5ER9A

Structure of oxidized udp-galactopyranose mutase from mycobacterium smegmatis in complex with udp in mixed conformation and closed form
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
394
structure length
394
Chain Sequence
STGNFDLFVVGSGFFGLTIAERAATQLGKRVLVIERRPHIGGNAYSEPEPETGIEVHKYGAHLFHTSNKRVWDYVRQFTDFTGYQHRVFAMHNGQAYQFPMGLGLVSQFFGRYFSPDEARALIAEQASEIDTKDAKNFEEKAISLVGRPLYEAFIKHYTAKQWQTDPKDLPASNITRLPVRYTFDNRYFNDTYEGLPVEGYTKWLENMAADERIEVRLDTDWFDVRDDLRAANPDAPVVYTGPLDRYFDYAEGRLGWRTLDFELEVLETGDFQGTPVMNYNDLDVPYTRIHEFRHFHPERTYPTDKTVIMREYSRFADNDDEPYYPINTEADRAVLAAYRARAKAETASAKVLFGGRLGTYQYLDMHMAIASALSMFDNVLAPHLSEGASLVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural dynamics of UDP-galactopyranose mutase from Mycobacterium smegmatis
rcsb
source organism Mycobacterium smegmatis
molecule tags Isomerase
molecule keywords UDP-galactopyranose mutase
total genus 134
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5er9A01
3B1FA 3IKVA 4CV0A 4XQEA 2C07A 9LDTA 1P44A 3BHIA 1PZHA 2NWQA 1ADCA 3QWFA 5CG2A 1E3IA 5CEJA 2QYSA 3TJRA 3VZPA 1BGVA 3D64A 1NAHA 3NTQA 3RI3A 1XYGA 4PLGA 4PIVA 1EDOA 4OQYA 2VHWA 2VT2A 4GPD1 1R0LA 1HE2A 1RM3A 4HFMA 1SO8A 3ZNNA 4B3JA 1LUAA 3DBVO 4B7CA 1XWFA 1ZNQO 1MV8A 2CY0A 1E1LA 4NNJA 2IE0A 2NVUB 3GT0A 5F1KA 2YYYA 2WMDA 2QHXA 3NV9A 3VTZA 3E48A 4EJ0A 5JO9A 1QLJA 4A5OA 5TLSA 2A9FA 2FHSA 2VTDA 3WDSA 2FRDA 4K6FA 3EDMA 1PS9A 3PVZA 2YDYA 4FDAA 4QECA 4IM7A 3GPDG 2Y1OA 3NJ8A 2X0JA 4OH1A 5GY7A 4R41A 4DTIA 2O3SA 3GY0A 4H3VA 1IPEA 1HYHA 1MA0A 3LQFA 2PKQP 1EEHA 2BH9A 5T8KA 2OO5A 4HWKA 3CIFA 3UCFA 1X7DA 2IZ0A 5DOVA 1RM4A 4IS3A 3MOGA 2PA3A 5L3ZA 3ETGA 4CM4A 3L4BC 3GDFA 3H5NA 1NASA 5IXSA 3DHNA 3S1LA 3H9QA 1R12A 1N7HA 2HUNA 5JE8A 3V2GA 2AEJA 4WEOA 4JBGA 3PPIA 1LLCA 9LDBA 2D3TA 4HBGA 4Y9DA 2OFPA 4B4UA 4CLDA 4CMCA 4UVEA 4BO2A 3S2GA 1DIHA 3JQBA 3Q1LA 1XCBA 3GGGA 1GZ4A 4CMJA 1DAOA 3GUCA 2H9IA 1DC3A 3DZFA 2RIRA 3QVTA 4PCVA 3EAGA 2B35A 2ET6A 4RF4A 4Q39A 2B4RO 2EGHA 4MVJF 4CMAA 1NPDA 5CP8A 1WDLA 