA 1UXJA 1SBYA 1X15A 4P38A 1DAPA 3KYCA 2E49A 4J1NA 4F6CA 3JQGA 4PVCA 4NJOA 2FN7A 2WYUA 2YDXA 4BO0A 4DREA 4WNIA 1D7OA 2AHRA 2B5WA 1FMCA 2C20A 2X7HA 3DBRB 5JYDA 4P4NA 3GT0A 1IOLA 1LX6A 3PHGA 2DBQA 1H6CA 1X14A 1CIVA 4IZHA 4E2ZA 4KUHA 1NHWA 1ZUD1 1GCUA 4A0SA 3FR7A 2NVUB 5ADHA 1H0KA 4WNCA 2CSUA 4WKGA 1LRLA 2VT2A 4R1SA 3BMQA 2V7PA 4EJ0A 3BMCA 4IDBA 3WX0A 4CM9A 3I5MA 2HMVA 2OHXA 3I9MA 3K2BA 1UJMA 4PZEA 1P1HA 4XDYA 1MC4A 2CFCA 4BKRA 2EW8A 3O9ZA 4IIVA 1NPTO 3L6DA 1VKOA 4OHUA 1AUPA 4PZCA 5CDYA 1EZ4A 3ETGA 4DBZA 2BFAA 2H9IA 3K6JA 1D1SA 3TL2A 3WSWA 4FN4A 3PFFA 2B4RO 4OAQA 1H9BA 3CMMA 4IDDA 4WGGA 3VZRA 4PLPA 1EVZA 1I36A 3FTNA 2JHFA 1QLJA 1HF3A 1R4MA 2O2SA 4MVJP 3AY3A 4D44A 2I5PO 4PG8A 1BWSA 1XU9A 2YY7A 4GH5A 4YYZA 3ETEA 4B3JA 1U3WA 1XIVA 3FWZA 4XDZA 3U4DA 3ROMA 4BIIA 1Y1PA 1OOEA 4GSLA 5G0VA 5TS3A 4CMJA 2DUWA 3WOHA 1CRWG 4Z9YA 4WUVA 3PJDA 4J4BA 1E1KA 1V9LA 2TMGA 2V6GA 1U5CA 4BNZA 3JD3A 5T67A 1KEUA 3KSUA 1YKFA 4CLOA 5IZ4A 1LTHR 3RKRA 5ILGA 4Q9NA 3BMNA 5CP8A 3GMSA 3IP1A 3G1UA 1NX6A 1I3LA 2G0TA 3L0DA 4CQLA 4TQGA 2VWQA 4Y6RA 5JCJD 3WGYA 2D1YA 1M6HA 1VI2A 1O95A 1U9JA 3ST7A 4O1MA 3GPDG 4NZ9A 1ZNQO 4R5MA 3DZBA 4RQTA 2ZATA 1PGOA 1P33A 3ZNQA 2AG8A 5CEEA 2X0RA 4DXHA 1ZXLA 2AQHA 2RH4A 3K92A 5AVOA 1ADBA 2JD2A 1Y8RA 1ZJYA 1U28A 3M1AA 2VUUA 1B7GO 4PLZA 3I3OA 4R16A 2IZ1A 3H8VA 3C3XA 3HZZA 1RM3A 1X0XA 1YB5A 4FGSA 1BW9A 2VWHA 3LK7A 3JD1A 4QXMA 1OFGA 4NFSA 1E6UA 3SC4A 3G0OA 1YDEA 4ALNA 2Y1DA 4BO9A 3HQ4O 3CUKA 3W4IA 4BNFA 3GRKA 5LDHA 3IDSA 1HKUA 4MKRA 3P5SA 1KEPA 4A27A 1IYZA 1J0XO 3UCXA 1RM4A 5T8KA 5DP1A 4L4XA 2VRBA 2YQ5A 4NQZA 4FOSA 4Z3DA 3GHHA 3PHHA 4AG3A 4R3WA 4PFJA 3JQAA 3LT4A 1E3WB 4PIVA 2ZB4A 3PPIA 1P44A 2A35A 2JD0A 4PVDA 1NR7A 1T4DA 2ZK7A 1DIBA 1PZHA 3GH3A 4U0KA 4DIOA 1IY8A 4F45A 1LU9A 2BD0A 3ROKA 4BNXA 5DCWA 6ADHA 2HKIA 2HJRA 1SEPA 4GKBA 1JWBB 2C7GA 3F46A 3INGA 2ZYGA 1WW8A 3ITDA 1I2BA 4I1IA 3ZWXA 4R68A 4H16A 1IPFA 1K6XA 4GMFA 1VL8A 4CMIB 4RV9A 2C07A 4INAA 1ARZA 4IQ0A 4ID9A 2ZB8A 2Q4BA 1E3JA 5DZSA 1HDZA 5G4KA 3A14A 1JLLA 2ZKLA 1KVRA 3T7EA 2JAPA 5JO0A 4GLLA 3ETDA 1BSVA 1OC2A 3Q1LA 4KOAA 2GZ1A 4BGVA 2QRJA 4ZGWA 2VRCD 5A1TA 1M75A 3PQEA 2I66A 1W6UA 1JN0A 3PJEA 4J9UE 2WMDA 2FHSA 1CEQA 3RUIA 5THKA 1HDCA 1M67A 4MIEA 1IL0A 4RLHA 4PLCA 4WLNA 4Q39A 5EERA 1KYQA 2EF1A 2WD7A 2OOSA 3KLPX 3WR5A 3WQSB 2GUGA 4CQMD 2A92A 4E31A 1YRLA 4RF5A 3FNHA 1J6UA 2EEZA 3SJ7A 1XELA 3LT0A 3H3JA 5L4LA 3KYDB 2ZCVA 2X6TA 4XB1A 1Y9AA 3VOSA 1X13A 3RU7A 3LLSA 3D7LA 4W7IA 4KWHA 4I5DA 3PIDA 2VQ3A 3VVBA 2NUAA 1H6AA 4YJHB 5JMPA 2A94A 3D1LA 3TZKA 5IDWA 4TKMA 3GVIA 3C85A 1ISJA 1HT0A 3OIFA 4RF2A 4LMRA 1GZ6A 3KSDO 3AOEA 3C7AA 4FB5A 4D45A 1XWFA 4NBTA 4A26A 4BO8A 4WCFC 2B35A 3LF1A 5COBA 1XGKA 4I08A 1PJ2A 4L4RA 4FPXA 3VZSA 5KVSA 1G1AA 2EIHA 1UP6A 4WPGA 3DBHB 3QV1A 1WLYA 4E0BA 2PKQO 1R16A 3L4SO 4NK5A 2NLOA 1TT5B 1N9GB 3OIGA 3U5TA 1PL6A 1JTVA 1I24A 1VKNA 1C1DB 4GX0A 1VJTA 4DLAA 4I9HA 2JJYA 5B4UA 4M1QA 2Z1NA 1NFFA 2Q4EA 1U1IA 3L4BA 4UREA 3I9LA 2Y68A 5G0UA 4BKUA 1DC5A 2GR9A 2YHIB 3L77A 5IFLA 3KSZO 1ENYA 4MVJD 5TIIA 3AY6A 4K6FA 1YXMA 2PH3A 4R4JA 1ZSNA 3IUPA 3RUEA 5IXYA 1N1GA 1YJ8A 1JAXA 2GERA 4MVJM 1DRVA 1DXYA 4BO1A 1SAYA 1WPQA 4YAJA 5T5QA 2GN6A 4OKIA 3TDKA 3RUFA 3G1TA 3DMTA 4MKXA 1MUUA 3ZI0A 1XDWA 3AFMA 1PJLA 3RAJA 4O6VA 4FFLA 3IQDB 1W0CA 3EY4A 1P1RA 3RIHA 2VOEA 4CMEC 1ZIDA 1GPJA 3E03A 1E92A 1BXZA 3WQQA 5JC1A 1NPDA 2D5CA 3EAGA 3JQBC 1ISIA 5ER6A 2AEJA 4GGOA 2RCYA 2GGSA 1HZJA 2YUTA 3DBRA 3BIOA 1LDGA 4NG5A 1ZEMA 2EP5A 3QJ5A 2DVMA 3DZHA 3CH6A 4H3VA 3NT5A 1HDRA 2RHRA 3WGIA 2ZYAA 1E6EA 1LQUA 1GV1A 3EGOA 2NVUA 4CLHA 1LSOA 2G1UA 4OXKA 2E4AA 4NIMA 3Q2KA 1GEEA 1PJBA 1LLDA 3DZKA 4BO5A 3ZDFA 5JDIA 4BMNA 2XAAA 1PQPA 3BZUA 4HUJA 4I9UA 4CV2A 5AYVA 