5ER6A

Crystal structure of an oxidoreductase from brucella ovis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
251
Chain Sequence
HMELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPALKAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQLNRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
publication title Crystal structure of an oxidoreductase from Brucella ovis
rcsb
source organism Brucella ovis (strain atcc 25840 / 63/290 / nctc 10512)
molecule tags Oxidoreductase
total genus 92
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5er6A00
4NBVA 3S8MA 2J3KA 1P45A 2B36A 1YQXA 1ISJA 1CETA 2WSBA 3KYDB 5AQ1A 2PWZA 3SC6A 3KV3O 4MVJE 1IL0A 4CV0A 3DOOA 4E31A 2PH3A 3B70A 3KSZO 1E7MA 4E5YA 1LDYA 3PI7A 3O4RA 3PWSA 2CMDA 1P1RA 2V6GA 4URFA 4A10A 2E4AA 3GUYA 1YJQA 3TN7A 3RBXA 4JK3A 4CUKA 4AJPA 2G0TA 4L4SA 2PD4A 1NVMB 4J7UA 5T5QA 3NDJA 5JDCA 1G1AA 1NFRA 3F46A 3WLEA 2JD0A 4S1VA 3I52A 4ID9A 4RZHA 4U7WA 1B8UA 4M55A 1QV6A 2BKAA 2VTDA 4MDHA 3B1JA 2ZTUA 5G0TA 4EI2A 2C5EA 3S2GA 2Y1GA 3R0IA 4PVDA 1YXMA 2X5KO 2HO5A 4OH1A 5ENDA 2I3AA 1LRLA 1BXGB 3CINA 4QFDA 1N92A 3ZWYA 3GEGA 2DAPA 1HE3A 1D3AA 3WGHA 3DTYA 1IHYA 4I8XA 5KVSA 4LK3A 3KEQA 4IZHA 4IGFA 3WIEA 5KOIA 1XG5A 4YT5A 3DOCA 1G0NA 2ZQYA 2CUKA 3O8QA 1SC6A 3GVHA 3RU7A 2H63A 2AW5A 2E37A 2Y05A 1YB1A 3LU1A 3DC2A 4IZIA 1NAIA 4P38A 2O3UA 2EW8A 2FPIA 5A03A 4LSWA 3GEDA 5AXCA 1HE4A 3EZYA 4B79A 1ULSA 4RO0A 3OECA 2DTDA 4ZRMA 3QHAA 1OAAA 2E49A 2G1UA 3RQSA 1PL6A 4YBZA 2VHZA 2NVBA 2B5VA 2NVUB 1YL7A 3KO8A 1O0SA 2AEMA 3BTOA 3I9NA 3D4PA 3W6UA 3WWYA 4MP8A 4N18A 2O4UX 3MJEA 3FN4A 1OOEA 4GQAA 4CMEA 4LW8A 3RC9A 4YAGA 3LLVA 4NPCA 3NT4A 2W8ZA 3WYEA 3BMNB 4LVCA 1LUAA 4E5KA 2EKQA 2FSSA 3BTVA 3WYCA 2VYNA 3PYXA 2GD1O 2DFVA 3U4DA 2PGJA 4TVBA 2X4GA 4IM7A 5A05A 3BA1A 3WWZA 3OFSA 4BO0A 1LDNA 4WJZA 4PN3A 3MWDB 1XWFA 4G65A 1E1LA 1I2CA 4XCVA 3FTPA 1UXHA 2JFFA 4J0FA 2P5UA 2YZ7A 2P4HX 2GDZA 1IPEA 3BMCA 3JSAA 4BS9A 1O94A 4BOYA 3P2OA 1ZSNA 3DZBA 3WQRA 2B4RO 2BF7A 1OC2A 4KQWA 3TOXA 2D8AA 1PJ2A 1HDZA 2O3QA 3RAJA 1I3MA 2Q50A 2FP4A 4WLVA 3DZGA 1JU9A 1U7HA 2D59A 1DXYA 4CM4B 1B16A 1YB5A 3ZHYA 4E2ZA 2UV8A 3MJCA 5KIAA 4IIUA 1AUPA 4JLWA 3RUEA 4RGBA 5A3JA 3B1KA 1VL8A 2GPTA 2X86A 1I0ZA 4RPKA 3PFWO 4L76A 1Z73A 3AUAA 1EDZA 3B1FA 3G1UA 3WS7A 1PWXA 1A4UA 4WPGA 4TROA 4IXWA 4Q3EA 4YTEA 1GCUA 2H1SA 2J5RA 4CQMB 2AQ8A 3RUCA 1TXGA 1JVSA 2WE8A 3OEWA 2BH9A 1N7GA 2IZZA 4D3DA 4PRLA 4CJXA 1PEDA 3KYBA 3U4CA 1C1XA 2RH8A 3O38A 2NVWA 1F06A 3HUDA 3E8XA 3WG9A 1DC4A 3VVCA 4CR7A 2C2YA 3JYOA 1KEWA 2VWHA 4J90A 4OAQA 4B4VA 4YQYA 3FTNA 2D5CA 3MOGA 1DRVA 1T1RA 4MKZA 2DBZA 4IS2A 2HRBA 4BO4A 1K3TA 3ZWVA 3LQFA 1A72A 3I6QA 3JYQA 1KVQA 2O48X 3RUAA 1DIBA 1YQGA 5JC1A 3TL3A 1SBYA 3OQ6A 2G82A 2GERA 1RM0A 1TA4A 1N8KA 4RVUA 3FPLA 4E5MA 2JFHA 5AXBA 2X0JA 1X1TA 1PQPA 4GX0A 5DP1A 4A73A 2FZWA 3PPIA 2EGGA 1XHLA 2VCYA 4XJSA 4YB8A 4HXYA 2I66A 2B69A 3GOHA 4D46A 2WYUA 2B0JA 1DRUA 4JCOA 3H9EO 4KZPA 4MVJI 3ADOA 1QYCA 1X13A 1I3NA 2ZB8A 3OP4A 1LA2A 4CLHA 1Y8QB 1Q7GA 5U4QA 4E2XA 4FGSA 1EUDA 1WXDA 4WEQA 2DFDA 4OM8A 2NU8A 1BW9B 3GZ4A 4D0SA 1LRJA 2WMDA 1ZIDA 2Y0DA 1X7GA 3ABIA 3WOHA 4WK6A 3GGOA 4IUYA 3K30A 3QE3A 1MGOA 4BNWA 4DPMA 4IDCA 4INAA 1AHIA 1EBUA 2BMAA 3O8QB 1FDWA 4HNGA 4CR8A 1ZXLA 4WCFC 4XZ3A 4E12A 1BGVA 3LF1A 3ZU2A 1GADO 1MC4A 2CDAA 4FJ1A 5KKAA 1XU9A 2J6IA 1ZW1A 2JFGA 1NYTA 3K92A 4H7PA 4XQEA 5JYEA 3PP8A 1HWYA 5TS3A 2R2GA 4P8RA 2OP1A 1PJBA 3VC7A 3JD3A 5K6AA 3X2FA 4PLPA 3ZWNA 4R1NA 5EPOA 1OFGA 1NFQA 3E03A 4DIFA 4ZQEA 4PIVA 7MDHA 3VH1A 4PG8A 5DBIA 2FPPA 5IDQA 1B2LA 1E3WA 3MJTA 1R16A 2EEZA 3H2ZA 4CM9D 5FI3A 4F6LA 3I5MA 3GLQA 3Q3CA 1RM4A 4R51A 4YJFA 1TT5B 1JTVA 1Y8RB 3SLGA 5KJFA 2UVDA 3VPXA 4OIMA 4U0KA 5T67A 4FC7A 1S6YA 1X7HA 3OM9A 4NDNE 3TZ6A 3BYZA 3GPDG 1UUFA 2QIOA 3JV7A 4J2OA 5COAA 1I01A 1R15A 1NR7A 1T2EA 2DBRA 3P19A 1LLCA 3PYLA 1HSZA 3E82A 4YQZA 4BVAA 4Y6RA 4YJGA 1HE5A 3UGKA 3WSWA 4GSKA 1OMOA 1RWBA 1V8BA 3RC1A 2WDZA 2X8LA 2YDYA 3DFZA 4O6VA 4ZJUA 5CDGA 5CEFA 5JAMA 4OSOA 5EL0A 2O3TA 2EV9A 1GEEA 1MG5A 2PZLA 5GMOA 1E3LA 4CLRB 5I7SA 1NQ5A 4J4BA 4NBUA 4AJOA 2EG9A 1R4MB 3AFMA 2VWPA 2NUAA 3WGTA 4HV4A 2JD1A 2Y0CA 3DBVO 1M2WA 1P1IA 2IDZA 4AL4A 4I9UA 5JXWA 1KVSA 1FK8A 1PJ3A 4UULA 3O03A 4RF5A 5KJ6A 4BGUA 4PG4A 4WEOA 3ZWXA 4JP3A 1FMCA 2OORA 4E33A 3QVOA 1IZ9A 3RKRA 3IJRA 3TF5A 1X1EA 1RKXA 3ZV4A 4XGKA 2DTEA 3OETA 3PWZA 3EHEA 1E6WA 4PG5A 4OXKA 3JQCA 1RPNA 2H6EA 1Y5MA 1DHRA 4CMEC 2X9NA 1PGOA 4ZQHA 3R3JA 1ISFA 3G17A 4AICA 4DWVA 3JQAB 1O95A 3GA0A 1ZK0A 5DT9A 3HDJA 1EDOA 1CYDA 1NVTA 3SBOA 1QRRA 4YYZA 1B3BA 3CXRA 3PRJA 2SCUA 3HFGA 4TRNA 4WKGA 5ER9A 3WTCA 1C1DB 5ITWA 4M8SA 3KOUA 5DCYA 3RROA 4QUKA 3L9WA 4PLWA 2Z5LA 1ZFNA 4Z0PA 4HY3A 3G49A 5B4UA 3H9JA 5ES3A 4BKQA 1H6CA 3R1IA 4DMLA 3Q0EA 2VNAA 4BNLA 5EN4A 1PGNA 1EFKA 3UHAA 1EUCA 4Y8VA 3W8FA 5ILOA 3LYLA 2GZ3A 1I24A 1T4BA 1P77A 2RH4A 2G5CA 2ZKLA 3AFNA 1XQ1A 1FF9A 1W73A 3ENNA 4ALKA 1NWCA 5H83A 5T6BA 1V0JA 3NT5A 2HMTA 4KUEA 1MV8A 2CD9A 1PS0A 2VT3A 5JBIA 1EVYA 3PYMA 2YUTA 3UVEA 2E48A 4E2WA 2GN4A 1ISGA 2GASA 1V3UA 2Q1UA 2IXAA 2YHIB 3ZWPA 2J5KA 4ZRNA 4UVIA 2EKLA 