4QO8A 1MUUA 1KERA 3E1KA 4PG7A 3L6OO 3DZGA 3LLVA 5HRUA 1DOHA 2OBNA 3KXDA 2XF8A 1PEDA 3L4BA 4B7XA 3PP8A 4AJNA 2DBRA 2O50A 4JIGA 5C5IA 5A4DA 1HDCA 1XA0A 2I66A 4L9RA 5TSDA 3GZNA 4ITUA 2ZQYA 4IDDA 5T6BA 5CDSA 1UP4A 2QZ9A 4ZRNA 2FN7A 3PLNA 4XCVA 4RZHA 2GERA 5MDHA 3NKLA 4IIVA 4MVJE 2HJSA 2QRJA 3D4PA 1VRWA 4DRYA 3BAZA 4XYMA 2JFFA 3I9MA 1C14A 4TZKA 3AU9A 3GOHA 3TZKA 4M54A 1IHYA 1O6ZA 4ZQEA 5A3VA 3DTYA 2AQHA 4B79A 1ZH8A 4OGWA 4ALMA 1UZMA 4BO6A 1LXCA 4E3ZA 3D4OA 5T67A 2IXAA 4RVHA 1FDTA 1U3WA 3UN1A 2Q3EA 1KEUA 3F5SA 3PZRA 2ILTA 2I6TA 2WE8A 1PGNA 4WCFA 1NR7A 4MO2A 1LTHR 4BIIA 1EK5A 2AHRA 1BDBA 2DC1A 3B1JA 1CJCA 3PZBA 3QVSA 1IPFA 5A9TA 3D7LA 5K0ZA 3VC7A 1ONOA 4H15A 1V6AA 4NJMB 4CLOA 1BSVA 5AQ1A 4GGOA 3AM3A 1S7CA 1CQJA 3UAGA 2Q1UA 3CEAA 3FBTA 2WD7A 2P2SA 2CF6A 4FD3A 3DL2A 3F1KA 1HLDA 5CDGA 3DZKA 1YL6A 1E77A 5COBA 2UV8A 4FFOA 4OHUA 3QWIA 1MXHA 3TQHA 3DFUA 2HSDA 1M6HA 3CE6A 4IDCA 1BDMA 2FY8A 3TOZA 1HT0A 5JC1A 3RU7A 2GR9A 2J5QA 4FFNA 4QFDA 2PGDA 1E3WB 1X7GA 3IIEA 1PJBA 2J6IA 3L6EA 4JQCA 3JV7A 1PWXA 2W4QA 3ZWAA 4BO4A 2DUUA 4TKLA 1VSVA 3RBXA 4FQ8A 4BO1A 4HFJA 4KUGA 5B37A 5TT0A 4DIBA 1NYTA 4P8RA 2PZLA 3QHAA 1JKIA 4OYRA 4XEHA 3VHRA 2VOEA 4P4NA 3G49A 3W8DA 3ZWCA 3C1TA 1X14A 2E49A 5IZCC 1FXSA 1T24A 1PU2A 5FF9A 4D0RA 4EUEA 4EITA 4BB5A 4RVDA 5A02A 1LDNA 2BD0A 2IZZA 3GK3A 4ND3A 4CMHA 3WR5A 3GGOA 4BNIA 1PL8A 4PG4A 3COSA 3HDHA 3OEYA 1UZLA 1HE4A 2PR2A 4BMNA 2VTEA 2VT3A 1HF3A 3PHGA 4N54A 1NAIA 4IBOA 3KM0A 2RCYA 5EQFA 1E7MA 3QWAA 5LC1A 1Z6ZA 4XIYA 5TT1A 2NSDA 5EJ2A 2FWMX 4IGEA 2EKLA 4YAEA 1LC0A 1IULA 2NADA 3EVNA 5JC8A 1DAPA 1U5AA 3KBOA 4CM9D 1GTMA 3JD3A 1AXEA 1IUKA 3ASUA 1L1FA 5JSFA 4BO5A 4F3YA 1U2GA 4Q3NA 3KLPX 3GEDA 1MGOA 3ZWMA 5A9RA 4MP8A 1BVRA 3O26A 1U7TA 3QJ5A 1EVJA 2Q2VA 1H5QA 2ZYDA 2EIHA 2EXXA 3JQBC 3MJ4A 5B4UA 4BKPA 3AI1A 4ILKA 4AL4A 3LSYA 4MVJP 2NV6A 2JCVA 1ZFNA 2CUKA 1VL0A 3BMCA 3K92A 3LT2A 4FS3A 3I4CA 1Z7BA 4GWKA 4H16A 4CQLA 1YOVB 2YV3A 4TKMA 5H83A 5I9NA 2R00C 3OM9A 3WGOA 3ZH2A 3FR8A 4TVOA 1ZMOA 1H6AA 2FR0A 4J49A 1Y8QA 