4TROA 1UDBA 1N7HA 3HB5X 4TZKA 4CPDA 1OI7A 2AE1A 2O50A 3JV7A 1NXQA 4PGFA 3BHMA 1HDGO 2PY6A 5L51A 1T2EA 1CDOA 2CF5A 4IJVA 2X5OA 3DOJA 3NDJA 4JQCA 4JK3A 2NVBA 1YONA 4HX5A 3VDRA 4UEKA 1HL3A 4O5OA 1NFRA 1MLDA 5B37A 1PJ4A 5CPBA 2OP1A 4Q3EA 1CQJA 1EFKA 2AEFA 1NFQA 2IXBA 1H6DA 4LCEA 5I7SA 1IZ9A 3DBLB 3E9MA 1KVSA 3R3SA 4N5LA 3BMCB 4R1NA 3WLFA 4A5OA 4AJOA 1E7QA 3OJ0A 1QYCA 1JVBA 4R41A 4X54A 3S8MA 3ZNNA 4C4OA 5JNLA 4MVJI 2ZB7A 1HWYA 5C7LO 3UOGA 1L7EA 3RQSA 1GPDG 1W4ZA 5BT9A 4RVGA 5FEUA 2I3AA 4LW8A 2O7QA 3P2OA 1A71A 4Q3CA 3PDJA 1LDYA 2OBNA 1ISGA 2Y1GA 3P2YA 1LRJA 1MGOA 5IJZA 4MVJG 1PS0A 2WM3A 4JX8A 4L76A 3KEOA 4NR0A 1S7CA 3KUXA 1FDSA 2E48A 4XX0A 4D3FA 2PZMA 4RORA 3T4EA 3QWHA 1A72A 1ID1A 5ITWA 1ZK0A 3DFUA 5JAIA 4IDFA 2ZB3A 1N5DA 1CYDA 4B79A 4AJ1A 5KJ6A 3QQPA 1M66A 1WVGA 4E4YA 4R51A 1U7HA 3K30A 5JO9A 3BHJA 3KLMX 2VZ0A 5LDGA 2P9CA 2PNFA 4JNKA 3ZWVA 5DDIP 2NSDA 1C0KA 5COAA 3TWOA 4HFMA 1BTOA 1I33A 4L9RA 2EXXA 4ZU3A 4U7WA 3OQ1A 2BGKA 3WGOA 4ALIA 4EBFA 2J3IA 4EUEA 1PL7A 3ITKA 1GZ4A 5TGDA 1EK5A 2CMDA 2GO1A 5CG2A 5I7FA 4U6QA 5L53A 2E37A 5EN4A 4U5QA 1N8KA 3I4CA 4BNLA 3INRA 3D3EA 4GI2A 1GAEO 4PG7A 3QHAA 2Y67A 3DHYA 1SMKA 3HDQA 1Z7EA 4DYVA 2C2YA 3BXXA 1E3WA 4PRKA 1IUKA 2Y1OA 4M55A 3TNLA 2IZZA 2I65A 1EFLA 3E82A 3M2TA 2FMUA 4U8GA 2CVOA 2PZKA 3CE6A 3JQ9C 3U4CA 1CJCA 4YAEA 5AXAA 1EBFA 1BW9B 1U7TA 4W9NA 1MG5A 4I5FA 5G0SA 3LC2O 4FCCA 3JYOA 1BG6A 1EQUA 3IP3A 3UCFA 3WQRA 1A4UA 3F4LA 2XOXA 2FPIA 3S2FA 2ZCUA 1U5AA 3E9NA 4BNMA 3MOIA 5I9NA 5JLAA 3A9WA 2HMUA 3B6ZA 2I3GA 4JBIA 4K9DA 1ZK2A 1V3UA 3QSGA 1R0SA 1LLUA 3NV9A 3IKTA 4RJTA 1DHRA 1P9LA 3M2PA 3ZWNA 1LI4A 4JJIA 1PGPA 2GN8A 1LBEA 1E5LA 2BI7A 2HRBA 2GD1O 5I8ZA 2C2XA 4J16A 1EVJA 3OA0A 3U4IA 4DPLA 5MGBA 2QYTA 3AM3A 1PJSA 2O3TA 1EUCA 2B36A 2Y1CA 3AUAA 3PWKA 4YT8A 4BVAA 2NV6A 5JCJA 1YOVA 4C7KA 4CM3A 3DAGA 3PYXA 3RC2A 2O3UA 1JWAB 1V35A 2HCTA 2FSSA 2HMTA 1Q2XA 3PZBA 3NDRA 4YACA 4TRRA 4FC6A 5EQDA 5G4KB 2RHCA 2NWQA 5JDCC 3KYDA 3V2UA 3HFSA 1NQOA 1J5PA 4WLUA 1E1LA 4BNWA 4BGUA 1B2LA 5EQFA 2QRLA 5ILOA 4OQZA 2W2LD 4NBRA 1LDNA 2X9VA 1UUFA 2RIRA 4ZJUA 4YJHA 4YR9A 3GZNB 3TPCA 3VH2A 3RUDA 4ZRNA 3TRIA 1LQTA 3BTOA 3WYBA 3GEDA 3H6KA 4JCOA 3EHEA 4I5GA 5T64A 4YAIA 4UUNA 2PD4A 1YJQA 4B3IA 4DQXA 3NT4A 4MKZA 1PWXA 3U49A 5TJHA 1SEVA 4RCVA 2AG5A 4FFRA 2WDZA 3PWSA 4DQVA 3NEPX 2CD9A 2BMAA 8ADHA 4HFNA 3SBOA 1UAYA 1EBUA 1O9BA 5CDSA 4H7PA 3FRJA 4BNKA 3GR6A 5CFZA 3DBHA 1HE3A 4KUEA 2DKNA 1D8AA 3OJLA 4BNHA 4LGVA 4DIFA 5K0ZA 5LCXA 1V3TA 1TT5A 4PG5A 4GKVA 1KS9A 4HV4A 1X7GA 4CMCA 4ZRMA 4EZBA 2X5KO 3BYZA 4QFDA 1H94A 3RUHA 7ADHA 3NJ8A 3L9WA 4QEDA 5F1OA 4W99A 1ZEJA 4TRNA 2YHIA 3OHSX 1ONOA 3H5NA 2EV9A 2UVDA 3OSUA 4OXYA 3RWBA 2YV1A 3GG2A 1ZXBA 3CIFA 1QMGA 4QFCA 1TVEA 4YBZA 3B1JA 4A10A 1LDEA 2P4QA 2B0JA 4NJMB 3NAQA 2ZTMA 4YRBA 1TI7A 4DVJA 1MFPA 4S3MA 1PZGA 1NQAO 1VL0A 4D79A 3LDHA 1M2WA 3R3JA 1ISFA 3LC7O 2Q46A 3CXRA 2G17A 1YH3A 2DBRA 4JIGA 1JU9A 3JYPA 4J91A 1E5QA 1RYEA 5B4TA 5BNFA 1WP4A 4J49A 5A05A 4ZN6A 5KVCA 2PD3A 3QWBA 2ZTVA 5C3MA 2I99A 2WEKA 1TT7A 3GG9A 1G6KA 2VRCA 1VC2A 3DEYX 3E1KA 1DLJA 2YHUA 5IDXA 3PEFA 4QTZA 3Q11A 4E3ZA 4WK6A 2C0CA 1LRKA 4OJNA 4B7UA 1M6WA 1DEHA 3OEYA 4GQAA 1P45A 4NNJA 2HUNA 4WJZA 4BHTA 2VUTA 4J7CA 1PQWA 2DT5A 3DTTA 2RBEA 3H9QA 4LMPA 1FDTA 5LC1A 5CHEA 1VSUA 4CQMA 1NAIA 2HAEA 1UZNA 4TRMA 1NWHA 3PQDA 2PA3A 1QV6A 1E7MA 1YB1A 1UP7A 4BNUA 3SEFA 1R66A 2HMSA 4M8SA 4II2A 4W6ZA 3KTDA 5HM8A 3ONEA 5HRUA 3K31A 4RZIA 1E77A 4BNIA 3QW2A 3LT1A 2W2KB 4YT2A 5KVQA 1F12A 5L4NA 3E8XA 3GQVA 1DIHA 3TZCA 1LSJA 4Y6SA 4CUZA 2CDCA 5DN9A 3NRCA 5JAZA 3DBLA 3OIDA 5GZ6A 1H93A 2Q50A 4FSHA 1QV7A 4PN3A 2G76A 4IDAA 3U4HA 1GYQA 3O38A 4IDCA 5T8KC 5BNTA 3HN7A 1D1TA 3GMDA 1EVYA 3WJ7A 2VWGA 3F5QA 