4YAEA 4KOAA 4Y9DA 4M87A 4QTZA 4B3HA 1JWBB 1EK6A 4TSKA 1XLTA 2EW2A 4H16A 2HUNA 4XQGA 4BO8A 1C0IA 1ML3A 3TL2A 2IRWA 3NGLA 3ZNOA 4BNIA 1E77A 1T4DA 4YT4A 1O8CA 2XF8A 3INTA 2QQ5A 2Z95A 5C7LO 2OUIA 2HMSA 3NAQA 2C7GA 4UREA 1LC3A 4XIYA 3F6YA 5U1PA 1ZK3A 3F4BA 4AJKA 4J16A 3RFTA 4CLXA 1M75A 1J6UA 4OOEA 4FS3A 2Y99A 2VZ8A 3PXXA 2C7VA 3GQVA 3JQ7A 4LRTB 1W0CA 3D64A 1U3UA 1DLIA 2ET6A 4RZIA 4OGWA 5KKCA 3QWAA 4TZTA 3GNSA 4FJ2A 3DBHB 3SLKA 5AXDA 3FBTA 4I5DA 1GV1A 1U3TA 3RCBA 1HF3A 1KC1A 3PWKA 4XIJA 3RFVA 4DRYA 5DNAA 1F0YA 4BV8A 4JJFA 4YAIA 3L9XA 1VJ0A 4FC6A 1ZZEA 3FPCA 3P5SA 4OOFA 4ZICA 1Q7BA 5G0UA 1GV0A 1HL3A 4RORA 2Q2WA 1X15A 1WZIA 1IE3A 4E21A 3PTZA 1VI2A 1LU9A 2DUWA 5DF1A 3I3OA 3I23A 3VZSA 4IGEA 1N1GA 1U4SA 4HBGA 1ZJYA 3HWRA 1VLLA 5TGDA 2DBQA 4BNFA 4WECA 4KDEA 4UEJA 1EFLA 4B8ZA 4CM6A 1NTOA 3VH4A 1Y81A 2Y93A 3OJFA 1PJ4A 3KTDA 3OHSX 3UUWA 4RDHA 3GG2A 1VSUA 1BXZA 4N5MA 3TZKA 4B4WA 3KB6A 1Q0QA 4J6FA 1H9AA 4G2NA 3V2GA 3ZI0A 4E30A 1NQOA 4J9VA 5TRTA 3RUIA 2BELA 1AE1A 4OL9A 4J1QA 1DFHA 2VHWA 3ZDFA 4BKUA 4HWKA 4GMGA 1LSJA 1Z75A 3PIDA 1RYEA 5L7TA 1I5RA 5AXAA 1U8FO 3Q9UA 4E6PA 3OA2A 1GUZA 5JW6A 1KY5A 2IE0A 3L4BC 5BNIA 1J0XO 2O3SA 1C0LA 3GDFA 1PZFA 5K6AC 3I9OA 3U9LA 4YJHB 1E1MA 2VT2A 3GNTA 1YS4A 3HNPA 2YV3A 2VHXA 4GGPA 1DAOA 1HT0A 1MFZA 1U2GA 5JO0A 5AOVA 4BGIA 1SNYA 1WDMA 1U9JA 1CJCA 4WOKA 2RBEA 2GLXA 1JWAB 3KXDA 4EJMA 3FCOA 3AM5A 5C3MA 3AY3A 4RQUA 4XB2A 1XKQA 3ZGYA 4BIIA 4GWGA 1Z74A 2B37A 2XXJA 5HM8A 1PL8A 2E82A 4CMCA 5A9TA 4E3ZA 3CTMA 1UZLA 3UAGA 1JQBA 4XYLA 1DIGA 3GC6A 2BFAA 3AUSA 1HSOA 4GKBA 3VVBA 3O9ZA 1FXSA 3H4VA 4Y98A 1PZHA 1K6JA 3DB2A 3T4EA 4NK4A 3IAHA 1E7YA 2OZPA 1HZZA 4A7PA 3F1KA 3QIVA 4GVLA 3FNGA 2NSDA 2JHFA 3G0OA 5EMHA 1ZXBA 2YFQA 4CV2A 1YE3A 3CZMA 3EVTA 5EQFA 3ZHXA 4NHEA 5DDIP 2A4KA 5A5FA 5ILGA 4WLOA 3TWOA 3RUDA 2C07A 3EC7A 2DM6A 4TKMA 3WB9A 1HDRA 2HU2A 3DHNA 4NJMA 5JCJD 1DPGA 3EDMA 1GQYA 4CMKA 5HA5A 1PJLA 4CLEA 3DAFA 1TVEA 3GH3A 3GY0A 1BXKA 3C1OA 3KYCB 3JQGA 4IMRA 3ZNNA 3V2HA 3GZNA 2W98A 3GHHA 4CPDA 1PJCA 1YOVA 4Q3AA 1SOVA 3QV1A 1WDLA 4IJWA 2NACA 3FWNA 1ADCA 4R5MA 3K9QO 1RJWA 3LT4A 1JN0A 1GD1O 3NT2A 2EF1A 2DC1A 2PKQP 1EE9A 4ND3A 5KNLA 3GPIA 5KJEA 2WE7A 5TJHA 1T1SA 2CF5A 2VWQA 3BMOB 4A2CA 1PIWA 2OFPA 1LTHR 4UEOA 1QYDA 4YRAA 1G0OA 2YV1A 4Z9XA 5F1KA 3TJRA 2I5PO 2VZ0A 4PZDA 3QVTA 3HDHA 5IDXA 4Q3DA 4R1TA 1NQTA 5T8KA 3HDQA 3WICA 2GZ1A 4AJHA 4GAEA 4J9UE 4WCFA 3X2EA 2W4QA 1NHGA 2AEJA 4QFCA 1I33A 3ZCXA 1MG0A 3GGPA 3ORFA 4XA8A 1O6ZA 2JJYA 3I6IA 1LXCA 2VNSA 3FR8A 3WR5A 4L0QA 2DT5A 1GYPA 2NM0A 2RHCA 4MP3A 3A1NA 1LEHA 2Q1TA 2Z1NA 3ON5A 1GAEO 2AG8A 3Q11A 5L7YA 3H65A 5LC1A 3B6ZA 3BMQA 1GZ3A 1O89A 1N1EA 4RVSA 1DDOA 1MA0A 2ZYDA 3L6EA 4FN4A 1R66A 3T4XA 3GEMA 1NPTO 1XGKA 1E3IA 1PR9A 4PFJA 1QP8A 4BNHA 3WNVA 5B37A 3UICA 5CDTA 4XJTA 1V9LA 3B20A 2C5AA 4DIOA 1B3RA 3QWIA 3JQ8B 4TRMA 2D3TA 1KYQA 3JQFC 3MOIA 1MP0A 3HB5X 1SAYA 1W4ZA 3PVZA 1Z82A 1DAPA 1MC5A 3UN1A 1X7DA 1HE2A 2W90A 1C3VA 3QP9A 3QVXA 4CODB 3MJVA 4K6CA 4GWKA 4CM9A 4II2A 3D3WA 5FWNA 2PTGA 4ZU3A 4R54A 1TT7A 5IG2A 3VDQA 3V2UA 1ZBQA 4R41A 4HFJA 5DN9A 2HMWA 1SO8A 4WLNA 5ENVA 3RBVA 4CMIB 3EY4A 4FPXA 3AOGA 1GFSA 3DONA 3L77A 1BWSA 1NPDA 3BXXA 3PJDA 3LDHA 3GDOA 3ZWAA 4Z0HO 3I9JA 1U2DA 1UXJA 3AM4A 3GAFA 3ZWOA 3S2FA 3WGOA 2ZQZA 1UAGA 5GZ6A 3GGGA 1P1FA 2GSDA 6ADHA 1I10A 5IF3A 3E9QA 4UUNA 4ZQFA 5TJ9A 3M1AA 1WW8A 4DLBA 3UCXA 5G0SA 1KEVA 4J2HA 3NV9A 2UUPA 1ID1A 3ASUA 3A14A 5L95A 1ONPA 2WD7A 5T64A 4RVDA 4H15A 3W6ZA 2GCGA 3GG9A 2X0NA 4Q3BA 5IFLA 2V6FA 4IQ8A 1VE9A 1QKIA 1KVTA 4NR0A 1NHWA 4XQCA 3IKTA 3C7DB 4CM5A 4F3YA 4J4HA 3LF2A 1U5CA 1JKFA 4EJ6A 1R4NB 4IQGA 4JBIA 3DO5A 3ULKA 1EBFA 1YJ8A 2AQKA 5DZSA 3FSRA 1U1IA 2CDCA 3H3FA 1EE2A 1UJMA 3WDSA 1RM3A 4BNNA 1KEUA 5IAAA 4EITA 2V65A 5F1PA 2I9PA 4B7UA 3DBLB 2A94A 3KEOA 1NXQA 5TSDA 4U6SA 1P33A 3VPSA 3RC7A 3G3EA 3LSYA 1VC2A 1YDWA 3ROQA 3HJAA 3FR7A 2Y1OA 3EYWA 4QX6A 1LLQA 1BVRA 5CEJA 4RL6A 3MJSA 4CLOB 1MXFA 3TFQA 1ZJZA 3DHYA 3NX4A 4Q39A 5HRUA 2GF2A 3DBRB 4X54A 4K6FA 2Q4EA 1NQAO 2DPHA 2P4QA 4MIEA 4TKLA 5CDYA 4HFNA 2C2XA 3CEAA 1PU2A 1N9GB 4ND1A 4FBGA 3FWZA 2BFMA 4LMPA 2VYVA 1T2FA 2X0RA 4DPLA 2J3IA 3BHIA 1KVRA 3E48A 4J43A 4FOSA 1B0AA 1XYGA 1NX6A 2C82A 4ITUA 1PGQA 4CM8A 2GN9A 3GUCA 5IZ4A 4CL8A 4JJGA 1BDMA 1GQQA 3U5TA 1LSSA 2J5QA 4A03A 4KTTE 4JP2A 3OIGA 3K8ZA 2VRCD 3GVCA 4AJIA 3QY9A 3Q1LA 3KUXA 4BQRA 3FNEA 4WOJA 3OH8A 4ONEA 4WLEA 4BNUA 4J1NA 1R37A 1UAYA 2UYYA 5KJ1A 4IIVA 4IDFA 4XB1A 4IDAA 4ND5A 3WQQA 5A9SA 3U49A 1P1KA 1P9LA 4Y6PA 4JROA 1GQ2A 3IP1A 2D2IA 3C3XA 4DLLA 1GL3A 3UCEA 2IYPA 2VRBA 2CZCA 3DDNA 4RCVA 5H81A 1IUKA 1LC0A 1YL5A 1UH5A 2AE1A 4P4GA 3EAGA 4LISA 1E3SA 1CF2O 2JCVA 1GUFA 1BG6A 1GYRA 4IQ0A 3SC4A 2DVMA 3ZHBA 2IEBA 3VZRA 2GR9A 4MIYA 3I4CA 1T2AA 1NP3A 3ONFA 2O23A 1PSDA 2WM3A 5COBA 3GAZA 3HB4X 4KWHA 1JA9A 1SEPA 2Q1WA 5ADHA 3ENKA 3LC7O 3PJGA 2CVZA 2ZJ1A 4CQMD 4PG7A 5I8ZA 1A9ZA 3JTMA 4FCCA 1DIHA 4AJEA 1FDTA 2CSUA 4XEHA 1QYXA 4HNHA 3UKOA 4BV9A 3UH1A 3C85A 4EYEA 4UVGA 3ZNQA 4I5EA 2DPGA 5IN5A 5GY7A 1YDEA 2IXBA 1TLTA 1KC3A 4PLVA 1AGNA 5AVOA 3UF0A 4B3JA 1VKNA 4XDYA 5F21A 5T8KC 3BAZA 4RV9A 3E1KA 