5CEFA 4U7WA 1PS0A 2PNFA 4CQLB 1GEGA 1NVTA 1WDKA 1I36A 1BWSA 4ZD6A 1AHIA 1DHRA 1WW8A 1TXGA 3I9JA 3QA9A 4R3WA 5ER9A 3U49A 4RF5A 2A4KA 5ILOA 1XKQA 3HB4X 5AXDA 1ZBQA 1PJTA 4C4OA 1P1RA 4D0SA 3IP1A 4D79A 4ESOA 3WXBA 5DULA 2CDCA 2P5YA 2HRZA 1I5RA 3B20A 3NGXA 3ABIA 4R1SA 4BHTA 3FNHA 1UP7A 4LMPA 2ZYAA 3PHHA 4CM9A 4GWGA 1HYEA 1Q2XA 4AJPA 4J2OA 4WECA 3JD2A 2GCGA 4OL9A 1U7HA 5DF1A 1UXKA 4AFNA 2OZPA 1GYPA 4UVDA 3H2ZA 4NK4A 2WWRA 4IZHA 1ML3A 5A9SA 4U0KA 1QYCA 3MJEA 3QP9A 1NVMB 3T7EA 4FB5A 3MWDB 3JQAB 4YRBA 4J1NA 5BSEA 4DYVA 2AEMA 3L9WA 1H93A 3B1KA 2EV9A 2P5UA 3ZV3A 2RHCA 2HMSA 1Y8RA 2C29D 1C1DA 2VUSA 3BXXA 3ENKA 4ND4A 1QV7A 4GH5A 2WJPA 1ZO8A 4YBZA 4XYLA 5A04A 4NBWA 4R54A 1V3TA 1Q7GA 1NPTO 1YO6A 4DVJA 2HJRA 4BNVA 4Q3CA 5ITVA 3QRWA 3DHYA 1HXHA 1G0OA 5ADHA 4CM5A 2POQX 1WVGA 3WGGA 3FWZA 2UUPA 3N7UA 4XWYA 4FBGA 2IZ1A 2JD1A 1XR3A 3EYWA 4BNZA 4WUVA 2J3KA 3R3SA 2QRLA 1RWBA 2AW5A 3W4JA 4BQPA 5LDHA 2YV1A 1JWBB 4R5HA 2B0JA 1YL5A 4UREA 5KKCA 4CMEC 2X5OA 5BQFA 3DZJA 3FTNA 3FR7A 1BXKA 3HG7A 1NFRA 1J0XO 3EZYA 2YFHA 2I65A 4NIMA 4A0SA 3ZCXA 4BNFA 3V8BA 2FR1A 5BSHA 1GU7A 1NWHA 2X5JO 2E37A 2V6FA 3ZZNA 4YQYA 1YDWA 1UXHA 3STHA 1UJMA 4RLSA 3RVDA 4YWJA 4M89A 5JYDA 5DOZA 2FSSA 1E1MA 3JQ7A 2P9GA 3CXRA 4OSPA 2VOJA 1KEWA 5IZ4A 1L7DA 5TX7A 4DC0A 3ZNQA 3ZN2A 3W6UA 4CM8B 3DEYX 3DBRA 5TGDA 5C7LO 3A4VA 3HZZA 5IAAA 4PLPA 5TNXA 2AE2A 1Z74A 2BKAA 3LF2A 2CDAA 4D45A 4DQUA 1W4ZA 2NACA 4WCFC 3ZWPA 2NLOA 2X4GA 4JLWA 1SBYA 4EJ6A 4BNTA 3R6DA 4YDRA 3JD4A 4JJIA 5BNFA 1J49A 1JDJA 4PG6A 4PZEA 1R66A 1T2FA 2OL4A 5U1PA 3VKVA 4B4VA 1YQXA 5HBRA 1JWAB 2ZB3A 3DQPA 1X0VA 3GVCA 4BO3A 4CMIB 4WLUA 1KVTA 4W82A 2D4AA 2DPHA 2HK9A 3PJFA 1DDOA 2FPGA 2G0TA 4O59O 2BI8A 2VZ8A 3GMSA 4DPMA 2GGSA 7ADHA 1SB9A 1H94A 1VSUA 4NPCA 3NAQA 4UUPA 5JDIA 1ZXLA 3IQDB 1XEAA 3OIGA 4GQAA 3FNGA 1V8BA 1TT7A 1HL3A 1XQ6A 3CTMA 1J5PA 2EF1A 2P9CA 3PRJA 1Z45A 1Y81A 2D2IA 4G5HA 4XRGA 4JP2A 1GFSA 1QRRA 4IY1A 4OKNA 2HMTA 1PJ3A 4PRLA 3GEMA 1YQDA 2VNSA 1I2ZA 1E7RA 1EZ4A 1U8XX 3F46A 1E3WA 4R68A 4U5QA 5I7FA 3WS7A 