3HADA 3OJEA 5G0TA 2Q3EA 3GNQA 4OXNA 3WNQA 3V8BA 3FR8A 3OA2A 3GLQA 3DXFA 3UUWA 3ZN2A 3I23A 1JKIA 3PHLA 4MVJA 2VHWA 3K8ZA 4BKOA 3AY7A 2JFHA 5BNIA 1YE3A 5JMWA 3STHA 2YFQA 2NTVA 3ENKA 3ZWBA 2EP7A 2XXBA 3UVEA 4N54A 3RJ5A 1VRWA 5F21A 5ENVA 3ZWMA 4MP3A 3PQFA 4C7JA 5KKCA 4BO3A 4ND1A 1EDZA 3GUCA 4TSKA 2W90A 4LSWA 3AI3A 5AQ1A 4FR5A 4OOEA 1V3VA 4BGEA 4LVCA 3KOUA 1O89A 1O0SA 3NGLA 3RKUA 4BQPA 5CG1A 5EL0A 4P4GA 1B0AA 2EHDA 1CERA 2A4KA 3OM9A 3R0IA 3CTMA 5A3JA 4GGPA 5H81A 3SVTA 4XYBA 1DJQA 4N5NA 5F1KA 1IULA 4WLVA 4HKTA 4K6CA 3UW3A 1AGNA 3UCEA 4CLXA 3LYLA 3X2FA 1FK8A 2CVQA 3H5RA 4GWKA 4M89A 3ZHXA 4OH1A 1JKFA 4ALLA 3B1FA 2D3TA 4NK4A 1C14A 1UXHA 2UYYA 1Y6JA 5CDTA 2DFVA 4B8WA 5JXWA 4G65A 3IC5A 3DAFA 1NQTA 3WG9A 1LUAA 3ZWOA 2Q49A 3Q9NA 1U4SA 2BF7A 3FHLA 2AQIA 5EIOA 5IZCA 3F3SA 2EKPA 4CUKA 1B14A 3UHAA 2DFDA 3E5MA 3E18A 1PL8A 3ZV3A 3A4VA 1MX3A 4DC0A 5U1PA 4GLOA 4PLHA 1HDYA 2EWMA 2GF2A 1D4FA 4D3SA 3ZU4A 3DC2A 3PRJA 3ANMA 4ILKA 4AJEA 5K6AC 4CV1A 3HSKA 4D0SA 4EUFA 2A9FA 4J4TA 1FJHA 1G0OA 3WBFA 2Z5LA 4XQ9A 5J23A 1U8FO 4XKJA 1VPDA 1GV0A 1LC0A 2X1HA 1LXCA 3AOEC 4E5KA 5A5EA 2DPHA 3CZRA 3OJOA 5A06A 2ZTLA 4HBGA 2VTDA 5KJFA 2WJPA 1HLDA 5KWEA 5CAEA 3GA0A 4P22A 2FZEA 3VTZA 3WTCA 1DBVO 1P1KA 1Z73A 4RLSA 1E7YA 2VWPA 3QRWA 2AE2A 3ZV5A 4U6SA 3GGOA 3GPIA 5A02A 4R1UA 4YPOA 3KZVA 1YB4A 5AXDA 5TQVA 2QYSA 4FJ0A 5JAQA 3DZFA 1OMOA 4UAGA 4KQXA 3L4BC 4DMLA 1B8VA 1LSSA 3GN1A 1YBAA 2PZLA 1Y5MA 5AXBA 3JQEA 3FCOA 2NQ8A 4F3YA 2VYNA 4OM8A 4OQYA 1Z6ZA 2NQTA 1YBVA 3FNGA 3FBTA 3HB4X 1ZSYA 3PVZA 4LSMA 3HN2A 1SOWA 2UAGA 2V6MA 4NFHA 4NBVA 3ENNA 2DTEA 1YDWA 4ZHSA 5ITVA 3RBVA 3V1TC 3GZNA 1EEHA 1NVGA 4FC7A 5KKAA 3ZHBA 5A9RA 3HG7A 4GVLA 3AI2A 4FJ1A 1RM5A 3GDGA 3W1VA 4ALMA 4UVDA 5A9TA 4BS9A 5L4SA 2V6FA 3D4OA 4YJFB 5ER9A 3RU9A 1BXGB 5JSFA 3PP8A 3TOZA 5I9LA 2X23A 5DOVA 3PJGA 3U62A 1Y8QB 1DIAA 3H3FA 4RVDA 4CMKA 1YOVB 3SC6A 4RVHA 1A5ZA 2NADA 3DAPA 2C59A 4XIJA 1EUZA 3U3XA 4B4UA 3HHPA 2POQX 4CLDA 2QHXA 2I9PA 1EUDA 4WOJA 4ESOA 4WLOA 1Z45A 2YV2A 2PGJA 1S6YA 3W4JA 3DB2A 2OXIA 4OO3A 3I52A 4RPGA 4IGFA 4JBHA 1T24A 1LLQA 2VHYA 3AUSA 4WOKA 3PDUA 1WDMA 2DBZA 4PLYA 3WWZA 4BNVA 1ENPA 4KQWA 3G79A 2VYVD 4QSMA 3OICA 4NJMA 2FR1A 1GTMA 1EMDA 2Z1MA 4XWYA 4DC1A 3HWRA 1N7GA 4OL9A 1ORRA 2VNSA 3RASA 4R1TA 1KC3A 2JFFA 4HFJA 4DRYA 5GZ3A 1KEWA 3FN4A 1HRDA 1C0PA 1PSDA 3UXYA 4FIZA 4FDAA 3DOOA 3FNEA 4CM9D 3W8EA 1A7AA 1WWKA 2FRDA 3C7DB 4DA9A 5JY6A 3KYBA 3UH1A 4AJ2A 4EITA 1RYDA 4CL8A 3LVFO 4YQYA 4Z3KA 1MFZA 1DOHA 1DIRA 1QKIA 3W6ZA 3JYLA 2E82A 3L07A 3ZCXA 5FI5A 3LQFA 4K1LA 1VL6A 3CMCO 1MA0A 2TMDA 1DC6A 3AW9A 4E2XA 4D43A 2FP4A 1T2AA 5K9ZA 1MV8A 4QO8A 2C5EA 5IN5A 2W2KA 3A28A 3FBGA 3TJRA 4DTIA 4IBOA 1UXKA 4ZQBA 4WCDA 2PGLA 2RH8A 1F8FA 3NTRA 1Q7CA 3NX4A 1ULUA 2YDYA 2OMEA 3D4NA 4GX5A 4JN6B 3ANLA 5TJ9A 3RROA 4AJHA 3NGXA 4CMAA 5KCZA 1E1NA 1Q7BA 1VSVA 3ABIA 4UEOA 4J1QA 3RCBA 4N7RA 4CQMB 4R54A 1CF2O 3V1UA 4KMSA 4HY3A 4M49A 3KXDA 3MZ0A 4BNYA 1MB4A
chains in the Genus database with same CATH superfamily
1ZW1A 4WVFA 1WXFA 4WY5A 3T7CA 4MWBA 2PUDA 3AVYA 5CEJA 4XLLA 5TMBA 1G6HA 2QLNA 3KTAB 1J2YA 1YGYA 2W0MA 1P29A 5EESA 2XOEA 1V95A 4OA8A 3JQ7B 1RRMA 3JASB 4DCNA 3L3BA 1O4WA 5CFQA 1GQQA 3FB4A 2RKWA 1AD2A 1X8LA 2ATEA 2VYQA 3I09A 3JAKA 4TTJA 4WN9A 2Q2QA 4B2LA 3JQ8B 3TTTA 3F7OA 1X9HA 5JNVA 3DE1X 4F2PA 3G8BA 1KDVA 1E9RA 2QUHA 4C4XA 3R3VA 3Q7EA 4H7KA 4J1SA 2FSVA 2YWXA 3K3PA 5PGMA 2DQ4A 2DFKB 3I6QA 5EMKA 1A27A 4TYMA 2OP0A 1HYQA 5SV2A 3ILYA 3PIRA 4KNVA 2QYHA 3D5QA 1BEUB 4BMSA 2MIIA 4O4LB 1XXHA 2KW5A 4RQUA 4XB6B 3O1IC 5ELLA 4CKXA 3OZRA 3L4JA 1PS9A 1UQUA 4OQQA 1HH4A 2AMVA 1E9EA 1V45E 4LTMA 4NAHA 1WXHA 1TM5E 4UVEA 5L6MB 4MHSA 3SHFA 4HBZA 3JZFA 2XNCA 1X7DA 3M1LA 4INOA 2ORYA 1MPXA 