1ZK1A 2RCYA 3RC2A 4XYMA 4BNGA 1UXGA 2CY0A 5DBGA 3MCVA 5L45A 1CWUA 4FQ8A 1B26A 3GR6A 3L4BA 4OQYA 1R6DA 3GDGA 1E3JA 2PZKA 1AXEA 3HHPA 1GY8A 3WNQA 1UDBA 3K31A 3H9UA 4WUVA 5I7FA 4J7CA 5EQDA 5KTKA 2E6UX 1PGJA 1EZ4A 2QYTA 4ZD6A 2O2SA 3DTTA 4II3A 4L75A 4R5HA 1JAXA 4P4LA 3OJOA 1Q7CA 4FFOA 3PGXA 4RVFA 4XDZA 5G4LA 4FR5A 1ZVMA 4WLUA 5THQA 4MPDA 5A1TA 1DC3A 3GK3A 4PCVA 1N5DA 4NFHA 4B4UA 3NJ4A 3PQFA 4NFSA 4I9HA 2HJRA 3WXBA 1P1JA 4M89A 3S2EA 2WTBA 5TT1A 4NQZA 2PH5A 4IINA 4GMFA 5THKA 3V1YA 3H8VA 2Q49A 4GKVA 4AJ4A 5JLAA 1I2ZA 3QWHA 3SJ7A 4Z3DA 2TMGA 4MVJG 5JAQA 3BMCB 3VH2A 4BNMA 3PLRA 5DCWA 4MKRA 2X9GA 1Y6JA 4A26A 5CPBA 3TNLA 1PJTA 1QV7A 2CDBA 3IUSA 3I9MA 4Z9YA 4QECA 1E7SA 1WMAA 1DHTA 4MKXA 3I4FA 2QZZA 4BNKA 3NTOA 2GUGA 3FBGA 4DQVA 3OIFA 2HAEA 3ZU4A 1O5IA 1DB3A 2EHDA 1QG6A 2Q45A 4GPD1 3VZPA 5CAEA 2XPCA 1AHHA 2JD2A 3GRKA 3H2SA 1EVIA 5JCJA 4RF2A 2EIHA 4MVJM 4J1SA 1O9BA 4CQLA 4TMFA 2DTXA 2PFGA 2OHXA 3K2EA 2QHXA 5A5EA 1XQ6A 3ICPA 3ROKA 1K5HA 4N5LA 4XQ9A 1QSGA 2CNBA 4TRRA 5A06A 1K89A 1C1XB 2HLPA 4UVEA 2PD3A 4N5NA 5JMWA 2BGLA 4KUGA 2VYVD 1YGYA 1CEQA 2G76A 1XIVA 3PZBA 3RUHA 2HJSA 3HQ4O 3WMXA 3HZZA 3PLNA 3QVSA 2NQ8A 3IMFA 3F5SA 1VJ1A 4HP8A 4KMSA 3DMTA 1KIFA 3UW3A 3FD8A 1M66A 5BSGA 3WGIA 1SOWA 5BT9A 1UP4A 1C14A 2PA3A 1LQTA 4IXTA 3BZUA 4KTVE 3DOJA 1WP4A 2ZYAA 1HYHA 4EUHA 2JL1A 2B83A 3NDRA 4YA6A 3HADA 2TMDA 1OZAA 4R3NA 4GL4A 5F5LA 3ROPA 1OBFO 4W4TA 3RD5A 5JPIA 1E7QA 3ADPA 4JQCA 4BO9A 1EEHA 3NJ8A 2FR1A 4R3WA 1CERA 2OL4A 9LDBA 5I9LA 1R0SA 1TI7A 1A4IA 3WIDA 4CR6A 2IZ1A 3V1TC 3U3XA 3JQFA 3JQAD 4NBWA 3ITDA 1DLJA 3ZWBA 3VHRA 3VKVA 2Y1CA 4RJTA 1E3EA 4BO6A 3SXPA 1UDCA 4PLYA 4PRKA 3PQDA 2YHUA 4LN1A 1IHXA 1Z45A 2D0IA 4XGNA 3TDKA 3UFXA 1ULUA 4LSMA 4JNKA 1ZMTA 4W7IA 5A9RA 4DPKA 4YPOA 1U3WA 2WYWA 3ZW8A 4XRRA 1LRKA 4D43A 2ZB4A 2VZ9A 4FW8A 3PHHA 4I1IA 1H6AA 4IMPA 1UR5A 4NK5A 3GVIA 2FSVA 3WGGA 4FB5A 4XR4A 2W2LD 1T25A 3V5NA 4E32A 1DIAA 4RF4A 3NTQA 1OC4A 1R12A 4NJOA 8LDHA 2FOIA 2FRDA 5FEUA 1MX3A 1AXGA 2OO5A 1CQIA 3IKVA 4NH4A 4HADA 4Y67A 3E5RA 3K2BA 1YRLA 5G4KA 1V6AA 4QQRA 1YVEI 3RWBA 4TQGA 3VPGA 1ZSVA 2VUSA 1UXIA 3DZHA 1E0DA 3JYLA 1F12A 5TNXA 2Q4BA 1D1TA 3T7CA 2Y67A 1WLYA 3GT0A 3PZRA 4BHTA 1Z7EA 4D0RA 4RPLA 1I3LA 3RJ9A 1E3WB 1ZEMA 3KYDA 4BMVA 5BSFA 1SCUA 4KQXA 5F5NA 2QG4A 3DAPA 1MLDA 3DHEA 4R1SA 4YJFB 1QR6A 1ENPA 3GFGA 3CSDA 3QQPA 4K26A 4XD2A 4EUEA 5TLSA 1TB4A 4YEDA 4BNVA 2YJZA 1CQJA 4IDEA 1ENYA 4MP6A 1WWKA 5EERA 4IDDA 3R3SA 4YDRA 3RI3A 5HS4A 1S7CA 4XRGA 4JBGA 4DBVO 1H6BA 1VM6A 1TEHA 2CF6A 1GU7A 3SX2A 3DZFA 3FNFA 3VPHA 4ZQGA 3OJEA 3DR3A 4M1QA 4YT2A 4DVJA 1MUUA 3ZV3A 3NGXA 1NBOA 4OSPA 4Z0TA 3VPFA 2HQ1A 2DLDA 1PL7A 1V3VA 4YJGB 1ENOA 4DIBA 5JY6A 3I1JA 3OSUA 4EJ0A 1ISHA 4BNXA 3WQSB 5JSFA 3AU8A 4ALMA 1BXGA 5CP8A 5KCZA 1GZ6A 1JAYA 2F1KA 3RIHA 5DULA 2GN8A 2OP0A 4RQTA 5CHEA 3C7CB 3AJRA 1H93A 5KVQA 1B8VA 4F45A 4ZHSA 1LQUA 1V3TA 3C24A 1HDGO 1Y7TA 5I8WA 4WASA 4O5OA 4RLSA 5L3ZA 3M1LA 4NMHA 2J8ZA 1L7DA 2P9GA 1GCOA 1U3VA 1VKOA 3ICCA 1P0FA 5EJ2A 1KOLA 4YR9A 3CE6A 3IQDB 3PK0A 2ZTVA 4PZCA 3NUGA 4R4JA 4UEKA 4W6ZA 2OBNA 1D4FA 4DC0A 1PJSA 2HDHA 4DC1A 1ZCJA 1H6DA 1GTMA 3WMWA 1LI4A 1ZEJA 2W2KA 4DQUA 4IBOA 3STHA 2I6TA 3DWFA 5FF9A 2O3JA 1Q0HA 2HKIA 1RM5A 2NVUA 1MXHA 1DSSG 2QRKA 3RVDA 1A7AA 1ADFA 3AU9A 5COQA 5L51A 3U4IA 1CIVA 2B4TO 4FGWA 5K9ZA 3VKUA 3E9MA 4ZQBA 2DQ4A 2X22A 3BMNA 3PHIA 2ZATA 4O0LA 4OXYA 3S55A 5L40A 3K73O 4CL3A 1H2HA 3RUFA 2NLOA 3PGJA 1IZ0A 4CM1A 4A5OA 1PS8A 2VRCA 5LDGA 2QYSA 1DJQA 3JD2A 1VL0A 5TIIA 1I30A 2O7SA 3AM3A 3M6IA 4EDFA 1G6KA 3K96A 3BIOA 1PR3A 3JQ6A 5KVVA 5DOZA 3IL2A 1PQWA 4UVDA 3K5PA 4MIOA 4DYVA 1EVZA 4PGFA 3SEFA 4LCJA 3RBZA 4EGFA 2IYOA 1KBZA 2NQTA 1X0VA 4RPHA 3VZQA 3CZRA 3DZJA 2RAFA 3M2PA 5TT0A 1BVUA 5IXSA 4R16A 1VSVA 4CM4A 2IODA 2YW9A 4GLOA 5G0WA 2O3RA 1ZSYA 4P4NA 2Y0EA 4ALIA 5KWEA 1HDCA 3VTFA 3CH6A 1SEVA 3EUWA 4KWIA 5H82A 4U0JA 1JLLA 4ALJA 1HLPA 2PZJA 4CMGA 4BO2A 3KVOA 4ND2A 3V8BA 4BO3A 4D41A 1ZH8A 2GYYA 3NDIA 3G79A 1FDUA 2YDXA 3EVNA 4PLHA 3L07A 4EEXA 1BSVA 3ITKA 4D44A 4EUFA 1HXHA 2R6JA 4DBZA 4CQMA 2FWMX 1D7OA 1VL6A 4BMNA 4PLTA 5DBFA 2OXIA 2NWQA 3TRIA 1XR3A 4DXHA 4CV3A 4J0EA 2WWRA 3UOGA 3QRWA 5C7OO 4ROSA 3PEFA 2H5LA 3DMTC 3JQ7B 3JQBC 3ZWWA 3BTSA 5B4TA 2C59A 4B3IA 2Q99A 1E6UA 2X23A 4JGBA 1WDKA 2X9VA 1M76A 1N7HA 2VQ3A 5ER6A 3IIEA 3ASVA 3TZQA 2VOJA 1RYDA 2R00C 4G5HA 4K28A 3NKLA 4MVJH 3ONDA 3OA0A 4YXFA 2ZB3A 4OQZA 1GYQA 3KSUA 3INGA 3PHJA 2V7PA 4UVHA 5J23A 2WYVA 1P1HA 3JQ9C 1NWHA 4AFNA 1LBEA 4EZBA 3ONEA 1WNTA 4FIZA 5LCXA 5JYDA 4RDIA 2X0IA 4IPTA 3ZNPA 5ICMA 3GFBA 5C7IO 5EESA 3RASA 4MINA 3L4SO 4JX8A 2BGKA 1BTOA 5CG1A 2NV6A 3JYPA 1C0KA 4XYBA 4BNYA 2HRZA 3IUPA 2DU8A 1UP6A 1NNUA 1JKJA 1J4AA 1DO8A 1BDBA 3LLSA 4Q3NA 1Y5RA 1XELA 4BNJA 3OICA 5F3RA 3O26A 1IYZA 2PKQO 2ZB7A 3D5QA 4K1LA 3ZV6A 4BB5A 2AG5A 2FPGA 1DC6A 3ANNA 4K9DA 4GX5A 3NYWA 5HBRA 3QWFA 1Y8QA 4Q3CA 2Y1DA 5EINA 4GGOA 2JCXA 3FRJA 4BQPA 3U0BA 1NVGA 4OKIA 4QT0A 5BSHA 4BL5A 5C37A 3AI1A 1BW9A 1XEAA 3IP3A 4C7JA 1E7WA 2AHRA 3QW2A 1HDXA 4BNTA 1QXSA 9LDTA 1HDYA 1DRWA 3KBOA 1SB9A 1U28A 3ZU5A 4Y6SA 2C0CA 4LRSB 2HCTA 2I3GA 5EIOA 4RLHA 4AG3A 