1FDUA 2LDBA 4J3FA 5I8WA 3GVHA 1YB4A 4RVFA 1WDMA 2V6MA 5U4QA 4DMMA 5TIIA 1NTOA 2ZTLA 2GN9A 2HMWA 3ST7A 1ZKMA 5BSFA 4O5OA 1GUFA 1M6WA 5F1OA 1GEEA 3S55A 2Q1WA 2CNBA 2X23A 3I1JA 3DBHB 3NDIA 5BSGA 3JQ8B 2W2LA 4ZQHA 1BTOA 4R16A 4BOYA 2AXQA 4OJNA 2HCTA 2JAPA 3UUWA 2Q4BA 1MG5A 2A92A 2GN4A 3OJFA 2AQIA 4YAGA 4K26A 3ENNA 5C7OO 4E5YA 2HK8A 2XOXA 1MC4A 4PLCA 3BIOA 3RCBA 3JQ6A 3FNFA 3ONDA 4ND5A 1DB3A 1SPXA 3AFNA 3KSZO 1K0UA 1R16A 4YVFA 2W2KA 3JQ9C 4E32A 3DAFA 3G3EA 3GMDA 3RAJA 3KZVA 1B26A 2F00A 4C7JA 4RORA 1TA4A 4CL3A 4DGSA 2HAEA 1AHHA 4PZCA 3JQFA 2DUWA 3DBLA 4YEDA 4FFPA 1HZJA 4FOSA 2QYTA 4LMRA 1V3VA 1SZJG 3WFIA 2BFMA 1Y8RB 1QYDA 3OQ6A 1YQGA 4FFLA 4JBHA 2NQTA 4CV1A 4PG5A 1WMAA 4NBRA 3K5PA 2IRWA 2PZJA 3WGYA 1NHWA 2VZ0A 5CDTA 2BFAA 4JXKA 3RUFA 3EW7A 3A06A 3AOEC 2BFOA 3EMKA 3VZQA 4J1QA 5FI5A 4BNNA 2ZCUA 2WTBA 2ZB7A 2Y1EA 3WGIA 1QP8A 1QSGA 3RUIA 2Q4EA 3ROKA 3M1LA 4YXFA 1EQ2A 3ROMA 3DWFA 5JMPA 4QO7A 4I1IA 3ZU3A 4FW8A 4D42A 1EBUA 3WQRA 1D8AA 1FK8A 4P4LA 1PQPA 4O63O 5CDYA 1ISMA 1ZSNA 3GN2A 5GMOA 2DU8A 3MCVA 4MINA 5L4SA 4DQXA 3DR3A 3WLFA 2Y1FA 4MP6A 2C5EA 5L45A 4G81A 1WP4A 1B7GO 2Y0CA 4XYBA 1E92A 2D0IA 4HKTA 3D3EA 1V0JA 4ZA2A 2PH3A 4Q3AA 5IN5A 4R1NA 3RFTA 2QX7A 4YA6A 2X0RA 3TZ6A 4RZIA 2X5KO 1HWYA 4XD2A 2AA3A 4AVYA 1JN0A 3R3JA 4XGNA 2FZEA 3I5MA 4QSMA 1BXZA 4JJGA 4NK5A 1QYWA 2O2YA 1P31A 5JCJA 2XXJA 1YE3A 1T1RA 1UZNA 4J7UA 2PV7A 1SOWA 3RD5A 4HX5A 2GO1A 3K73O 1SAYA 3K96A 3M1AA 3RC9A 2NVUA 1Y9EA 1G1AA 1CETA 2O23A 1T2CA 4R3NA 3IS3A 3PXXA 2YUTA 4W9NC 4B8ZA 2QRKA 3ZWNA 1PR9A 5CDUA 1GCOA 1HETA 4MKZA 3NT4A 2JCYA 3VZRA 3TFOA 3PHJA 1KC1A 4IDAA 3E5RA 1T2EA 3TL2A 1OZAA 2NU6A 3ZWXA 4AJJA 2J5RA 1A9ZA 2IYOA 1MP0A 3GRKA 2JD0A 4WKGA 2IODA 2HMUA 4BNXA 1U8FO 3KSDO 1DHTA 3U9LA 3FTPA 5CFZA 3IC5A 2AG8A 4KQWA 3FN4A 4ZU3A 3WGHA 5KVCA 5AXBA 4NFHA 3ZDFA 4CM7A 4YTEA 1VL6A 3AI3A 4K1LA 2R6JA 4RVUA 4FSHA 1ID1A 1HSOA 3GAZA 4ALJA 5DBGA 4NHEA 2DFVA 3UW3A 3D3WA 1P1HA 5JCJD 4IQGA 1CDOA 4AJ2A 1UDAA 1TLTA 4LGVA 4ND1A 1PJ2A 1VLLA 4E21A 3H3JA 5JMWA 3ETDA 3EHEA 