2HHCA 5BV7A 1E61A 2ZSJA 3JQAD 4XPIB 4ENWA 3AV0B 3DDWA 3DKIA 1O1YA 2W6JA 4UMVA 4LJRA 5AKHA 1E6WA 1ULTA 1UEXC 1IOVA 3A9VA 3NHZA 4NABA 3C97A 4O63O 2VDWA 4LHSA 2MSCB 4U2EA 1MCZA 4CDMA 4WLEA 4Z4IA 2OV8A 1SQ0A 2CMHA 2P65A 3QVXA 4C0JA 3MTEA 2RBGA 5DI9A 4YLYA 1I8TA 5IANA 2GWHA 1DQNA 3U3OA 4G3XA 4PZ0A 4CN8A 3O2NA 1A4XA 4DV1B 2ID4A 2PUEA 1Y1SA 1U3CA 2BW0A 2WIJA 1R9MA 3W6OA 4EQ6A 3U6KA 4RHCA 1PDOA 4XD2A 4OQXA 4XQEA 4GOJA 4RDCA 4IKEA 2OCYC 2YIVX 4EYEA 2I9KA 4QFBA 3OU2A 2WU3A 2XTJA 5HK9A 1I01A 2ORIA 1QVWA 3GLHA 1I5OA 3N0RA 1RZVA 4YCJA 3UYKA 4HEQA 2HF9A 4BNTA 4J03A 1B3BA 3LQQA 4HP8A 5DXFA 5EIBC 4ASUA 1OLOA 1YHZA 3U1VA 3DMPA 1G2IA 2VH2A 1G5FA 5CU7A 2P68A 3FBWA 2HQ1A 2GVNA 2GJ9A 3MT7A 1OIXA 1U0TA 1E3LA 4EEXA 2APJA 3HKCA 4L6AA 3BXOA 3JQDA 3KQYA 4RZHA 2VTKA 3BGSA 5BWCA 3K5IA 4NDZA 2EKQA 1X9GA 3ROGA 4YT4A 1Z0IA 5IKEA 1N5KA 2ZAYA 3TM5A 1XEFA 2ZZKA 2BELA 3GRAA 3TMKA 1JG1A 2VH5R 2WF6A 4D8VA 4BFLA 4ZV4A 4AW9A 1LNQA 1H23A 3RFUA 2BMFA 2NU6B 4AG6A 1JEQA 4QHTA 4TS1A 1D6NA 3ETJA 4FGKA 4X44A 2R6CA 2BEVB 2BM0A 4Y7DA 4BLTA 1C1HA 4EEZA 1ZGHA 3D6UA 2H1HA 5CX1B 2J8ZA 1XDSA 2UUPA 4KO3S 1I3MA 4TVBA 3TZ6A 1WTCA 1SWWA 2OHJA 5CVDA 2CFRA 2QIPA 3P4YA 3KUDA 5DM60 4CV3A 2H2FA 2J5RA 3ZDQA 4JXZA 3BAZA 2BKVA 2W43A 1U3TA 2W37A 2LCIA 1SCJA 3L5OA 2IGTA 3OEHA 1TLLA 3MGGA 3N2KA 1QHHA 3QPDA 3VPSA 1YZHA 3HBFA 3W4KA 4OBXA 3EWSA 3K9GA 4TTVA 3UFXA 1Z2DA 5LA6A 3P2MA 3TJZA 1T0IA 4JJFA 1Z0UA 1AOXA 2XUGA 4G0XA 5DXAA 3L43A 1JG3A 2R11A 3ZK8A 4JENA 3VH1A 4C05A 2FW9A 1N0WA 3HKEA 3RWOA 3JR3A 4G4SO 1X1EA 2CVHA 2NZ8A 2DTXA 3EC1A 4LVUA 3BTVA 3ONNA 3ZWWA 2HK9A 4FX5A 2ARKA 1C2YA 2D00A 5L7WA 3TKYA 3WLJA 1NBOA 3I01A 4J6EA 4XJSA 1HKHA 2NO1A 4Y3UA 1E59A 4C3ZA 1P3JA 5F76A 2UV8A 1HTWA 3RJMA 3JD0A 4P34A 5GM1A 3SDSA 1L5FA 3E35A 4YJFA 4F56A 1MJGM 3LDUA 1P39A 1WZIA 1BH2A 4CLEA 4KIWA 1N7JA 2V3WA 4ZCMA 5IH7A 3K1ZA 1PFYA 4IILA 2XBLA 2FAXA 2JI8A 1HQYE 3WB1A 3AETA 3I8OA 3V4OA 2F2TA 2HOQA 2O8CB 2PTHA 4U7HA 1AT1A 1HNZB 4JITA 1N6PA 1YZVA 1SQFA 5TRTA 3AF6A 3L0BA 1KDZA 4HGQA 4X6YA 3KB2A 1AJEA 1N9KA 4UBNA 4BLOA 4MS4B 4LOAA 1K8RA 2VDKB 3N1UA 3NBFA 2G82A 3DHEA 1D5WA 4DY4A 3PC2A 5K8LA 4MTCA 4AD8A 2OMKA 2EJTA 3IUBA 2HNAA 2NU8B 3F98A 5D87A 3Q8XB 5K51A 1F2UB 1GG8A 1MRZA 2WT9A 4QGSA 1K3TA 5EJ9A 1K5HA 1RADA 3AW8A 4P4LA 4DBLE 2O4CA 4XIFA 3P9YA 1E64A 2J3QA 2ZJ0A 3QW4B 4WX2B 2R6JA 1UJ4A 1Y9JA 2H63A 2OAEA 1XRSB 2DR0A 3HCRA 3IAXA 4R3NA 2EARA 3G9XA 1K3UB 3C41J 1DO8A 1NIJA 1Z0SA 1U31A 1BA2A 1W4RA 3CLTC 4KQHA 4HNGA 1OAOA 4Y18A 4CIVA 1KMCA 3L7MA 1A9PA 2ZI3A 5BO5A 2DMRA 3FF4A 4YJ2B 3QX9A 1Z6PA 4GR9A 2J0SA 1ZBQA 2C0QA 4UAUA 1YZGA 1EBBA 4E5PA 1QZZA 2I2DA 2OCPA 2X8LA 2Z2IA 4OOFA 4UTXA 5L3SA 2KBEA 3BIFA 4D9BA 3DLPX 2X5JO 4YJ3A 1W73A 2XTZA 2GNAA 3RSHA 3D0KA 4RTOA 1SUBA 2RI6A 3C16C 5KVAA 1S8OA 5GQSA 2VHCA 3KL4A 2GX6A 3MLEA 3NIBA 3HH8A 4JQOA 4M1WA 4U2DA 3ZJVA 1FPMA 1U3UA 4RJKA 3UK7A 3TGWA 3IP6A 1KRHA 1GGVA 4DUGA 4DUZB 2C5LA 4PO1A 4QQRA 2OBYA 3EA4A 1S2NA 3VKUA 3DA8A 3GL9A 1QGUB 5EJIA 3ICWA 5F3WB 4I46A 2A2ZA 3CUVA 1UBNA 2QJWA 4NE7A 2Q4DA 5AMXA 4RHFA 5LBUA 3HXLA 3R6WA 1ZA1A 2PX3A 3B1KA 4MJLA 4B09A 1IBKB 1ZOPA 1BE0A 3QI2A 3KOXA 4YIKA 4GP9A 1DV1A 4G25A 1SURA 5GONB 3UAWA 1PWYE 1T5BA 3L8ZA 4RTNA 1L8AA 2BT4A 2WKSA 3H84A 2Z04A 1ESCA 1SG9A 3W8FA 2VNIA 2CKMA 2R00A 4KXNA 3LW8A 1QV9A 2C7VA 1PT6A 2CXUA 1E3EA 4KAXA 4FB4A 2EQ5A 2XYHA 2GOYA 3UMSA 3LUPA 3D8BA 1G5QA 3CRW1 2O8BB 2V1UA 4MW4A 2A1TR 3IQXA 3RU2A 1NBWB 4KR2A 2P4HX 1XZBA 4ZQFA 2NTYC 5CR9A 2XGSA 3DMYA 4BNJA 1VMEA 3T34A 1Y6GA 5B5SA 4LIPD 1P7CA 5HHTA 4DCCA 1J1ZA 5LP1A 3AVTA 1ZIPA 3FYSA 4D8WA 1FYWA 2F1OA 3U37A 4F46A 4AAYA 3SX2A 3E8MA 5F4BA 3MTDA 4PYKA 4PSAA 1QVAA 3I6IA 3PF9A 3RFVA 1WOMA 2X4GA 2ZAIA 1JYEA 5DNUA 3T1OA 5CT4A 3TNJA 