4B7XA 2AA3A 3S1LA 3H9QA 2QZ9A 4IJVA 2OMEA 3OJLA 5T57A 1XSEA 2DBVO 4J91A 5A3VA 4NIMA 1LDEA 4F46A 5BQFA 3P7MA 4FD3A 3KSDO 3AI3A 4BGEA 3OF2A 2W2KB 3GMSA 4W99A 1YBAA 1HZJA 1ZKMA 2NTJA 2FN7A 4O59O 3D3EA 5JO9A 4JIGA 4DA9A 3ANMA 3FNHA 4NBRA 3TFOA 2RIRA 4D3FA 1NFFA 5F1OA 1KY4A 1TT5A 1IOLA 2FHSA 3C7AA 1ISIA 5L4LA 3EW7A 4FDAA 1XA0A 1LDMA 1YQDA 4RPGA 1Y8RA 3AOEC 4RVGA 4E4YA 1KETA 4ZN6A 1EQUA 4HFRA 4CM3A 1ORRA 1MFPA 4GBJA 1ISMA 3GN2A 3N74A 3BHJA 5HS6A 1L7EA 3CIFA 3ZN2A 1T26A 3RKUA 4A0SA 3WGZA 4WNIA 1SB8A 4JXKA 4E5NA 4NJMB 2O2YA 3AI2A 4RVHA 1W6UA 3KM0A 3KHUA 1D1SA 4MOWA 4RPJA 5MGBA 3H6KA 1PQUA 1ONNA 1I32A 1SZJG 5IZCA 1U8XX 5IN4A 3JQGB 4WE3A 2AXQA 1HLDA 3PHLA 4CLRA 3AK4A 1P44A 3GZNB 4OYRA 1R4MA 4ILKA 1Y1PA 4XYGA 1YOVB 1WZEA 3L0DA 4PLFA 5B4VA 3VDRA 2ZCVA 3ROMA 3IOYA 2G17A 3PIIA 5KVCA 5FYDA 2P9CA 1JW9B 3OBBA 3QA9A 2ZTMA 4C4OA 1GUYA 5GZ3A 4QXMA 1H94A 3A9WA 2QX7A 1B15A 2YQ4A 2FR8A 1A71A 2BD0A 4YJDA 2LDXA 4ALNA 4JJIA 3VAZA 1HYGA 3E5MA 3TQHA 2LDBA 5L7WA 4QEDA 2BFPA 5K0ZA 2VN8A 2C54A 4YACA 3JQAA 3CUKA 3DQPA 4WCFB 4W7HA 1IY8A 5JCXA 3HN7A 3OQ1A 3UCFA 3DXFA 4E0BA 3H9GA 2AQIA 1ADBA 4EBFA 1KEPA 2J3HA 3U4HA 4ND4A 1C1DA 1K0UA 4CUZA 5B12A 3WJAA 1GPDG 2QRLA 4DYDA 1VRWA 4R1UA 4CMJA 5FFFA 3MTJA 1XU7A 3BMQB 2C20A 4XR9A 1CDOA 2YYYA 4CMAA 2W2LA 1UXKA 4PVCA 1QLHA 3PJEA 4DUPA 1E1NA 1E5QA 2HMUA 2Z1MA 3QSGA 3WGQA 1R0LA 3ZWMA 4EW6A 1Q0LA 1R0KA 2BLLA 4YRDA 4B7CA 3HG7A 4DLAA 2AQHA 1WPQA 3H7AA 4FFNA 3WFJA 3JD1A 4TVOA 4YRBA 2BHLA 4Q9NA 1YO6A 4HFMA 4CV1A 4YVFA 2QW8A 3BHMA 5JS6A 4QO8A 2PK3A 4J1TA 4DTIA 3TSCA 3EMKA 2I65A 2GZ2A 4B4OA 4W9NC 4N54A 3N58A 1E6EA 2POQX 3SVTA 1YKFA 2FR0A 3K6JA 4UUMA 1DEHA 4E13A 4CUJA 3ZU3A 2PY6A 3D3WB 4M49A 2YHIA 3FHLA 4OMUA 2HK8A 4L4XA 1DFIA 1K6IA 2CFCA 3KZVA 4BO5A 1LSOA 5FI5A 4UUPA 1UP7A 3IC5A 1Z7BA 1B7GO 2GN6A 1A7KA 3C1TA 4D45A 5A4DA 2DUUA 1K6XA 5CDSA 2VUUA 2VUTA 2PKRA 4NFYA 1IULA 2OGUA 2Y68A 4KUHA 3FF4A 4M86A 4KP7A 5JDIC 1B14A 4U8GA 4NI5A 1EK5A 2I99A 3PJFA 3I9KA 4NZ9A 2X6TA 1D8AA 1GDHA 3LK7A 5L4SA 4L4RA 1UZMA 3Q6IA 2JHGA 3E6AA 2JKVA 3IS3A 3VOSA 5JNLA 1M6HA 2JAHA 1YB4A 4PLCA 2EKPA 4DGSA 4FFPA 1ZNQO 1UZNA 3F4LA 2WD7B 1VPDA 5JY1A 3DBHA 1FDSA 5BSEA 3QJ5A 1GZ4A 3ZZNA 2AE2A 1C0PA 3ANLA 3D4NA 2BI7A 3H5AA 3C1AA 2Q2QA 4D42A 4FOOA 1DOHA 1M67A 3WBFA 3AWDA 3D1LA 3I83A 3MEQA 3JCZA 4IS3A 1DIRA 3ZV5A 3WFIA 4BMSA 4H3VA 3DAGA 4Z9FA 2EERA 5JDCC 5ITVA 1FDVA 4JBHA 1NM5A 5TC4A 5A04A 4BO1A 2CVOA 3HSKA 3GNQA 4BKOA 4I08A 4UAGA 1GR0A 4HUJA 4QO7A 2HSDA 3HN2A 3QWBA 2D5AA 6LDHA 4BUCA 4JN6B 4YT8A 1PGPA 5KJCA 4Z3KA 2Y66A 1P3DA 1NASA 4FSHA 4IDBA 4A27A 3R6DA 5IDYA 4YAJA 4L74A 2ZYGA 2EP5A 3LT1A 2B5WA 2WJPA 1V35A 3IDSA 1A27A 1A9YA 1IB6A 2XAAA 2YV2A 4MVJA 4FFLA 3L6DA 4FJ0A 1U7TA 3JD4A 2Q3EA 4OKNA 3T7EA 3OJ0A 4NU5A 4IY1A 5JAZA 1QLJA 4CM8B 1ZO8A 3ETEA 5HTOA 5TX7A 1LDBA 3DL2A 2NADA 2Q46A 2X5JO 4IJKA 3TPCA 1BHSA 1ZK4A 3LZ6A 2Y1EA 3VTZA 2PLAA 1XCBA 2P2SA 1DBVO 3F9IA 3W4JA 4AJLA 2CVQA 1NPYA 2EGHA 2VOEA 5U9CA 1QORA 2VYND 4YJHA 3CKYA 4L8VA 4WGGA 4OXNA 3Q2IA 4TRJA 4L73A 1KS9A 3DFUA 4NG5A 1CRWG 2FY8A 2PGDA 1U5AA 3DZKA 3GF4A 3MTGA 4DREA 1YH3A 2XOXA 3P2YA 3S2IA 5ICSA 2AMFA 1U4OA 2JCYA 3WGYA 3WSVA 4J49A 4L9RA 2NU7A 1HEUA 4GLLA 5A9SB 2RHRA 2A9FA 1Q1NA 5BR7A 3JQBA 1N2SA 3KLPX 1Y9AA 2GNAA 3U09A 4MVJF 4AJJA 2A92A 3CMMA 1FJHA 1P74A 1PX0A 1ZK2A 3D7LA 3D0OA 4J7XA 4NNJA 1ZMOA 1QMGA 1J5PA 3W1VA 2R00A 3CMCO 5I7VA 1I2BA 4DL9A 1ZUD1 1QYWA 4I5FA 3F47A 4R68A 1M6WA 4MJLA 3JYNA 3RSHA 3PQEA 3HE3A 3W8DA 2NU6A 4ALLA 2PZMA 4CMBA 3JQ9A 5IZCC 2VHVA 3WTBA 5IJZA 3DEYX 3PFFA 4GI2A 4AVYA 1LLUA 2NTNA 3F1LA 4G81A 4R9RA 1Y9EA 3W8EA 4C7KA 5JC8A 1PTJA 5G0VA 3ZH2A 2EWMA 4LMRA 3KYCA 4IJUA 2P5YA 2UDPA 2IZ0A 4DMMA 1VJTA 3AUUA 3A28A 3W4KA 1E92A 3JQDA 3PDJA 1H5QA 3INRA 3RJ5A 3FI9A 1J49A 1HYEA 3EGOA 3DMYA 1HDOA 4O63O 2V6BA 4GSLA 1IPFA 1E7RA 5IXYA 2UAGA 3BMOA 2EXXA 1GEGA 2GRAA 4D79A 1HKUA 1PS9A 3Q2KA 3Q9NA 4GH5A 2P9EA 3NTRA 4BGVA 4FFMA 1JKIA 2V6MA 3D5TA 4CM7A 2ZTLA 4P22A 1PJQA 1H9BA 1I3KA 3DZIA 2H9IA 4GVXA 4R69A 3U62A 3HFSA 1UDAA 3OQBA 3WLFA 4NBTA 5DCUA 4TZKA 4LVUA 1F8GA 2BI8A 2YQ5A 2WEKA 2ZCUA 1H0KA 4XYEA 1LJ8A 1EUZA 5A02A 2VWGA 3TZHA 2BGMA 4OHUA 1YBMA 1X14A 1H2BA 3SJUA 4AJ2A 2WD8A 4BNZA 1WAMA 3D4OA 1Z6ZA 4J4TA 4BO7A 5DOVA 3QVWA 5L9AA 4GX2A 2UUOA 2D4AA 3EK2A 3C8MA 3OMLA 2O7QA 2OOSA 3L6OO 3GRPA 5IDWA 2DKNA 1OI7A 1SMKA 3BTUA 1W8DA 4F6CA 2IEDA 2NTVA 3G1TA 3GMDA 4FFRA 3H5NA 5CDUA 1PWZA 5I9MA 2PR2A 1JVBA 5BNFA 2EJWA 2YFHA 3H3JA 5L4NA 3ETGA 1ARZA 1HETA 3W4IA 3RU9A 3AOEA 4I9NA 1L1FA 3MZ0A 1E5LA 2VHYA 4O1MA 4XWYA 4BKPA 4CLDA 5BNTA 5AYVA 1ENZA 4OJNA 2Q2VA 3CPSA 3JQ8A 5C5IA 1F8FA 4PLGA 1KERA 7ADHA 1B8PA 4GX1A 2B4QA 2ILTA 4D7AA 3LC2O 1YBVA 4PZEA 2X7HA 2EP7A 1LLDA 5MDHA 4Z6KA 3LVFO 1AN9A 1P31A 3F5QA 3F3SA 3JD0A 4AJ1A 4BB6A 2B35A 2FMUA 3GN1A 1BMDA 1SPXA 5CFZA 4YCAA 4KDFA 1XDWA 3TZCA 2HMVA 3GHYA 2Q1SA 4E2YA 4MVJP 1LNQA 4J3FA 3V1UA 1YONA 4CMIA 3HDYA 2X1HA 4QSMA 5I7EA 2P68A 5G2OA 3RFXA 1LSUA 5TF4A 2VTEA 3PHGA 5TQVA 5HWSA 4E5PA 1EQ2A 4U5QA 2C29D 1Q2XA 1K2WA 2I67A 4AJNA 3A06A 1T2DA 4W82A 1DC5A 1PZGA 1WVGA 2HK7A 4WCDA 4CQLB 3OEYA 4WLFA 1JDJA 1T2CA 