4DIOA 1JLLA 3I9KA 4MJLA 1NBOA 1B2LA 1P3DA 3A1NA 4NU5A 1FDVA 3GN1A 1YRLA 4GSLA 4YRAA 1U2DA 3DO5A 3DMTC 3ZW8A 3ZWVA 3H8VA 2RH8A 4HNHA 4D43A 4J7XA 1NHGA 2CSUA 4WOKA 3ZWBA 3ICPA 4QX6A 4XZ3A 5JAZA 2WYVA 4W6ZA 5L9AA 1D1SA 3AFMA 5COQA 1EE9A 3JQCA 2P91A 4YJHA 1X13A 3OJOA 4BNGA 2GZ1A 2WSBA 1NP3A 1BW9A 3WNQA 2WM3A 1E7WA 3WSVA 4UUNA 1Q0QA 3SLKA 2PZKA 4PLZA 3GH3A 1SEPA 3ZGYA 6ADHA 5DNAA 1I3NA 1OOEA 3PDUA 3FI9A 4CR7A 1CIVA 1E7YA 3WJAA 4GVXA 4QQRA 3P19A 1ZZEA 3BMOB 3L07A 4PGFA 3Q9NA 1K6IA 1PQWA 1BG6A 3C8MA 1AE1A 2VYVA 1U3UA 3HDQA 5F1PA 4EBFA 4CLHA 4NZ9A 1VI2A 4TRRA 3RKUA 3C7DB 2Q1TA 2H5LA 2CVQA 3KEOA 2P9EA 4BO8A 1DRVA 4L4XA 1YOVA 4IMRA 3OEWA 4N5LA 1HKUA 4FFMA 1JU9A 1PZEA 3DBHA 1P0FA 3VPFA 4D41A 1T25A 3RROA 3RSHA 2OP1A 3QE3A 4IINA 4XQGA 3UOGA 1OI7A 3ZU5A 4AJLA 3SEFA 1YJ8A 3RJ5A 3PQEA 3DOCA 5TQVA 4D3FA 2D8AA 3PJGA 4N7RA 3PGJA 4L74A 1G0NA 3ORFA 1NQ5A 3WB9A 3WMWA 2FPPA 4TMFA 3AOEA 3R0IA 3C24A 3JQ8A 1LDBA 3INTA 3DONA 2X58A 4O1MA 4Y8VA 4GLLA 2CDBA 1T4BA 1HDOA 4BGUA 1PL6A 4OOFA 1KVQA 2EJWA 2G82A 4CJXA 4CLRA 3TNLA 4WLFA 3O03A 1V9LA 4EDFA 2VUTA 2O2SA 5KIAA 4RVGA 2E6UX 5JY1A 4E4YA 1XU9A 1YJQA 1Z7EA 1WWKA 5IXYA 1KEPA 1T2AA 1YS4A 4AJEA 4XRRA 4EW6A 1KC3A 2JJYA 3QQPA 1SMKA 4A27A 4ZVVA 3C3XA 3BHMA 5TJ9A 4J4HA 2YFQA 4WPGA 4W7HA 2DT5A 2Q46A 1E3JA 3I3OA 3I9LA 3BHJA 3NGLA 3RKRA 1XHLA 4YT8A 1I2BA 2NUAA 3E6AA 3VDRA 5I9LA 3EGOA 4LISA 4XIJA 3NYWA 2OOSA 4P4GA 1I01A 4NFYA 2DLDA 5EMHA 3QSGA 1K2WA 1M75A 2QZZA 1R15A 1U4OA 4URFA 1ENZA 1UAGA 2X1HA 3OQ1A 1I32A 5G4KA 3K8ZA 1DJQA 3ZV4A 4XA8A 1EFKA 4Y98A 1F8FA 1ARZA 3IOYA 5AVOA 4INAA 3IDSA 1PJ4A 1UH5A 3PTZA 3PWZA 4MIOA 2FP4A 1P1JA 4NBVA 1FDSA 4MVJG 4KQXA 2X0IA 2I3GA 4FC6A 3VPHA 3QLJA 2PD6A 4YQZA 4CL8A 3K2BA 1PGJA 3VOSA 2VQ3A 2HU2A 1UXIA 2WD7B 1HE5A 2UUOA 3F4BA 1ZK3A 4WGGA 3HFGA 3WICA 2P68A 1J6UA 4LRTB 2VWGA 4YT4A 1Y5MA 1H9AA 1BXGA 5G0SA 3DFZA 1VM6A 1DEHA 3BTVA 4A2CA 4MVJI 3JQDA 3W8FA 4W7IA 5KKAA 3LZ6A 3VH3A 1ISIA 5G0UA 5TC4A 4CR8A 3C1AA 4OIMA 4OM8A 4QXMA 3S2EA 1DLJA 1O94A 3K9QO 2ZB4A 1K6XA 1KY5A 