5D8DA 3PE4A 3H65A 5FL7A 3GEEA 2ZSHA 3BRSA 4GF5A 1RIIA 1KI8A 4KXWA 4L5CA 5D01A 5B3AA 4Z1MA 4AG5A 2WWYA 3E03A 5EZQA 4C5AA 2PL3A 1QGAA 5KNBA 4M1MA 4F4IA 1POWA 2C8LA 2XPCA 4TYQA 4TL8A 4B48A 1RMQA 3A3OA 3GB9A 1PUIA 1E8MA 2FP4B 4CZ2A 1KYZA 2QROA 1WXIA 4CGZA 1LPSA 2DKFA 3WBJA 1EHCA 1EM6A 3NYQA 4BV9A 3TSOA 4LWQA 1MA3A 3GGCA 4FZJA 3RABA 2OPHA 2PFGA 4RGYA 3EVEA 3QLEA 4I4NA 1DTSA 1ZN9A 2UZIR 1WMDA 4UUBA 5T41A 1KFBB 3PC3A 1HDIA 4RMGA 3NPAA 2PVCA 1ZNWA 4JOBA 2G70A 4AP9A 5IW8A 3DF9A 3ROFA 5HZGA 3K2EA 2YKGA 2HQOA 2YW9A 4UULA 1JQKA 1C7FA 2CW5A 2ZWAA 2D4AA 1FLDA 4IIXA 2DF8A 1CR0A 3GBVA 4UHFA 3WLEA 5JH7B 2VSXA 2I71A 1BE8A 3OF3A 4A23A 1PT7A 4DANA 1J97A 4LA4A 3U61B 1BX0A 3FNRA 3ZOZA 2WG0A 4BTLA 1EVQA 1DARA 1K1EA 4L0QA 1U81A 4NOLA 1GEGA 3I4LA 1IZ0A 1O97C 2N0SA 4MQ4A 1QSGA 1IBMB 2I4RA 5HTKA 1K9VF 3AHCA 1SC6A 3VYTB 4UOEA 4CKZA 1CZLA 3OZWA 3AF2A 1NPYA 1KSFX 2BKAA 4J0JA 2BGIA 3RVQA 3H86A 4DYDA 1GZDA 2PX4A 4M8LA 2P2LA 3QVOA 4CL0A 1B8UA 1CP3A 4JA0A 2RAFA 1Y1QA 3LE8A 1PL0A 1S2DA 2BL4A 2ZRQA 1YO6A 3EVFA 4JSTA 1I94B 1VJCA 2C31A 1AB5A 5FJJA 1KMIY 4BO7A 1PEKE 3MCUA 1F14A 4Y6LA 1QLHA 3UGKA 3ROPA 4PEVA 1J2RA 4OFZA 4UHHA 1GZUA 4PHTA 3GJ4A 3IKJA 4C30A 1U6JA 4ZEOA 1NNSA 1PX0A 1U2RA 2IVFA 3FFWA 2WJWA 5EEGA 1ULHA 3EY9A 4JP5A 5KTMA 3O8QA 1UH5A 2AMYA 1GUFA 4D56A 2MWMA 1U3GA 1X1DA 2SCUB 4RIGA 1MQSA 3COSA 2XH8A 2FZKA 2OFPA 1TUBB 2HDHA 3C3CA 1B00A 3PQ4A 4HSGA 2EQBA 3KO8A 2G67A 2VF2A 1GTSA 2NTJA 1O9GA 2HF7A 2FQYA 1VG8A 2VJPA 1R0LA 1GFSA 1L9XA 2X86A 3ENZA 5I51A 1AKUA 1AF7A 1GJRA 1JLMA 1Z8HA 4EOGA 1C3EA 5JXJA 3EH1A 2VP3A 1QYIA 2CLSA 1U1DA 4MKGA 3CYFA 3IP7A 2GYYA 3VSBA 3K72B 3K9HA 1ENOA 1Z26A 1Z4PX 3T5PA 3CLRD 4O4JA 1QHGA 4W4TA 4C14A 2J46A 1JHPA 3LSTA 1JHDA 3R1IA 2JJ8A 1L7DA 4K03A 3K5PA 4JBLA 4MP6A 3T1YB 4LBWA 1PFWA 3A1TA 4GR5A 4H15A 3A1CA 2A0YA 4IWYA 4K7JA 5F5LA 4D7AA 2ZBPA 3NFRA 1NRXA 4ZVOA 3FCCA 5E4JA 3VU8A 4YRDA 3I2GA 3JWHA 2I6GA 1G63A 5T6BA 5DCYA 1JTFA 4E6EA 3WGNA 5ESDA 3PQ6A 1B1CA 5KYNA 1R64A 3HLTA 4DBVO 2X5NA 1CJUC 1UM9B 3A1UA 1JUDA 4EHLA 4EY6A 3NBQA 4EQ6B 1AA6A 2J32A 3FW1A 4KYVA 1T3ZA 4IY1A 4JWTA 4PGMA 5CGZA 4DMHA 1TNDA 3MQ4A 5EJ5A 4M7WA 2QLJA 3QK7A 4HLDA 4GOOD 3QITA 1RWOA 2Z5FA 1ZLYA 1DDGA 1PJCA 2VHVA 4WWHA 1ZCAA 4DWVA 1R8XA 5ALMA 4D57A 2P0EA 4WTOA 3LDFA 4C1BA 3TR5A 2AN1A 1XMQB 4RAOA 2X42A 2HA5A 3N76A 4UU1A 5KAMA 4CM4B 5CCEA 4J07A 3QLJA 3DR5A 2JLVA 1HNNA 3CR3C 2JDID 1VB5A 2K87A 2YVKA 4NENA 3O94A 3QPBA 4RUKA 4BQOA 2FETA 2VP9A 4XJVA 4FDVA 1GAJA 3K1YA 4UDOA 4YEDA 2A0FA 5TC4A 1T5OA 3KAQA 1T0BA 2OGUA 3O8OA 3NXKA 1F4VA 2MT9A 4W9MC 4GBMA 1TAGA 2BMDA 4Q1AA 1W46A 4MW2A 3NALA 1A1VA 4PU0A 1UDRA 3B53X 3BCRA 4CKEA 2HU2A 4LZLA 3TH5A 1SHLA 2DH6A 4BVKA 3T52A 3Q6IA 5JNRA 4O02B 4RVUA 3BTUA 4GX1A 1P1FA 1R18A 3QH4A 5INTA 3J81A 2ZIUB 3O03A 5FPYA 3IPYA 1SKYB 3GC6A 1DJPA 1QHHB 2VK1A 3D6AA 4RF3A 3S2EA 2XDYA 2JLYA 1B0ZA 4RTKA 3CJRA 4B8ZA 1XV5A 2QM3A 3UFXB 1N34B 2NU7A 2IXDA 5LA6B 4O2BF 4QTTB 4DF3A 5KOJB 1YFKA 2Y0CA 2O0MA 1U94A 1ZKMA 2D1FA 3FKSD 4I55A 2A5FA 5F12A 1X1BA 4BNYA 4BTVA 5IPFA 1ZN2A 3REQA 2O54A 1XUOA 1Z7WA 4HAWA 2WWTA 3DM5A 3TZEA 1I0LA 1G3QA 3L4EA 4POOA 3DMTC 4M98A 3U4MA 2F64A 2YMPA 5DIZA 1OGJA 2ZR0A 5CLHA 5E9JA 5J1TB 1PHRA 3L40A 1E1CA 5AKXA 3CH7A 1YNSA 2HMWA 4UM8B 5KNBH 4I50F 5JR3A 3TR6A 1PJTA 4A0HA 3LKDA 1A98A 1FU7A 2PSDA 2W4QA 2WKPA 3PGA1 2FN9A 3MCWA 3PGXA 3E5RA 2ZYUX 5E6RA 5CDFA 1GGFA 4I1OA 4AS1A 1TQ8A 2D1TA 1FZTA 2VN8A 2H0AA 3A05A 4Y9DA 5BSVA 1E9AA 3L7AA 4BMVA 5FX2A 3OE5A 3PEWA 1HORA 4JJKA 4JOSA 3P1JA 1XJCA 5AHWA 3D3WA 1SHZA 5ARDA 4DPMA 1Z4LA 5D5QA 3OOJA 5KREA 1BVRA 2OZEA 3LKZA 4BZWA 5JRJA 3WXBA 3A9RA 3T35A 4QO7A 5G41A 1PJZA 2Q8NA 3MC1A 5M2QA 3KB6A 4XVRA 5DYYA 3RJZA 2JHPA 3CLUC 2OGSA 2QENA 1SC4A 4ROSA 