3NRCA 3AY7A 2BRUA 8ADHA 1LDGA 2EJVA 5CEEA 3COSA 4IDGA 3E9NA 4S3MA 1I36A 3QLJA 1HRDA 3OIDA 4MVJD 4UUOA 3A4VA 3ETDA 2ZJ0A 4N7RA 1F17A 1NR1A 3LC1O 3M2TA 2ZIZA 1E1KA 2PGLA 3KRTA 4RF3A 2PD6A 2NU9A 1GPJA 2NNLD 3IJPA 4ZVVA 1ONOA 4D3SA 1R4NA 2FZEA 4YWJA 5JFOA 3MWEB 1BRMA 1EMDA 1F14A 4MO2A 1PZEA 5JMPA 4BKRA 2O50A 1NAHA 3E18A 3AW9A 3WX0A 1X0XA 1MB4A 1I8TA 5JAIA 4M54A 3WBBA 3DBLA 3EZLA 2GGSA 2PV7A 4TWRA 1EVJA 1YL6A 2GO1A 4U6QA 5DP2A 5JE8A 3H5RA 3I9LA 1DJNA 3PDUA 4ZA2A 4DQXA 4CLOA 2JAPA 4ZGWA 3DBRA 1ADGA 2PNFA 2ZK7A 4HX5A 1YWGO 3GVPA 2I76A 1T24A 3AY6A 1WMBA 2X5OA 4R01A 1N9GA 2BFOA 4CMHA 1HTBA 5LDHA 4W9NA 4OO3A 1KVUA 4R9SA 2XXBA 4HKTA 1LX6A 2F00A 3TOZA 4EEZA 3AUTA 3ZWCA 3ZW9A 2D1YA 3ST7A 1DFGA 3WYBA 4XKJA 3LT0A 2O4CA 2J3JA 4XGIA 3UXYA 5I9NA 4YAKA 2QRJA 4PLZA 5GZ1A 3GVXA 3WJ7A 4LCEA 1P0CA 4ESOA 3JQEA 3KLMX 4WNCA 2Y1FA 3VH3A 4B8WA 3ZHZA 4LGVA 2YY7A 1A5ZA 3MJ4A 4PG6A 3KETA 5B1YA 3LT2A 5JDIA 3N7UA 5CPFA 2OBYA 5CG2A 2P91A 5G4KB 2AEFA 2A35A 3NEPX 5L53A 4I5GA 4NU6A 2HK9A 2X58A 4XX0A 1QYVA
chains in the Genus database with same CATH superfamily
3SOPA 4Q4HB 8MHTA 1NLZA 3L0CA 5JWHA 3GLFE 3VDXA 1EX6A 3MVEA 3EXEB 3EA0A 4PBTA 1BCSB 3ZR4B 5L6MB 2B1JA 4V0OA 2YIMA 3KYDB 1VJ5A 1SCUB 2O8DA 1Z4QA 2O5RA 1K3UB 1QHYA 3WNZA 1M33A 1N5OX 3G2HA 4MVJE 3QNUA 4E31A 1KMCA 2PH3A 3KSZO 3HPRA 3IVMA 1LDYA 4E5YA 4NV3A 4YLYA 1Y6GA 3PI7A 1FP1D 3H97A 3PWSA 4BFXA 3DEFA 4AYXA 1RACA 4ZZ0A 1Z0AA 4ZO7A 3OT5A 1WBJB 4LY3A 4AROA 4IUCS 4JK3A 4DMKA 1YZLA 1W93A 4F3KA 4M6WA 2GSWA 2PWPA 2X42A 4ZT3A 1BMQA 3QEAZ 3UAZA 2ORVA 1NVMB 4GE3A 5BRNA 5A4AA 2FUCA 5T5QA 1OLSB 1NFRA 1ODJA 4B32A 4INJA 2QTRA 3UGTA 3ZG6A 3FPFA 1YS7A 1B8UA 2ACKA 4M55A 1L5FA 4LF7B 3FUVA 1CUUA 3KE9A 2ZTUA 5K3FB 4IIDA 2GF0A 4O4IB 2C9OA 2YY5A 4EI2A 4TKZA 2C5EA 2O0JA 2Y1GA 3DEKA 3IVRA 4KXUA 4PVDA 1XNRB 1YXMA 2F64A 1XKTA 3F9CA 2J9GA 3O95A 4WZBB 3A6LA 4OH1A 3VO9A 1SVSA 2I3AA 4QFDA 3CINA 1W85B 3GI1A 5EP4A 5AOCA 1OYYA 1Z63A 5K1ZA 2HJ9A 1A95A 4ECAA 2YRWA 4IGFA 3WIEA 4MO9A 1AD2A 3W9BA 5KQMA 4YT5A 4EGCB 1VMDA 3QU2A 2QE7A 2ZBQA 1A7JA 2GPSA 2AD5A 2HZ7A 1SC6A 1FFEA 2C0QA 4PFKA 3QI2A 1CUBA 1AF7A 3VR6A 2CV0A 1U4NA 1W46A 1TK3A 5I9TA 3WAJA 1ODIA 1FBNA 4P38A 5D01A 3HO6A 1T0HB 4CG3A 1VBMA 2DX7A 2EW8A 3IQGX 2FPIA 3L7LA 3NWEA 3EJ6A 4Q3OA 1C3EA 2RHWA 4NFLA 2IHVA 5AXCA 2WUVA 3H19A 4ZYYA 1IG0A 5ED0A 2ZWPA 1U1DA 2BC9A 3KQTA 3L43A 3FYDA 3MILA 4I6JA 1T1EA 5BSUA 3ZQ4A 3QHAA 3H4TA 1OAAA 2V9CA 1TCCA 2ZUVA 1UC8A 3IRUA 3ENZA 2R6DA 1KHTA 4JI1B 3UMRA 2DFLA 2B5VA 2HMYB 2GEDA 2VP0A 1YL7A 4JLAA 1JFSA 2H1HA 3VXKA 2AEMA 2H07A 2WWYA 1X8JA 4PHTA 1ACMA 1Z68A 3A1SA 4D9NA 2ZTSA 4N18A 4RIEA 4JIMA 5AI8A 4B83A 5I4BA 4LZOA 4B2IA 2Z6AA 2A8YA 1OOEA 1CY8A 2WSYB 3ND8A 4PNHA 1VCHA 1UM9A 2O05A 4U02A 3TQOA 3LLVA 4NPCA 4KVZA 1PK9A 4EB0A 3G2NA 3KQNA 2REQA 5D8DA 3BC1A 3FNQA 4GLJA 1BN7A 3FHOA 4LVCA 5IJ9B 3F98A 4HQ6A 1DKRA 1LV8A 3A9RA 2XUAA 2VCHA 4BAUA 2FSSA 2H7CA 3BTVA 4TQAA 5ULLA 3WYCA 4RANA 4BMCA 4YMVA 1CUDA 2GD1O 4BX9A 1NMSA 1CVRA 3HBFA 5LMZA 4OX9Y 3FFBA 3CN7A 4LI0A 3UANA 4IM7A 5A05A 2I03A 3K94A 1Y33E 3P45A 3VUFA 1FC0A 1RHRA 4WJZA 4PN3A 3ROXA 1N2HA 1E1LA 1I2CA 3EDYA 4TTJA 4XCVA 2O8VA 5IAJA 3CSUA 2P5UA 2YZ7A 4L5CA 2XZTA 3CRZA 4GQIA 4BTVA 3WMEA 1QQ5A 3BMCA 1RVDA 4MUBA 4ZOLA 3PVSA 4G1MB 3P2OA 2Q9UA 5JZSA 2CUNA 121PA 2A30A 2B4RO 1V8OA 3CZ9A 3GCDA 4FYHA 3LBNA 1QBGA 3I01M 1EJ0A 1QZZA 3GUHA 2I7XA 3OZCA 2IC5A 1I3MA 4TTSA 3RAJA 5B3LA 2E2WA 2WJIA 1JU9A 2BONA 5B1IA 2E55A 4CM4B 3OLCX 3K0HA 3BE8A 2HN9A 1J9EA 2AC2A 1RE0A 4IIUA 4PEVA 3RUEA 3P0FA 2NG1A 4RGBA 2H4WA 1FDIA 5JD3A 1VTKA 5M04A 1VL8A 1JLLB 2X86A 2FFBA 1CU1A 2R6GA 3SC2B 3PFWO 6REQB 2EF0A 1EHYA 2ZBVA 4P80A 3AUAA 1P0PA 4BWYA 3B1FA 3TCKA 2G4CA 2IZOA 1PWXA 1A4UA 5JCOA 1NXXA 1C3LA 1U2GC 3WS7A 1E2KA 4TROA 3ZWKA 4YTEA 6Q21A 3CVYA 2FSPA 4YX9A 1RVV1 3UW1A 1Z5WA 3I9V1 1EFVA 4CQMB 1AXRA 2R1TA 3ER8A 1T36B 4YRZA 1L5HB 3HY3A 5AM1A 5KYNA 5LQAA 3AEKA 2XYPA 3PUWA 5BYKA 4HS9A 1QC5A 1JEQA 1YC5A 5KDLA 2MSEB 4CJXA 5BWNA 2XVAA 3IRVA 3UPDA 1JQAA 4BQEA 1PEDA 1CUZA 3N3AC 1B00A 3AIMA 3KJNA 4RXMA 3O38A 4HLUC 3S3TA 2FFRA 3SE0A 3UEOA 1PBTA 3VVCA 2C2YA 3VNBA 2VDNB 3HA7A 1KEWA 1QX3A 2VWHA 3ILXA 2RBKA 3JYOA 3UK7A 5BV8A 4G25A 3KVVA 2QRUA 3MOGA 3QUSA 3LO5A 1DRVA 2BT4A 1MOZA 3HYNA 3MCZA 4LNAA 1T1RA 4DSZA 2DBZA 4IS2A 2HRBA 2ASVA 3U3RA 1YB2A 4TWZA 1QKJA 3ZWVA 4CN8A 1A72A 3I6QA 1KVQA 4O2BB 2EG5A 5D87A 3RUAA 1SA0B 3MINB 2WVJA 4DLXA 1WP9A 3TMYA 3U13A 2BGUA 2I4OA 3FVQA 5T3UA 5SY4A 3ZDYB 1RM0A 4UHEA 1DAKA 3HNOA 1N8KA 3BXFA 2YZKA 3CT4A 4P53A 2EZ4A 2F8SA 2MSWA 2X0JA 2W93A 2VJYA 2I2AA 3DB1A 1A69A 1PQPA 2ZFUA 3U3DA 1RMYA 5AT1A 3WKBA 4ER7A 2FZWA 5JBQA 2DGDA 1KJJA 1XRSB 3MBKA 3DVSX 5CGZA 5D6OA 1XTBA 4XJSA 3C3DA 4YB8A 3NIBA 1FW6A 2B69A 3GOHA 3U7QA 4PX9A 4QUDA 2DH5A 1VPLA 4D46A 1QJCA 2C2GA 4NBNA 3D7RA 3Q2OA 1NBMA 1ITZA 1C29B 1PFVA 1WOMA 2E87A 3CLRC 3DGEC 3FI0A 3IVGA 1GPKA 3BSWA 4KZPA 2H5IA 3ZDCA 5TF0A 1QYCA 2YZ2A 1I3NA 5TQ0B 1CUWA 3F6PA 3JYHA 4QSHA 4DB2A 4CLHA 3STWA 1Y8QB 1SVOA 1YA8A 5K8VA 1X1DA 3AZQA 3OD1A 2WU1A 1I3CA 1VPVA 2XMPA 4OJTA 1E0SA 4FGSA 3E81A 5IUKC 2IPLA 1EUDA 1WXDA 2PX0A 2PXCA 4KBGA 