1RJWA 2NVWA 4J9VA 4PLYA 5HS4A 1OMOA 3BMQA 4PLHA 2G17A 4BO7A 1R37A 1P77A 3TZQA 2VN8A 2JKVA 1NX6A 4RDHA 3ZNPA 1MLDA 1CF2O 2GYYA 4NJOA 1U3TA 3GC6A 3IKTA 4XX0A 2W2KB 4ALKA 5ES3A 4E2YA 5L95A 5IDXA 4I5FA 1QKIA 4QFCA 2O3QA 5L7WA 2V6GA 1QORA 2EKQA 4XKJA 3VPGA 2P4HX 2R00A 1OC4A 3HE3A 3M6IA 2GASA 3I23A 3PFFA 1B15A 4PLTA 3WGZA 3F3SA 1P74A 1LLQA 4MDHA 1A72A 3H2SA 4DUPA 3E9NA 2OXIA 1GCUA 1C0KA 3ZWOA 2Q1SA 1BW9B 3OICA 4CMGA 5A9SB 2Y1GA 2GZ2A 3I6IA 3SLGA 4TRNA 1K3TA 3D5TA 3GUYA 5DCUA 5LDGA 5TRTA 1LDGA 2VYND 3DZIA 2ZIZA 2C0CA 2Q2QA 4F6LA 2W2LD 5L7YA 3U09A 3V1YA 3ULKA 1LDYA 1GV0A 1LJ8A 1DFHA 4BV8A 1ZSYA 1KEVA 4RPGA 4TROA 4EYEA 4KMSA 1PJCA 5HA5A 1ORRA 1GZ6A 3VDQA 3MJSA 2Y1CA 4Z0PA 4PVCA 2PWZA 4MPDA 1E7QA 1DC4A 1C3VA 4FFRA 3N58A 3SC6A 1ZJYA 2VHZA 2RBEA 2DBZA 4BKOA 4F45A 2BRUA 1GR0A 4WNCA 3GLQA 3O8QA 1FJHA 1VE9A 3DOOA 3P2YA 1I8TA 2AEFA 4KWHA 2I99A 1E5LA 1O9BA 1E6WA 4Q3EA 2ZTUA 5EIOA 1E6UA 2DM6A 5JAQA 4GMGA 4RPHA 3ZWWA 1F17A 2F1KA 3BMCB 4AG3A 1LBEA 2NU8A 1ZXBA 3HSKA 4CLEA 4RPKA 3LC1O 4D3DA 3JSAA 4ID9A 3GEGA 3ZI0A 4ZHSA 1RYEA 3FCOA 2X9GA 1AUPA 3PYMA 2D5CA 3TZHA 3NX4A 1MB4A 3GVIA 1R4MB 2CVOA 3RASA 1D7OA 4JP3A 3VH1A 2JHGA 3CMCO 5IN4A 3CZMA 5KJEA 2Q45A 3JYOA 4WEQA 3TPCA 3WTCA 1IOLA 1ULUA 3OMLA 4DL9A 5A5FA 3ZHYA 1VJTA 1AGNA 4XQCA 1B14A 1ADFA 3JQ7B 4MOWA 3NJ4A 4PG8A 3E8XA 1I3MA 1FF9A 1XIVA 1Y5RA 4PVDA 2YHIA 3WYCA 2O3RA 3UH1A 4IQ8A 1H2BA 1E1KA 1VJ0A 3DTTA 1Q7CA 1ZSVA 3AM5A 2GLXA 3EC7A 2PZMA 4BMSA 1FMCA 1U9JA 3Q0EA 1PJSA 2HRBA 3I6QA 2HDHA 1K89A 1WNTA 3K2EA 1B16A 3OP4A 1D1TA 3HJAA 3PYLA 4HADA 5F5NA 5CG1A 3P7MA 1ZCJA 2C82A 1NQTA 1O8CA 4A10A 2FSVA 2W98A 2Y66A 3B70A 2B69A 4FOOA 3JD0A 4OSOA 5I9MA 4MP3A 3E03A 1NVGA 3RBZA 1HEUA 1CRWG 1ZUD1 4BVAA 1HYGA 4I8XA 4WLOA 4R51A 1VKNA 2Y0DA 3ITDA 3KB6A 2B37A 3SC4A 2FPIA 1HSZA 3LC2O 4GX2A 2NTVA 2G5CA 4LSMA 1KY4A 2VWQA 5C7IO 3E9MA 5TJHA 4G2NA 1LRLA 3HADA 3OF2A 5KJ6A 4AJIA 3SX2A 4FJ1A 3WJ7A 1YXMA 3JYPA 3SXPA 1QG6A 4GI2A 2IEDA 3PI7A 1UXJA 6LDHA 4BKUA 1Q0LA 4TQGA 4XDZA 4B8WA 3L9XA 3NRCA 5EQDA 2BF7A 