2FZCA 5CM8B 5FLKA 5JJBA 1T4BA 2R6HA 4MVJF 2J07A 2Q3LA 3GRZA 2W2VA 2Y66A 4HVAA 5E4TA 4AJLA 5EWLB 5KX5F 4YXFA 1ISPA 3CRQA 3CEJA 5AHKA 3KR0A 4UEJA 3VFDA 1EHYA 4TT8A 3NHJA 2OVFA 1GLVA 1M0SA 4BAUA 4C2BA 3JCZA 3CZ5A 3DV0A 5D3QA 2VBIA 3M33A 3SPXA 4BX9A 3NBZC 4P8RA 4KBYA 4LQLA 3VNSA 3T54A 1N1EA 3VDQA 5K3EA 1UC8A 3K96A 1TMYA 1X0VA 4V1CA 4F6LA 3Q1KA 3D3QA 5G2OA 3SCZA 3UAGA 2EZ9A 1S8NA 2Q6TA 3ZYZA 4FD3A 4D4HA 5CFRA 1ZSVA 3DTVA 1JDBB 1RACA 2N1MA 1NW7A 1OKKA 1QC5A 4INPA 1VE9A 2AEEA 2P9GA 2Z2XA 3GCGA 1JHYA 2FSGA 2JCXA 2NUPA 3BSSA 4FP9A 3ILVA 4TXHA 2ZIGA 1AS3A 4HEJA 5C80A 1MV5A 3VR2A 1KVQA 4I7EA 4JLWA 1RCTE 5B3JC 1GP2A 4D26A 1OBFO 2O8DA 1OTXA 2QRKA 1KBZA 4N03A 3OZGA 3JQFC 1N2IA 1QJ4A 3TTSA 1KWKA 1WXDA 3BH0A 3LKVA 1J9EA 4OQEA 3KKMA 1OD6A 3MG9A 4NYMR 3AI7A 3CGWA 3VDMA 5JLJA 3I62A 4UNNA 2DEUA 3B20A 3EG9A 1APBA 4KSCA 2HD4A 1OGIA 1I2MA 1N5IA 2UUOA 1OAKA 3IMGA 3T41A 3TL3A 4CIYA 2J85A 3WK6A 4J7AA 1HRKA 3E61A 3LP6A 3PUWA 1VECA 4XRRA 5AM1A 5WRFA 3DEZA 4O2AF 3OPVA 3RG8A 1XQ1A 3MD0A 3S2GA 2XV1A 3AOGA 2H8KA 2ZANA 2GXSA 2QX4A 4HXGA 3QVSA 4ENSA 2VA8A 2QLFA 3E8SA 4FE4A 1PJ3A 3GJTA 2ONJA 1N4DA 3D3NA 4B3XA 1I6MA 3IHTA 1VPEA 1Q3TA 2DPGA 1U8XX 1KZ6A 1T2DA 1NRWA 2IUTA 2P5TB 2PM8A 1OWPA 1NLFA 3BN3A 4XOIA 3I2KA 3EE6A 5FOTA 5C5EA 4MAFA 1Y3DE 3L6UA 4J7UA 2GDJA 4K86A 5C4MA 2J4DA 3WE7A 2FOIA 4CQJA 5C52B 1M7HA 4LHVA 1OXBB 3KPUA 4X24A 3PNOA 5IEBA 1UDAA 2GZRA 4QTXA 3SQLA 1S5PA 3AB8A 2CLMB 2PU7A 2XWSA 3HO8A 4R9SA 1UBFA 2ZVJA 4IDEA 4CCYB 1Q6YA 1XZNA 1ZD5A 2WC1A 1PWZA 1ZMOA 3D1JA 1TVMA 3Q9LA 3L7NA 4ZZ2A 1XKLA 5A5FA 3B82A 1XD8A 1BVUA 1Z7YA 5D7BA 4FDLA 3W34A 3BK1A 3FWHA 4KVZA 2Z43A 4BATA 2HH9A 2V7UA 1I1NA 5DYTA 3DYIA 4R9UC 2HU8A 2ZUUA 4Z3OA 4Q9JA 4R7GA 4RK5A 1KR2A 2C2BA 2CLLB 1RNLA 3LOPA 4J2OA 3MJTA 3T5CA 2JCGA 4XJTA 3KYIB 3LY7A 4MCAA 3IUSA 1OPRA 5BRJA 3H9EO 4UAVA 1L7OA 4LRUA 3NDIA 4LDZA 3W2IA 1KK0A 2QJRA 3KM0A 2IUFA 5DYWA 4E1AA 3ECSA 4KYUA 3LQ4A 4JH0A 5FPHA 4D8YA 3E6AA 1IBCA 1I32A 1TC2A 4CT4B 3TLCA 5DU2A 4TQUS 2EG5A 2WE8A 2Y1LA 3CT4A 1F0YA 4FQ7A 4R2IA 4TVOA 3WGQA 3IBTA 2OKGA 2F43A 2KLHA 3ZDEA 2ZR7A 4BFVA 2XZTA 5AJVB 5BR7A 3JWGA 5JQWA 1A9YA 4HXYA 4WCFA 2PVSA 1OI4A 5DHSA 2ANBA 1PVOA 3MJEA 4FLEA 4YJDA 1EQ2A 4D9NA 3NT2A 3IPCA 5KWVA 2V74B 1D04A 2GETA 2C2MA 2VG8A 3QEOA 4Y6PA 5F2NA 1B8PA 4FONA 2AN9A 3EFOA 4H18A 1TU0A 1CDEA 1B43A 1MXFA 1EH5A 3VC3A 1WHSA 1DKNA 1K7EB 2GMWA 1V43A 2VI5A 4P33A 3Q8LA 1OTYA 1PKEA 2UYHA 3V4SA 2H65A 1QP7A 1JG6A 3FMGA 3CEHA 5J5AA 3M3DA 4ACAA 1EWRA 1NG1A 5FDFA 4KWIA 5H9VA 2IRWA 1LDBA 3DL4A 2IV2X 3DXXA 4MUJA 4AY2A 5LQRA 3Q6MA 4MUFA 5AO9A 1ULSA 5B7PA 1TEXA 1HFEL 2PVPA 1SXHA 3JVVA 4M1KA 4BJHB 4ECAA 3BCSA 2W8ZA 2DBYA 2Z95A 1QG0A 3WAJA 2W6MA 3QA3E 1ZAYA 4BJ5A 4I9NA 3T4XA 2GPYA 4YMLA 3K6KA 5CTJA 5L8VA 2BSXA 4GBED 2H1IA 3TZHA 3W05A 4HWSA 2IYPA 4AY4A 1C7RA 5GY7A 4HWKA 5JARA 2I1LA 3AHIA 4FYMA 4J1TC 3TCXB 5TLSA 3AU9A 2WMYA 1L7BA 1DZIA 2QEQA 4OMCA 2GCOB 5DSXA 3CX4A 3V8MA 1N3YA 2VHXA 3ULKA 1U2TA 4UOQA 4EGSA 1ID8A 2GEFA 2JF0A 4P53A 3I42A 4LG1A 4CIWA 5TS2A 3NNNA 1FLVA 3WDSA 2YH2A 1DHTA 2R7AA 4KMRA 1CQZA 3WIEA 3D8TA 2GEUA 2VLBA 3OFSA 1V5EA 2PA0A 4RWEA 4ITVA 4JR0A 3D6HA 1GYRA 1PQYA 1V1JA 4EG1A 5KTYA 2QVCA 3ZHYA 1GSOA 4XR4A 3V3TA 5FOQA 2FK7A 5CVUA 1W0JD 1EZ1A 3O1LA 4O4JB 2QRNA 3TEFA 5C4IA 3QKWA 3FPLA 5EHNA 3ZUGA 1XKQA 4MKIA 1PSZA 4B6OA 3FUTA 2VEDA 3RTGA 2OY0A 4XEUA 4I9GA 3BS4A 1YKGA 3X1MA 4AVYA 5L40A 5JFGA 3KQMA 3BMNB 4TTRA 5JATA 2O2IA 2D8MA 1JR6A 3JRNA 3GLRA 3U3DA 4B4KA 1ZD2P 4ZYUA 4CQLB 1JA1A 3W5UA 1HSOA 1ZN7A 3DOEA 4EHBA 1FXSA 3AXTA 1NVFA 1IHYA 4ZVLA 3ANNA 1USUA 4G6ZA 4D4IA 3F1LA 1U4NA 1TA4A 1UPAA 1XNHA 3F6CA 3IP5A 3THXA 2ZUEA 2O8FA 4DJTA 4LQ4A 1H42A 4UE2A 5AT1A 1WW2A 2PSFA 3Q4GA 1US8A 1UAGA 2V3VA 