2DFDA 1CZRA 1SUBA 1U7DA 1BW9B 2W6QA 4OB7A 4OM8A 2ZRIA 4ZC1A 1CHNA 1ZIDA 3ABIA 1TU4A 3CKKA 1IHOA 1H2RS 4DMHA 4CTKA 221PA 3K30A 3HY4A 2ZRPA 4YRKA 3DEZA 1KYTA 3KYIB 2WIJA 1AHIA 1ZUIA 4HNGA 2W6ZA 1ZXLA 2C1ZA 1U8EA 1U94A 4WCFC 1R7RA 2XHEA 4XZ3A 4WXMA 1BGVA 4E12A 1ZIPA 4R9NA 2CDAA 4AWXA 1A8HA 2D0OB 4Q1FA 3RBAA 4FJ1A 821PA 5KKAA 5IT5A 1HT3A 1F7VA 1XTJA 3H1EA 3H99A 2JFGA 1RBQA 3U19A 3BCSA 1BH2A 4INZA 4PSUA 1KKLA 2OP1A 4KACA 1W35A 4D5GA 1J2UA 3EX7C 3V8VA 3OM1A 1TM5E 3K9GA 1I2AA 4DILA 1U9IA 4HGQA 3LCRA 4N7BA 3WRYA 1NFQA 4DZZA 1B6RA 2Y8EA 4PIVA 1OY1A 4WXYB 3WL8A 1JHMA 2WQ6A 5IDQA 3I73A 2B6NA 1E3WA 2GHIA 2RHMA 3MJTA 4JDPA 2O2IA 2C99A 1R16A 2QTFA 3Q3JB 2ZI5A 3H2ZA 3KFXA 2H4FA 1D4AA 1OLUA 1WDWB 4WTOA 4F6LA 3GLQA 4R51A 1RM4A 1Q16A 1ESMA 3VR0A 5F33A 5KQGA 1Z56C 4YV7A 4MAFA 1RADA 4EKNB 1E63A 2V97A 3R6LA 3KDPA 3T1HB 1Y8RB 3D6AA 2VT7A 4B9EA 2UVDA 3VPXA 1ECGA 1UMCA 1BDIA 2BFCB 5AIBA 1RJDA 2FW0A 3LNCA 4U0KA 4YMUA 2B9VA 4RY8A 4MV7A 1X7HA 3HXQA 1IBRA 4MB6A 4NDNE 2E4WA 4Z49A 3TLJA 5KQLA 1TMYA 2OQRA 3BYZA 1JHYA 3ED1A 5KYYB 3BK1A 2HF2A 7ABPA 4A6XA 1NR7A 2QN2A 3KQKA 2WLTA 3P19A 1LLCA 3P2MA 3E82A 3ZD6A 4ZV4A 2QTHA 2XNDA 1ABBA 1CK4A 1BE1A 3DTVA 4PNZA 2PUEA 2XDWA 2DCMA 3MIZA 2WDZA 2YDYA 1XCGB 2ZUTA 3TOSA 4C08A 5LZ2A 1T15A 2VH1A 4D26A 5CEFA 1Z6AA 5EL0A 4LQ4A 4UTVA 2PGAA 3FCUB 3O4IA 1E3LA 3S70A 5DRYA 4CLRB 2B1QA 4AJOA 1UZAA 4Y7DA 2GJSA 1PZMA 3HYLA 2JD1A 3M9WA 2Y0CA 3HYRA 4OG2A 5ECDA 4B73A 3TECE 2PIDA 1NX9A 3HCFA 1NNSA 2IPOA 3FX2A 5JXWA 2B3TA 2D13A 5FBKA 4UULA 5D3KA 3RABA 3B1ZA 2V7WA 1F5SA 4D0LB 2QR5A 2J07A 3FH0A 4E33A 1VRCA 2VQFB 4MWCA 4UE6A 2XCRB 3FMOB 4Q02A 1X1EA 1OTYA 1JR4A 1J42A 1RKXA 3CBQA 3ZV4A 4KQGA 1MX1A 1YNOA 1F4VA 5SZJA 3CCBA 3PWZA 4Q7EA 3C3WA 1E6WA 4O4LB 1IWBB 1SZPA 3JQCA 5AVYA 1RPNA 1KSGA 4YAUA 2N1MA 5JEDA 3UB3A 4UBMA 4R40A 1I7SB 1JA1A 4ME6A 2ZGVA 4CMEC 1GU1A 3G17A 3S27A 1ONSA 2IBMA 3F8SA 5BN3A 5FTJA 4US2R 4EX7A 1EFVB 3HDJA 1P1CA 1EDOA 4JA0A 2GA8A 3AEKB 3LZDA 1QRRA 3ENQA 1FLDA 1OXBB 2GEKA 3CVWA 4Q1DA 3U26A 2SCUA 2LCIA 1HR0B 5C8YA 3K1AB 4HQLA 1W19A 4ZI5A 3UIEA 5HUHA 3O21A 5KNBD 4TRNA 5DYIA 3DUFB 4AZ3A 1C1DB 4AU1A 2QMZA 1ILEA 1D6SA 3OZTA 1TF5A 5CT4A 4C0XA 4QTYA 2AVDA 3L9WA 4PYJA 2Z5LA 3W3AA 4Z0PA 4HY3A 1QO7A 2P67A 3H9JA 1PEYA 1RXYA 4IIFA 1T35A 3Q0EA 2Z0MA 5EPUA 5KZMB 1JG4A 3CR8A 4BNLA 1ISRA 5EN4A 4KVGA 1GRQA 3VR4D 3FZEA 4KIWA 2Q5LA 3ESCA 1TIBA 3LKBA 3O8DA 5BUZA 5ILOA 3L6BA 4BTLA 2G1KA 2P75A 1L8AA 4DCOA 1FF9A 1S3GA 1Z0ZA 2UYOA 2LBPA 3A05A 4RWEA 4ALKA 1NOJA 1BMFD 1C1YA 4MUYA 5C9ZA 1X19A 1J99A 1E2FA 2EIXA 5T6BA 4EG6A 2CVPA 4I6EA 4KUEA 1EDBA 2FNAA 2R1UA 2CD9A 3OD5A 1JMYA 4KXYA 2VT3A 4OU5A 3PYMA 1N0VC 3DLHA 2AYXA 1I6MA 3LUGA 2E48A 3JARB 1S2MA 1OD6A 2GN4A 3BIJA 3L6UA 1JNXX 1ISGA 4P1ZA 5HDQA 5IBRA 5BVGB 3VQTA 3LK6A 3P9KA 1P91A 2Q1UA 5AUQA 4G97A 2B78A 5EP3A 2FWAA 1YFJA 2EKLA 1YAHA 4EJSC 4G0PA 2OFWA 4AQ7A 2BR3A 5HVNA 5TGTA 2HJGA 2GKGA 1J0BA 5AFSA 1VMIA 2FMTA 4XQGA 4BO8A 1M1XB 1PVVA 1RPZA 2VSNA 4D4GA 4BNIA 1T2UA 1E77A 3R5SA 1IQRA 3H13A 2Q3BA 1CXZA 3PGA1 4C22A 3HVRA 1KA9H 3PGVA 3OTIA 5C7LO 1HM5A 3VZDA 4MS4B 4QUJA 1DCKA 1QZXA 3AONB 3F6YA 3RS3A 1ZK3A 4AJKA 1F4LA 4K6HA 4CLXA 3ETLA 4OOEA 3QY0A 2XQJA 2PZGA 3PXXA 4MUXA 2BGRA 4L6CA 1VI6A 4LNUA 4DRXB 3RYHA 1TU0A 1NSFA 1SBNE 3PCRB 3UAWA 1WZ2A 1SCQA 4O3MA 1GRCA 4JQOA 1DCTA 2BFBB 1U3TA 3X44A 3U3OA 1CR2A 2O8CA 5EGNA 3D7NA 3M33A 4C6HA 5CBPB 3IKLA 4H6PA 2YVKA 5HQ3B 2PGNA 3P9CA 3PRYA 2VHTA 4UE3S 5EE1A 5TV2A 3EB9A 3ICOA 1FNBA 3GROA 4BV8A 3INNA 3ZD7A 1G8PA 2IUSA 1NV8A 2ACEA 3P5SA 3E3OA 1GPMA 4OOFA 3G1WA 2RKOA 3AGPA 1D03A 2Q2WA 4OPMA 4D6PA 2QMQA 3B9BA 3PTZA 1MZPA 1KI2A 3RG2A 5DF1A 4QJ3A 4C7XA 3L7KA 4L8FA 1E66A 3NXSA 4BNDA 1N1GA 4HBGA 1JIUA 1VLLA 5TGDA 2QLBA 4ZC8A 4YRMA 2Q8PA 2PMCA 1PQYA 2C4HA 1J5XA 4PYQA 1NTOA 1P62B 2I7VA 1YCGA 1DAHA 3O2NA 1X1RA 2HSGA 3E3MA 3OJFA 5KQRA 3SD7A 5CITA 1IJFA 4B5LA 2VZLA 3RQIA 4E22A 2C4WA 4E1AA 3TNFA 5IKOA 1EGMB 3QXGA 4BY9E 1TZCA 1P9RA 2QTVB 1K0FA 4G2NA 4UQLA 3MT8A 1YD7A 3PFBA 4N65A 4YALA 2ZZKA 5JHHB 1K98A 1AE1A 1ZIXA 3FMGA 4V24A 3F7TA 4URYR 5CD9A 2VHWA 1SRRA 4BKUA 4URXR 5JNTA 4UUBA 1VDZA 2N1BA 2P90A 4GBMA 2UVPA 4MS3B 3FUWA 4HLNA 4MR9A 4X8OA 5EZYB 5K3OA 4L8WB 4QBHA 3FWYA 4A8TA 1EWKA 1DOZA 4IIBA 1EFRD 2VDOB 3G0DA 5CT9A 4JLPA 3OIWA 2BSQA 2ZSAA 1L8XA 2BKXA 2Z3ZA 2FZKA 1MPTA 2ZEJA 2G7ZA 4GP7A 3RUPA 3U7RA 3VTAA 4W5TA 4F12A 3Q8KA 2EATA 5K6AC 4OLHA 3U9LA 4YJHB 4XSHA 3VKWA 3QVUA 2PKXA 3LCVB 4YV1A 4GGPA 1BE0A 1HT0A 1P39A 1U2GA 1XTIA 2IJGX 1TKBA 2XTJA 4KQIA 4OHRA 5AOVA 3T8YA 5LQDA 1EINA 1CJCA 2FX2A 4BJ5A 5K20A 1L7PA 1VHLA 1EH5A 1JWAB 4Y2UA 5C3MA 4I4IA 2GCNA 3DFKA 4RQUA 3UUGA 1Z39A 4BIIA 5KUTA 3A4LA 5A6SB 1K7CA 4HAWA 4MUGA 5LQCA 1EYZA 5HM8A 5KNCA 1O54A 4FIDA 5EXPA 3Q88A 5EJ5A 1DKOA 4Q16A 3CTMA 1CY4A 1TNDA 2Z43A 1UZLA 5ALWA 2RGXA 3HJHA 5FT9A 4BXOA 4L57A 3OAAA 3K1ZA 4RXTA 2FSIA 3CX3A 4OTZA 3AUSA 2SCUB 3LHIA 2HWWA 4I14A 4B48A 3VVBA 3E7PA 4I66A 5F9FA 5FADA 5FTMA 1K6JA 1UQTA 1SKYE 2G40A 4KFSA 2IOQA 4U2EA 2EARA 2V7BA 2JGFA 3FGZA 3IAHA 1KAOA 4A7PA 1P0QA 2O0LA 3ROGA 3QIVA 1QB8A 3FNGA 5IANA 2NSDA 5BR1A 1C4OA 3ZXSA 4CI9A 