2H6EA 3TFQA 1EVZA 4S1VA 2B5WA 2TMDA 2ZATA 1DIAA 1EE2A 4L0QA 4M87A 1GDHA 1BRMA 4XB2A 5DZSA 5K6AA 4YJFB 4LW8A 1YL7A 5HWSA 3D0OA 3UCXA 4MKRA 4R1TA 2Y0EA 3UFXA 4ALIA 4DBVO 4FC7A 5BNTA 3JQAD 3L4SO 3MOIA 3RUHA 1DSSG 4I5DA 4ZQGA 3WGQA 2AG5A 1P9LA 1EUDA 4BNJA 4XDYA 3GGPA 5ICMA 2D1YA 3EY4A 5KJFA 3PGXA 3PIIA 4WNIA 4JN6B 5ENDA 1EDZA 4L4SA 4MVJM 4KDFA 3TDKA 1T26A 5CPBA 3W6ZA 3QIVA 4R69A 4YCAA 3AY7A 3INGA 4NFSA 2B36A 2EP5A 1H2HA 4BO0A 2I76A 4R5MA 1PTJA 4I5GA 4CPDA 4Z9XA 3EK2A 2GZ3A 4BO9A 5JDIC 4YACA 5JFOA 2YQ4A 3LLSA 1I0ZA 1PZGA 3WGTA 1Z82A 1EQUA 1TI7A 3TSCA 5JW6A 3GFBA 2DPGA 4EEZA 3ETEA 4J4BA 3H9GA 5KVVA 2VYVD 3RU9A 3KV3O 4CQMA 3I83A 3ZU2A 2PKQO 4EUFA 1ISFA 3RIHA 2GF2A 2C7GA 3RBVA 3F1LA 1IYZA 4ZGWA 1H0KA 2GN6A 3OIDA 3UICA 1NPYA 5IDQA 2YZ7A 3NTRA 2YY7A 1EK6A 3HFSA 3FD8A 3Q2KA 3OJLA 3AW9A 3KO8A 1ENPA 1X15A 3OH8A 4A26A 1DO8A 4L8VA 4RO0A 4E31A 1Z75A 3IJPA 1EMDA 4DYDA 3G1UA 1UR5A 4U6QA 3FBGA 4XYEA 3GQVA 4MVJD 2Y05A 1JA9A 1U3VA 2UAGA 3I4FA 3I9NA 4IXTA 3QW2A 4UVIA 4FPXA 1DLIA 2E48A 3CKYA 4FN4A 1LA2A 1SB8A 3RQSA 4DLBA 1M66A 2J3HA 4JROA 4CV3A 4BKQA 1KYQA 4QEDA 3VTFA 5KOIA 3UF0A 1LDMA 4IJWA 1HTBA 3WG9A 3KSUA 4YAJA 2RHRA 2X9VA 3GF4A 1RPNA 4ZICA 4WLVA 5I8ZA 4OQZA 3RUAA 2V65A 1ZW1A 2GUGA 5K9ZA 4GGPA 1YB1A 3GRPA 3PQDA 5DCWA 3GG9A 1PGPA 1UXGA 4D7AA 1N9GA 1JVSA 3EZLA 5GZ6A 4GSKA 3ITKA 2BI7A 1HRDA 3U4DA 3JQ9A 2Y99A 4G65A 3V1UA 5FI3A 3DDNA 3AOGA 5JO0A 5G0VA 1IE3A 3FRJA 5AYVA 3V2UA 1NNUA 4J0FA 5A3JA 4XR9A 1C1XA 4ALLA 4DPLA 1ZMTA 2NU7A 1D3AA 4LVCA 4BNKA 1H6BA 1RKXA 4IDGA 4TZTA 4ZJUA 2PLAA 2OP0A 5JXWA 1DC5A 2GRAA 5DCYA 2BGLA 3DZHA 1G6KA 1WAMA 1LQTA 3DMTA 5L53A 1HDRA 1QV6A 3ANMA 1SOVA 2J3JA 1PGQA 4E2ZA 2PH5A 2X86A 3AUTA 2AMFA 4IDBA 3F6YA 3WTBA 2NQ8A 4CM4B 2VNAA 2LDXA 3MTGA 4DBZA 4W4TA 2YJZA 5I7SA 3LVFO 4TVBA 5L7TA 4UEJA 1YVEI 1QXSA 3JCZA 3RC7A 3GHHA 3KOUA 3N74A 2VYNA 4MKXA 3WYEA 1ZK1A 5JAMA 5HS6A 4BB6A 3G1TA 2YQ5A 2X0NA 4FJ0A 4TRJA 3KLMX 5HTOA 2YDXA 1LSUA 4JBIA 3DZBA 2HKIA 4WOJA 3BYZA 1WPQA 3BMOA 3MTJA 5ICSA 4QTZA 3BTUA 4WLNA 5THQA 