2R8OA 3RC8A 4C0BA 4BEWA 1L6IA 3F0TA 2H4HA 4GYKA 3IKVA 4MS3B 3KHKA 2JH3A 3W5JA 3OWXA 3R0XA 3CVUA 3DQPA 4BRSA 5BWOA 1KJNA 4WAUA 4PHGA 4RNDB 4HNAA 3VKGA 1VZ3A 1Y8RB 4J75A 1EDOA 5K3BA 2B99A 4UUQA 4DCMA 4YXWD 3FPFA 5K05A 1EESA 3LT5A 1BMQA 1Z3CA 1J8FA 2F17A 1ACJA 4OJQA 3SHVA 4HDQB 1SQGA 4EYQA 3D6MA 1Y6ZA 5ALJA 1IMOA 2HU7A 4NENB 4YRFA 4MZXA 4LCJA 2Y92A 4Y2PA 4BU1A 4NMXB 1BDIA 2G71A 2BHLA 2D62A 5BVHA 5DNYB 2QT1A 4E30A 4GM4A 3V4PB 4WBXC 4YCNA 1HK7A 1RAAA 2CCGA 4OHXA 3TVTA 2R86A 5DWDA 2FEXA 1U2ZA 1R88A 1XBTA 2VT7A 4EYOA 1M2OB 3IHKA 4HZUB 4UU0A 4WBNA 2OO5A 3EZLA 1P3DA 1TD1A 2AV6A 2ATVA 1ZHOA 3EIQA 1G6OA 3IT3A 4AF7A 1DIGA 4CKEB 2VNAA 1BMDA 2R87A 5HE8A 2O5VA 4J9VA 4BVFA 4BQEA 8ABPA 1ABBA 5EIWA 3P97A 2WSSA 4D0RA 2FEPA 4XM2A 1IIRA 4DR5B 3W78A 2Z3VA 3KUCA 3X1XA 1SHTX 3CUYA 2OHHA 4BNGA 7AT1A 3FFTA 3ZC3A 3V32A 1R5JA 2F8TA 3C6KA 4JHXA 3REQB 2GCPA 5KEIA 5B58C 1RJWA 4C6RA 1GL6A 3RANA 3DPUA 2QIOA 3IDAA 1T3HA 3PUKA 2WHXA 3L7IA 3SLGA 1T4GA 2H4FA 2J9YB 2BISA 3RS2A 2H2WA 3TE7A 4B3HA 5JD6A 3CC8A 4G84A 1QDEA 2IDZA 4Q3NA 5GV8A 4US1R 3T61A 1YTUA 1EE9A 3NV7A 2ONYA 1WSAA 5KCMA 2ZSKA 4LBYA 4ZAGA 4TGLA 1FVXA 1XHFA 3F7NA 3IAHA 4WK0B 4QRHA 4WKCA 4PFSA 3TD6A 5EFZA 1HYEA 3L6RA 4PPFA 3TMYA 1NE7A 2EU8A 1TEHA 1VIDA 4MW9A 4ANFA 3SQNA 5BSGA 1XJQA 3V8RA 1P2GA 2WOJA 4GSYA 3W2TA 4D6XA 4XVHA 5DI3B 3MIIA 3QA9A 4MWCA 5B58T 1RE1A 4Y67A 3COYA 3MYRA 4ENVA 4TPKA 5IVIA 5BN4A 5JW6A 2YVLA 2WIBA 3HRKA 3HE3A 3M1YA 4E70A 4WVLA 1TYZA 4PCUA 1CJKC 4IJQA 3X2SA 3QY9A 1BHSA 1FZQA 2XUAA 3NOVA 1UWVA 5CVEA 3PLRA 4Y1EA 1XU7A 5DYIA 1RKVA 3VDXA 4ND4A 3CEAA 3W5HA 2VO1A 4WZAA 1JZQA 3MLBA 1OT5A 2ECFA 2EBHX 3S1AB 2DWCA 1COWD 5C5IA 2PCJA 1A2OA 1A8HA 3DV0B 1N9GA 4PX5A 4MB2A 4U0JA 2J3DA 1J00A 1UAAA 4BQQA 1YFLA 5HP4A 2CCJA 2YWBA 3O2QB 4CMHA 1JB9A 3HVJA 4B1FA 3SKVA 4ZDKA 2VJYA 2ZRLA 3FSRA 2BDEA 2RH5A 3HP7A 4I6EA 4NH4A 3RC7A 1NR1A 1RYZA 1UPBA 2O2ZA 4AXBA 8GPBA 4RU1A 1E20A 5AI0A 5K0GA 4LBVA 1HMPA 2E9SA 1L8XA 3TIVA 2OK7A 1WEKA 2NUPB 4NH0A 4F71A 5JFTA 5CYOA 2J5BA 2QW8A 3IEUA 1YDHA 1S01A 1WB5A 1IEVA 3UB3A 1ML3A 1U2EA 1PO7A 3O6VA 1R50A 1NIPA 2X22A 4E4TA 1E32A 4GOLD 3QKSA 3VUEA 3M4YA 4LTDA 2HA6A 3ANSA 2VJCA 2DY0A 1ZNXA 4L57A 5A6SB 2W48A 1UP4A 4QT0A 3WKEA 4CM6A 3H2IA 1FCJA 3P2EA 3WMWA 1KI1A 1V5GA 2ZJ3A 3H2BA 4D5EA 1B1AA 1OLUA 2H4ZA 3KPVA 4N5HX 5EE5B 2WJGA 3PI7A 3ZHCA 5U9CA 4KWEA 1YBFA 4LXGA 3B78A 2RC6A 3HVKA 2YMLA 3FPHA 3EN0A 3AM1A 4RPJA 2ZRKA 3PQ5A 2I67A 2YYZA 3PTZA 2BWJA 4L4ZA 3KWLA 4JT9A 1W5BA 1JAIA 3DONA 3ZDYB 5JBNA 3U4QA 4KQFA 3VM6A 3EQ7A 2W6JD 4IR7A 1A9XA 2M1XA 2Q4TA 4W82A 1SUFA 1SUSA 5DM4A 2WU1A 3L0OA 5AVUA 2GLXA 4IHKA 1MX9A 3E58A 4YRKA 1O94A 2BE9A 4ED9A 3ICCA 5A3QA 4O29A 2Y99A 1UMCB 4L4UA 3V7YA 4DXDA 3Q8MA 4MH0R 4AF6A 1H2YA 1Y63A 2QMOA 3EVAA 2P78A 4IHJB 1M76A 3ZIUA 1WU7A 2ZBEA 3LRPA 2WYWA 1UJ2A 4YAUA 5HYVA 3GOQA 3A9UA 3UTDA 1UBOS 2QRVB 2A9QA 1A2KC 4MARA 3PD1A 2ZIXB 3QMPA 3MINB 1DAPA 1KORA 3KYCA 4J1NA 4BY9E 2O8VA 4PVCA 1J20A 1WQ3A 1QQ5A 2NW6A 4BP8A 2WYUA 4AYTA 3GJ8A 3SBXA 5MFPA 1M1YB 3D5EA 1D7OA 1SIOA 1IZ7A 2AHRA 1ZAKA 1QB7A 3GW8A 3HJUA 5JYDA 2QP4A 3ZLTA 4A16A 1IOLA 1YUNA 1NVXQ 4F5WA 4HGOA 1DTEA 4KE9A 3KKEA 3K6SB 1CIVA 4E2ZA 3ER8A 2ABWA 1CVIA 2HLHA 1ODSA 1D6JA 1GCUA 1ZUD1 3BCHA 3BXZA 1GL9B 2R96A 3FR7A 3MUEA 4ASUD 2XMZA 4HCJA 1FUKA 2XF2A 3Q7QA 3L8DA 1A95A 4OFXA 4I36A 1IY2A 5JASA 1U8CB 1K5GA 3LFTA 3I5MA 1SIWA 3FAZA 1NU8A 3K2BA 3EX7C 3F97A 4XDYA 4X7BA 1MC4A 1W1IA 5GADl 4Z4FA 2EW8A 2ZBQA 2HY7A 4B82A 2V55B 2XJ9A 3KLNA 1F2TB 1NPTO 3KXKA 2BHTA 1QX4A 2M1ZA 2FSHA 1EZ4A 3DL7A 1EXDA 3EIUA 2BFAA 4DBZA 3K6JA 3OKCA 5CH3A 5AHRA 1DXHA 4WY8A 5EJ6A 3PFFA 1CUBA 3EFOB 5KPDA 3KQKA 4OAQA 4B0PA 4BLUA 1M72A 1MNQA 4MROA 1H9BA 3CMMA 4IDDA 3VZRA 1KEEA 1R6XA 