1JVNA 1NLYA 1WHTA 2ZT7A 1DP4A 4BJ3A 3CZMA 3EVTA 1CNMA 1VFPA 2FMXA 4UNSA 3ZHXA 1TYDE 1E2HA 2CLHB 6NULA 5A5FA 5JXHA 2CV1A 3IAM6 4IICA 3OE5A 2WSMA 5AJWA 5ILGA 3TQSA 5H3CA 4C7VA 4WLOA 2XDAA 4DDVA 3EC7A 3T0GA 3WYGA 4TKMA 3O75A 3DQQA 2CJWB 2VAPA 4L27A 5JCJD 2R47A 1GQYA 3CEJA 4L95C 1KPIA 1N5LA 3R3ZA 4CLEA 1TVEA 1U2EA 3PXEA 4WK0B 3AEZA 3DEAA 2FQYA 3GY0A 3C1OA 3PKZA 4A36A 1F51E 2R6FA 1ATIA 3T5DA 3GHHA 1GITA 1R0BA 1E94E 3KTAA 1SZCA 1PJCA 3LWDA 4FZJA 4Q05A 2P2CA 3FPEA 1XHFA 3KOWA 3FZGA 5HILA 3QV1A 1WDLA 2HPZA 3SEQA 3TXYA 1ADCA 4OB8A 3UWMA 4BX8A 2HI0A 3C87A 5SY6A 2M6LA 3DYVA 3I9FA 1QE3A 1JFLA 2WE7A 4IKOA 4JB8A 5TJHA 4A2CA 3G9XA 2OFPA 2NYAA 2QVLA 2GK3A 3BFJA 4NE2A 4OM7A 1XKXA 4WKNA 5F1KA 1QHHB 5A7HA 3TJRA 1NXTA 2VZ0A 4L78A 2GA9A 2D4HA 2GBIA 2DHQA 3HDTA 3QVTA 3IE2A 4LPSA 3MCWA 2FMKA 4Q3DA 4UATA 3UGQA 5IDXA 1M1YE 1WUKS 3NTXA 4N03A 4DIMA 1XRPA 3HDQA 3WICA 2Q5EA 1E6LA 2GZ1A 5AOBA 2HT6A 4AJHA 2GVNA 3V4ZA 1XTKA 3AGQA 1FNCA 4HMPA 4Z4CA 1RP1A 2O7RA 4J9UE 4WCFA 2W4QA 1NDUA 1NHGA 1USGA 1IXKA 2QD5A 1IBSA 2LXNA 2QI9F 3Q8WA 4LOAA 4YP1A 3Q6MA 3S0JA 1G8GA 3L41A 3R5TA 1UBHS 1JALA 2VNSA 4E94A 5CDFE 2O2XA 2PXHA 3PD0A 1E89A 2FEWB 4JUAA 4DR4B 5EIXA 3L7DA 3TIXB 3GXBA 1MH1A 1Y80A 4YRCA 2WU8A 3JU3A 1LEHA 1PR6A 2GJKA 3ON5A 4LHZA 3MSXA 4UXHA 1RQRA 5L7YA 4KAFA 4XI9A 3UAYA 2PGIA 4M4SA 3PLAE 2VSYA 3GDWA 2WHQA 4Q3KA 4ZXFA 2ZYDA 3W5BA 3HJUA 1G291 2AF3C 4GQBA 4EPWA 1NPTO 3PC8C 3T99A 4DUGA 5GV8A 1E3IA 1KFEB 5JXJA 4NV1A 3E1GA 3KLOA 5GWXA 2XA2A 1AKVA 3R23A 1RQXA 3R3VA 5B37A 4YREA 3GEEA 3OJXA 4D92A 5K3DA 5K0NA 1R8JA 1PD0A 5ISMA 4Z4GA 3D0QA 2J59A 3QWIA 4ZV9A 3SG0A 1MQ8B 3OZIA 4GT1A 1J2RA 1KYQA 3JQFC 5H9VA 3IV7A 4YPVA 2PZEA 5DISB 3ESAA 3BJIC 4Q4AA 2WHEA 2NO0A 2A5GA 1T8YA 1HMPA 1MC5A 2WJVA 1IH8A 1X7DA 3CO0S 3JWEA 3QP9A 4AJ9A 2BMDA 3MJVA 4K6CA 5K2OA 5B3JC 3OQIB 2Z9DA 4W1PA 3K0KA 3KCQA 2X4DA 2PTGA 1FTWA 6PFKA 3RYFA 2JIZA 5FBVB 3VDQA 1FS4A 2RGAA 1GZDA 1DWPA 5LOVF 4R41A 4YMGA 3QBVA 1P81A 2BFEA 5DN9A 4FTWA 1OH8A 3COJA 1XJ5A 5ENVA 3EY4A 3QKWA 3IOCA 4D82A 4N3CA 3IE0A 3DONA 1H0RA 3ZOZA 3L77A 1JSZA 2EFCB 3PC7A 1BWSA 2PQ0A 3BXXA 3IDFA 4FS8A 1VXRA 3GDOA 1C9EA 3I9JA 5HJEA 1UXJA 3HZRA 3S2FA 3WGOA 1AY0A 4UJ3A 4ENRA 2BOVA 1KJQA 4BFYA 3GGGA 2BTQB 6ADHA 4NKRA 4ENWA 5IF3A 2OHVA 1BDJA 4G84A 3JATB 3M1AA 4U9IS 1P61B 1TYEB 1WIWA 1J0CA 1UFRA 2V7EA 1RYZA 3QLUC 1IC6A 1LFDB 1N6IA 2UUPA 1SG6A 4NZOA 3HP7A 3R09A 1P2UA 5EMNA 4FYPA 5ENZA 3HPQA 5ELLA 4OXIA 2YNMD 1MGPA 3FSEA 3A8TA 1WTAA 1N9ZA 3H8SA 1Y4DE 3ZE8A 3U17A 2X0NA 1IEQA 3BM5A 4Q3BA 5A0FA 5IFLA 3IQFA 5CTAA 1KVTA 3C6MA 1NHWA 1CKEA 4XQCA 1UAAA 3Q1KA 3EPJA 1D2RA 2GN1A 4OJQA 3V97A 4B0PA 3DZ8A 3OE1A 2ZR0A 2CXQA 3LYHA 621PA 1E3TA 1JLKA 1Z7YA 2QTBA 2Z9BA 3FCEA 3THYB 1XUOA 3W0LB 2BCEA 5AW7A 4WKCA 1BA2A 3PD7A 4XIIA 1C7JA 1EE2A 1P2BA 4D4LA 1KEUA 5IAAA 4EITA 2O2EA 3OQNA 4C2UA 3U6BA 2XQFA 3MS2A 3HMKA 1Z17A 1CNFA 2HCJB 2XYQA 3U80A 3D1JA 3I39X 5F73A 2PUFA 4NH0A 5AVKA 2JASA 2BEUA 1HPLA 2P9JA 2ZPAA 3VPSA 1XN4A 3Q8LA 3ROQA 4QX6A 4BP9A 3EYWA 3TM4A 2ORYA 3NZEA 4CLOB 5DGIA 1ZJZA 3DHYA 3IT0A 1N5MA 2CNKA 2GF2A 2ROQA 2P2GA 3OFVA 2QUBA 4TL7A 3VKGA 1IBLB 2KJQA 3MMSA 5HJ2A 3WGNA 3ILYA 1E2DA 4F5EA 2JLZA 2G0NA 4MWEA 3F73A 3GRAA 1E1YA 4DWWA 3FWZA 4L0MA 1L4NA 3ZZMA 2XB2A 5HDBB 4EPTA 1FU7A 1W0KD 2HCBA 2PPLA 3HI6A 4IVQA 5E1MA 1XYGA 5IYZF 1NX6A 5I7RA 1MDBA 1DS6A 1N0UA 2ZJ8A 2G6TA 3LCMA 4WADA 3N8IA 4EZEA 4DM4A 5IZ4A 3OQHA 2J33A 4YONB 3ELYA 4JJGA 3U3KA 1BDMA 4C6SA 5B55A 1JH9A 4WDRA 1GQQA 3VAYA 2P0EA 2II6A 3VMMA 3CGGA 2Z4SA 1AQIA 1LSSA 2WYHA 4J76A 3E4DA 4JP2A 4KTTE 4RDXA 2PKWA 3GLKA 3KWJA 3KZNA 4PZUA 3K8ZA 2L18A 5F7OA 1IY0A 2FQ1A 2YIDA 3KUXA 3Q1LA 4PR3A 4AJIA 4DT1A 4JZYA 4WVFA 5DYNA 2XNKA 5G41A 3ZBPA 3I62A 3CNQS 4I1RA 4GBGA 5I3ZA 4YRNA 3E22B 1ANKA 3ELBA 1XZ8A 2AS0A 4LBWA 3WHIA 4CEHA 1EJ2A 1QRSA 1R37A 2OHGA 4KMOA 1QHSA 3SLRA 4JLJA 2H1OA 2XCUA 5YASA 4ND5A 1JSLA 3MCTA 3WQQA 5A9SA 3UMYA 1GQ2A 3KPVA 3TR5A 3S2YA 4HAUA 1R18A 3C3XA 3L49A 4L28A 4UNNA 4DLLA 5CLLA 2D74A 2OCIA 2H2IA 4RCVA 1STOA 1IUKA 5AVWA 5D3QA 2H59A 3N0RA 4ZOBA 1Z0FA 2FW9A 1GTG1 1E3SA 1CF2O 2QI9C 4FYWA 1GUFA 4DNPA 3NCTA 1BG6A 1GYRA 4PGGA 2PL9A 4IQ0A 3ZHBA 1Y98A 4KNVA 1E5XA 3S2UA 3I4CA 3PD1A 2DXIA 4RX1A 3H1GA 1TQDA 3ONFA 3A9SA 2O23A 3UT5B 1WA5A 4YN3A 2VT6A 2WM3A 2Q8NA 3GAZA 3HB4X 5COBA 2ORIA 5A4JA 3EPHA 2Q1WA 1O57A 1VBNA 4OFXA 2C4KA 3KC2A 4G1BA 2PH7A 1KQOA 1UBKS 2CVZA 2ZJ1A 1KK0A 1N57A 3CF6R 3IAS1 4M0FA 4QELA 4CQMD 5I8ZA 1A9ZA 2WV9A 1DIHA 1XEXB 4AJEA 4RS3A 1FS6A 4FE4A 1UT6A 1NF8A 1QYXA 1Y3BE 2OC4A 1XLWA 1YQWA 3UH1A 3TW0A 4C5BA 4ZK6A 3WLQA 4Y1GA 2JAXA 1GHTA 4PYKA 4I5EA 3TSWA 2G28A 5EHQA 7GPBA 3LP8A 3MAGA 5IN5A 3CLKA 3RYTC 1HFKA 3PQ8A 1AUQA 1MIOB 2RH9B 4WDQA 4PLVA 1E2QA 1TLTA 3UF0A 1ST3A 1G5FA 1VKNA 3IGFA 4FLFA 1H2EA 1JSXA 1TJNA 3QTLA 2WJ6A 2BIFA 3BAZA 5CLQA 1EHIA 1XF9A 2RCYA 4Z86A 3LV8A 1ZIYA 3L7JA 4EA7A 4XYMA 1P17A 3FWKA 2MSDB 1W36B 4Q1BA 2OAQ1 1ZM3A 2ZYVX 4N6GA 2BFNA 1CWUA 2OV1A 4FQ8A 4W1QA 3SGLA 4DR5B 3GR6A 5H4HA 2FQQA 3G7NA 1T34A 4GRAA 4MDFA 1D07A 4CIWA 1E3JA 2OV8A 5C4GB 5DRTA 3T3PB 3HHPA 3U7EB 3TW8B 3WNQA 3R4CA 5DN6D 3RR2A 2V98A 1XZMA 