4J8PA 2CHEA 4UFNA 5BSWA 4D44A 2QN8A 3AY3A 1NZFA 3KQSA 1BWSA 1ICIA 1NLYA 1XU9A 1CQJB 3OLVA 1U2GC 4YYZA 3H1BA 2B8WA 3ETEA 4A1FA 3IQIX 1XF9A 4FDUA 2I62A 3AKYA 2HQSA 3DT6A 4W5TA 3U6BA 4RC9A 5AK6A 1GZ7A 4GSLA 5G0VA 5TS3A 5LUAA 3WOHA 4Z9YA 4N39A 4J4BA 1E1KA 1TRKA 1Z4KA 2P3LA 4BNZA 3UJDA 5LOVF 5KYUA 3P9NA 1ODFA 2HSGA 3V8VA 4BZXA 1SA0A 4CLOA 4DSUA 5IZ4A 1CVRA 2FZVA 1A96A 1J21A 3CXUA 1W48A 4V3CA 2DWQA 2J1LA 2PGIA 3BL6A 3EFHA 3ZJ4A 3ISTA 3GMSA 3IP1A 4K9MA 3RGGA 3G1UA 4MKFA 3HXMA 1I3LA 2G0TA 2V03A 2GFHA 3HDVA 4G63A 4G0QA 3T7TA 4X00A 4TQGA 3EEQA 4K3VA 1LJLA 1MDBA 5J2UA 3GPCA 3HWX1 1O95A 2RDMA 4RJJA 5EXXA 4O1MA 3UMRA 3SQDA 4CF6A 3RS5A 3QKRA 1MOSA 5BQ5A 4EJSC 4JEUA 3QU2A 5JU6A 5ICGA 3ZNQA 3OTHA 3WDLA 1LWOA 3HVRA 1ZXLA 1T3GA 2AQHA 2IIPA 5FUQA 3B7WA 5JWOA 2RH4A 5BR4A 1XCJA 5AVOA 2R6FA 4LECA 1U5BB 1P7PA 2O07A 4OHVA 5EHGA 1ZJYA 4P31A 1IY1A 3ECCA 3QLUC 4PLZA 4LDAA 4W1RA 1RU3A 3K0EA 4R16A 4AWBA 2HGSA 2PRYA 2WAOA 4HEHA 2PQ2A 1RM3A 2J7PD 3TZBA 1F9AA 1G18A 5AW6A 1EPUA 4N8SA 1WKCA 3BZBA 1E6UA 1CZNA 2V4MA 2ZSIA 1YDEA 1CZKA 4FDMA 3WIOA 2Y1DA 4COOA 2VYCA 1V9CA 1KAHA 5KBYA 2OHIA 3CUKA 4LGYA 1J8DA 2IYYA 3U7RA 5LDHA 2H4YA 1HKUA 4YALA 4MKRA 2QTCA 3IXQA 1IYZA 3S3TA 3UCXA 1RM4A 4FFBA 3BWVA 2IUUA 2P30A 5FHQA 4X1IB 4S24A 5BP7A 5JZVA 1KQNA 3LLUA 3C0KA 4NQZA 2XEXA 5CTAA 4WZZA 4XFJA 1RKQA 4R8SA 2G06A 4AG3A 4R3WA 4KK3A 4PFJA 3NWJA 2Z83A 5BR8B 5ANRB 2AHOA 4NAVA 3PPIA 4PVDA 3A37A 2VAWA 3MTAA 2HCFA 1N9ZA 2RHOA 3FI0A 4DDMA 4ZI3A 1PZHA 3TAHA 4DIOA 3L41A 3MK31 2ROQA 1EFHA 3R3YA 3TLJA 1IY8A 1NF8A 3ROKA 4BNXA 4MUKA 2JAOA 3AEQA 2ORWA 4EVSA 1E2IA 3WL4A 3S70A 1KL7A 5B7GA 4ER3A 1JWBB 4JVLA 4DUGD 4ZHQF 5AM2A 2F1IA 4O1IA 2VQFB 3ITDA 3P26A 5F5XA 4X97A 2BBTA 3MTIA 2QTTA 2C95A 1Q7RA 3GT7A 4HDMB 4GKKB 4C4PA 3FSJX 4GMFA 2P67A 1UMKA 1VL8A 2QGNA 2R6GA 3P9XA 2R7LA 5DNWA 1BGXT 1ARZA 4QFMA 4YO8A 4ZV9A 3CRZA 1V96A 3AVWA 1TE2A 2Q4BA 4B32A 1E3JA 3AZQA 1XRLA 3COVA 4JVSB 1CK4A 3A14A 4PFKA 3LAWA 2ZKLA 1KZ4A 1AU9A 4L50A 3AJ9A 3BK7A 1KVRA 4NNPA 1J39A 3PUJA 1JBEA 2ID8A 2XUIA 2HJHA 1K5PA 3PE6A 1TEZA 3VJRA 3IEKA 4WN3A 3VO1A 4DLYA 4UTVA 1C3JA 1KU0A 1L3CA 1LI5A 4KOAA 4IX1A 3K53A 3O95A 3RRZA 4F6RA 1HZZC 1TVCA 3QYJA 4EHNA 3DPSA 2QY6A 4U00A 2QRJA 4D9EA 4S2UA 2I66A 3ZJ5A 2XQGA 5FRDA 1EUCB 5JYCA 2OD9A 1VMDA 1YCHA 1RWVA 4BMZA 3OZSA 1M67A 4ARSA 5CCBA 4PPNA 3A4MA 4GMDA 4PLCA 2IX9A 2JK0A 4II7A 1YS6A 4Q39A 5HSGA 1ZR4A 3EQ2A 4G4IA 5AKKA 1OFUA 2BCJQ 2XKJE 3MMNA 1Y33E 3D2BA 2OOSA 2WJZB 3CR8A 3MAJA 4QXRA 4DZTA 3WQSB 1AUVA 1QQBA 4HRYA 4Q4LA 4XJXA 4Z4QA 1A5BB 2DHCA 1QTQA 2HTFA 1D0IA 4PAMA 4QZVA 1QZUA 4RF5A 1EXMA 4MV3A 2IH2A 4NV1A 3R8FA 2XMCA 5L4LA 5HIMA 3A31A 5FL7D 4YN3A 3CG4A 5H70A 2ZCVA 4Z1MD 4R6XA 2Z56A 3P4UA 2VKTA 3VOSA 2DWPA 3IODA 5KNBD 5DSTA 5E0KB 2B6NA 2GPJA 5LQNA 3C2QA 1XLTC 3PIDA 1ZOIA 5JMPA 1H6AA 2D2XA 3ZGOA 5UKDA 5AVQA 4H3HB 3OBIA 1ISJA 1HT0A 2PXAA 3LYUA 1GZ6A 2JAUA 2OTCA 3DZCA 1U98A 2WUFA 3IVAA 4Q02A 4DWJA 4NBTA 4AF8A 1PZMA 2XBUA 2R7KA 1ZP6A 1KZHA 3EIFA 1TZJA 4JC5A 1KQPA 4K0RA 1T1JA 2XB6A 2DRIA 1RYHA 3CSSA 1C3OA 3VNUA 1MJGA 3VZSA 1EVKA 3PDWA 1L5WA 3NWBA 1WUKS 2DJ5A 4GZLA 2O19A 1JSCA 2WAXA 3K5WA 3ZZUA 4BC0A 1X77A 2PKQO 4NK5A 4IH1A 2NLOA 1N9GB 3UA3A 2ACKA 1VKNA 4GX0A 2G40A 2JNWA 3MMPA 4I9HA 1EIZA 2G5TA 1C9KA 2JJYA 1D1QA 3I0NA 4OQMA 5HMMA 5BUZA 3ICOA 1C41A 2XA2A 2Z1NA 4M1QA 4YLEA 5HQTA 2ZYRA 1NFFA 1L3IA 3TW6A 4LF4B 2JASA 3L82B 4OUDA 4PZZA 4DG9A 2OG1A 2JJ1A 3L4BA 4M37A 1KAOA 1JHOA 2LRHA 2NO5A 4G8BA 3MSCA 2A6PA 1DC5A 2FHPA 2YHIB 3L77A 5IFLA 3KSZO 1ENYA 2A84A 4K6FA 4OTZA 3RS9A 5HCNA 1THMA 1X1AA 1FB5A 2OAP1 3QOWA 2PH3A 2PUWA 1ZSNA 5IXYA 1L4NA 3AJEA 1USVA 5LPNA 3I73A 1EIWA 2BHNA 3T3DA 1DRVA 2NYUA 1TW3A 2W6ZA 2ZSBA 1W93A 1SAYA 3NORA 4YAJA