1DQSA 4NONA 1QRAA 3H9UA 2FA9A 4HWPA 2RI6A 3ZJYA 1MJNA 5A0TA 1VPEA 3OTHA 1QUEA 3GNLA 1OYWA 4RZ2A 4UBKA 3RVOA 4P4SB 2P2DA 4R7TA 2E6UX 4DZRA 5EJ6A 5KTKA 2XRZA 2JBHA 1EZ4A 3NC0C 4UW9A 4M1TA 4ZD6A 4C88A 2O2SA 2LGJA 2D0DA 1FXUA 2J48A 3D02A 4II3A 5AK5A 5HW0A 5JNWA 3OJOA 2QN6A 3HBLA 5JRJA 2QY9A 2XGSA 2BJVA 1M2JA 1KJ8A 4FR5A 2IY9A 1QHXA 2JBAB 4MPDA 5A1TA 4GKJB 1DC3A 5GTDA 4PSAA 3QF4A 3GK3A 2ZAGA 5HF9A 4LF6B 3EGVA 4NFHA 3V8RA 1J2JA 3B1VA 2WT8A 3NJ4A 3HJGA 2C0PA 4I9HA 3AM1A 2JGNA 3LIIA 2DWQA 3H1PA 4OLFA 4F9TA 5CFOA 1U2ZA 1W30A 3BWEA 4M89A 1SELA 2HPHA 1MO6A 1F7UA 2H2FA 2E4XA 5IDWA 2I80A 4AY2A 5TB5A 4IINA 3BJRA 5CLHA 1JI0A 4Z5XA 4ER5A 2NMVA 3PHCA 2PN1A 2X1VA 2FSFA 4GKVA 4MKIA 3GLTA 3EIOA 3U7JA 4AJ4A 2OHJA 5BV1A 2MCFA 2HWKA 4ZYUA 3DDWA 3H1BA 3I72A 3IFSA 1LPBB 3A6KA 3NO4A 4HZIA 4Z3DA 4DADA 2ETXA 3BGVA 4NOKA 4ZVSA 3VH2A 4D4JA 2PO5A 2DG2A 5DCWA 5AVTA 3CCCA 5UKDA 4FYMA 1L5YA 2C77A 3HKBB 2X9GA 4JJKA 1Y5LA 2VSFA 3SEZA 1KI6A 2J67A 2ZRLA 3DDSA 5ESWA 2O2GA 4A26A 3U44B 1PJTA 1J9ZA 2OB1A 2CDBA 3IUSA 4CNQA 1CDEA 4EKIA 5JS1A 3I9MA 4FFSA 4Z9YA 5EWJB 4JI5B 4EM6A 3DFIA 3GFFA 4KQMA 4ND6A 3C39A 3RVMA 2BDTA 4DTCA 4MPPA 3SDZA 5BMVF 5M34A 3OIFA 2NP6A 1U28C 2JGAA 4OX9B 3W04A 3SR4A 3BKXA 3M7IA 2W6MA 2RHGB 4GPD1 5GM2A 2RIPA 3VZPA 1RZRD 3UHFA 4TLAA 1AHHA 2QXUA 2G5TA 4BUZA 1P7CA 4ENTA 1O4WA 4IKEA 4EJSB 3G0HA 1FFBA 2EIHA 4MVJM 1KO7A 4RF2A 1H5NA 5D6NA 5BVHA 3NBUA 5CA0F 2OLKA 2ZIVB 3EGDA 1O9BA 4J1SA 2C9YA 2ZOSA 4TSFA 5FV7A 5EEGA 5A5EA 3ESQA 3ICPA 1OFHA 3ROKA 4K0KB 1ZH4A 1QSGA 1OH5A 1BEUB 3CZ4A 2C00A 4LFAB 2GJAA 4Y6GB 1DMSA 1XCPA 2FWRA 4OQFA 4Z7JA 5CYGA 3G85A 3ECCA 3RIXA 1AQJA 1W88B 4N5NA 2FUNB 2V96A 4W1RA 3V48A 5C4IA 4OUDB 2VF2A 4XFDA 3IPYA 1IM5A 4DF3A 2IBTA 1CEQA 4IHJA 5TQ2B 3RUHA 3UYKA 5CJJA 2F3SA 3WMXA 4E5UA 3QVSA 2NP7A 5BSRA 2O8BB 5K2MA 3M4XA 4GS5A 4MPRA 5ITZB 3H5TA 1KFBB 1PO7A 2X2PA 4LIPD 4KXLA 2IF0A 2IOFA 1GPWB 3IBGA 4US1R 1BU5A 1UP4A 3MWEA 4G41A 2WHRA 2ZE6A 3E35A 4IXTA 3TVYA 1QK3A 3DOJA 1PW7A 2RH5A 4R8KA 1SGWA 2X5NA 3O2QB 5JQGB 1NLMA 1RXUA 1JHRA 2Q2OA 2TMDA 2H8GA 3PC8A 1UC5B 3LDFA 3NTUA 4R3NA 5EKDA 1O0CA 3Q5GA 4DN6A 1AH2A 3RD5A 1V41E 5H70A 3ADPA 2X8WA 2R25B 3AUYA 3LCUA 1EEHA 3DVQX 4C5AA 5EKXA 3HRIA 4MW5A 1XTZA 3FF1A 3UT0A 3BGWA 3LPCA 2JIQA 3X3HA 1CERA 3AJ9A 4M37A 9LDBA 4URHA 5I6DA 5I9LA 3FCCA 1J7KA 2BMFA 4DNXA 2NOAA 4DW8A 4JU8A 4Q7MB 2QW0X 1VL1A 2BE9A 1SUIA 2DULA 3H9CA 3JQFA 2WJ4A 4LYJA 4KO2S 4NBWA 1TKCA 3FVTA 5KAMA 3GLGE 4KHPB 1KJNA 4HEJA 2A9VA 3K71B 3KLNA 4L72A 1O7JA 1F9AA 5TMBA 3C14C 2XT0A 3OPYA 3FPHA 3ZHQA 3PQDA 5B3JA 3GQBB 2I6SA 5AK6A 5ALGA 3DKPA 4DPKA 4YPOA 3A6DA 4HJXA 4JITA 5KYVA 3OLQA 1IJBA 4JJZA 2ZB4A 2VZ9A 5BRAA 1H6AA 4IMPA 1UR5A 4NK5A 3TPFA 1Q14A 3GVIA 3TR0A 5C32A 4D8VA 5FL3A 1DIAA 3JRWA 1JZSA 3BXPA 4YRIA 5CLJA 2IIPA 5FEUA 2OO5A 1AXGA 3W5HA 4AF6A 1SU6A 3U4MA 4HADA 3V4OA 4TKVA 1VFNA 5KS2A 16PKA 1JMVA 1XO1A 2DUNA 1P2GA 1NLFA 1YRLA 2RDMA 5KHLB 1QU3A 2BMWA 3NRJA 3VPGA 1ZSVA 4IHKA 2AGVA 3CPHA 3GJ3A 2ESRA 2G4LA 3GT0A 2V54A 3PZRA 3QLUA 1Z7EA 2HBQA 1ZI9A 1BQ3A 1X7ZA 2PUTA 1I3LA 3EDOA 3OCZA 2VJAA 4JT9A 3OX2A 3T7KA 1ZEMA 3WBJA 4C7MA 3LL4A 4BMVA 3KX2A 1A9SA 1F9EA 1SK9A 2BLNA 4R1SA 2HF8A 1JQ5A 1QR6A 1ULAA 3ABSB 3FLEA 1LBQA 3GFGA 4ZJPA 5CDHA 5A0VA 3KKMA 4LI3X 4XD2A 3DHVA 2B61A 2DWCA 4MP6A 4AKGA 5EERA 4EEKA 2ZR9A 2WNSA 4IDDA 1PE0A 2O1WA 1XZBA 4KX3A 4MVCA 1OXSC 3RI3A 4CCAA 4Z2AA 2VNIA 3C8DA 2BGGA 3TTSA 4DBVO 2ZSFA 3K70C 1D0SA 2Q29A 3QEJA 1DI0A 1SVLA 3V4PB 5KYWB 4P33A 4PQRA 2QORA 3SYTA 5DH9A 2AR9A 1MUUA 3D5EA 4PQYA 3PENA 3ZV3A 4DVJA 4NAUA 4Z0TA 3VPFA 1A2KC 4TS3A 1A9XB 1BFUA 1V3VA 2EQ5A 2WWXA 4DIBA 1UM8A 2EBHX 3TIFA 3AF2A 4KGVA 3RTAA 4EJ0A 1ISHA 1G2QA 1GRVA 2I4RA 2WAYA 2MSCB 1PT9A 3EY9A 5AW6A 3ZE2B 3I8XA 1DQPA 2NO5A 3QKIA 3R0QA 1KIMA 2O06A 4R8LA 3EF3A 5CP8A 4D8UA 4K8RB 4MNTA 3UMSA 5KCZA 4JBNA 4M7PA 3RIHA 3GZJA 8GPBA 5DULA 4ATNA 2L0XA 2JDID 3BQNB 5KSPA 3FOEC 1UFOA 3OZUA 2OP0A 1SOAA 3TMKA 1H93A 3K0FB 1USKA 3BT7A 2QTGA 2I4NA 2QM3A 4F45A 4ZHSA 3L0SA 3C24A 4F5YA 1O6CA 5I8WA 4WASA 1N1MA 3U16A 4Y0VA 1OU0A 5B1DA 5A62A 2KQUA 2NZXA 4RK0A 1GCOA 4WXHA 2Q4RA 5EJ2A 1P0FA 2XVMA 3IP5A 1NI4A 4QVKA 1KOLA 3AB8A 3IQDB 3KD3A 3GFVA 2IELA 1ZGGA 3LI2A 2ZTVA 3NNDA 1EFPA 2ZU6A 2EKBA 3NS7A 4R4JA 4RZSA 4DV4B 4NCKA 3ZTWA 4DC1A 4YCBA 1UKYA 1GTMA 2GCPA 1G20B 2Q5QA 3KKPA 3LOUA 2R3SA 4H27A 4TMZA 4Y2YA 1LW6E 1D9ZA 3WZ2A 3IA7A 4D02A 2B2CA 1XJQA 1B0ZA 1PKEA 3ICWA 1ZMBA 1MW9X 4PIPA 1OB5A 1NUQA 2YYAA 1RM5A 1P4AA 3S4YA 3VBCA 3ENWA 4XCQA 3AU9A 3AESA 3UPTA 2I4MA 3NXKA 1VSQA 4WOBA 3M5DA 5TEWA 4JFRA 3PNQA 5EGSA 3B82A 4ISCA 4MW1A 4GXTA 4PCUA 3U4IA 2R751 4UM7A 1U3FA 4CW7A 1T10A 2ZJ5A 5AKIA 2EU8A 3VKUA 2J9ZB 2WZBA 4IV8A 4JLMA 1E9SA 2X22A 3SS9X 2I7DA 1T8WA 4N41A 3S55A 4O0LA 5L40A 1DG3A 5DK4A 3K73O 4CL3A 3AERA 5ALEA 4ZQCB 3SQDA 1DBPA 2NLOA 4B47A 3S81A 1KDTA 1IZ0A 4Y2XA 1PHPA 5D84A 3I2FA 3SMVA 3RRFA 1JJAA 4FQ7A 1XZCA 2VRCA 1SHTX 5FO0A 3LUJA 5ESXA 3WB1A 3CPJB 1OX5A 5SZHB 1GL7A 4KPFC 2W58A 3JD2A 1VL0A 3L0BA 3QE0A 1I30A 4WQMA 3FNIA 2IP2A 1KWGA 1T5IA 1GTL1 3M6IA 2PXAA 3RRBA 5AW1A 2DETA 3K96A 4AN0A 1GPBA 1KJWA 1ZM9A 4UVDA 2YKGA