1E3EA 1O5IA 3G17A 3LU1A 4II2A 4E0BA 3OJ0A 4YJGA 4KTTE 3H65A 2NTJA 3BMNB 1T2DA 1XGKA 1KS9A 1E0DA 5GZ3A 2Z95A 1YGYA 4GKVA 1R4MA 4BNWA 2W8ZA 2EERA 4KP7A 4LCJA 1WZEA 3FNEA 4A03A 2H63A 4A73A 2BHLA 2PGLA 3ZWYA 4L4RA 2ZCVA 4GX0A 4N5NA 5G0WA 4MVJA 4Z9FA 5B4VA 5G0TA 4IQ0A 5BR7A 4EI2A 1PJQA 5JYEA 2FZWA 1YONA 1MC5A 3IP3A 1ZVMA 4E5MA 2GPTA 4W9NA 1LI4A 4DIFA 1L7EA 4BGEA 3TL3A 1PR3A 1M76A 1K6JA 3WMXA 4OXYA 3WQQA 2E4AA 3QWHA 4QUKA 2XAAA 4N5MA 4Y6PA 3JQGB 1CQIA 4UUMA 2DKNA 4J90A 4YJHB 1LRKA 4I9HA 1YWGO 1Q1NA 4YT2A 5I7EA 1I10A 1JVBA 3IJRA 5DN9A 1HDYA 2ZB8A 1DXYA 3Q9UA 3ZV5A 3GG2A 1SC6A 2A94A 4RCVA 3WYBA 1T4DA 1U1IA 1JKJA 4B4WA 2DTDA 1I24A 3CH6A 1I3LA 4E5NA 3PFWO 4Q9NA 2PTGA 4RVSA 1LDEA 1GQQA 4KTVE 4ZQBA 2ZTMA 3TF5A 3PHLA 3INRA 5A03A 3GNSA 3HHPA 5EINA 3TOXA 5EL0A 3ON5A 2JHFA 1E5QA 1I3KA 4GMFA 4KDEA 3OJEA 4OMUA 4BNMA 1LSOA 3WLEA 2DTXA 1E3SA 1CEQA 2I5PO 5B12A 3KEQA 3PK0A 4Y67A 3U4CA 5DBFA 5EESA 3SJ7A 4DLAA 3GHYA 1CYDA 4LN1A 4M49A 1A5ZA 3FSRA 1GV1A 1DJNA 3D5QA 4GAEA 4J1SA 3QVXA 5ER6A 2J8ZA 1X1TA 4GX1A 5KNLA 4CMKA 1WXDA 3JQEA 4JCOA 4BV9A 3FHLA 4NR0A 2VWHA 1ZEMA 4PRKA 4DQVA 1DC6A 3FPCA 2ZTVA 4NG5A 3VVCA 2ZKLA 3DBRB 4D3SA 3X2FA 1HE3A 4ZRMA 2EKPA 1QMGA 1OC2A 4TWRA 3KVOA 1PWZA 1E3LA 4WJZA 3TWOA 4OKIA 1N2SA 3LT0A 4N18A 3WIEA 3WNVA 4AJKA 3B6ZA 1NQAO 1ONNA 2Z1NA 4GBJA 2C2YA 4EGFA 2UVDA 4I5EA 3WBBA 4BGVA 1V35A 1GZ3A 1ZK4A 4B4OA 1PSDA 2IYPA 3ADOA 3EVTA 3RC2A 2DBQA 1IHXA 2HK7A 1C0PA 5LCXA 2CZCA 2J5KA 4GKBA 4EUHA 5L4NA 3GR6A 3HQ4O 4F46A 4B3IA 1I33A 3WX0A 4CMBA 1X1EA 1S6YA 1ZIDA 2Q99A 3QVWA 1C1XB 1X0XA 4FR5A 2FR8A 3JYNA 3PIDA 3T7CA 2GDZA 4AJHA 1DBVO 3K30A 1A9YA 1HZZA 2O3UA 4AJ4A 3D4NA 4BNUA 1U4SA 3ZHXA 4J7CA 4O0LA 1P1FA 2G76A 4TRMA 2JFHA 3NTOA 4EZBA 1N1EA 1F8GA 2Z1MA 3KTDA 5CPFA 2PK3A 4BNLA 2YW9A 4L76A 1NWCA 5KJCA 4RV9A 1B8UA 3P2OA 2X7HA 5JBIA 4RQUA 3AK4A 3IL2A 3AU8A 3AJRA 3K31A 3ADPA 1OBFO 2B4QA 3UKOA 2DQ4A 1ISHA 2CFCA 2C2XA 5IFLA 3RJ9A 1RYDA 4DXHA 2ZYGA 5J23A 4U8GA 4CM8A 3LK7A 1KVRA 4CQMD 4JGBA 4LK3A 3LDHA 1P0CA 2VWPA 1LC3A 2EW2A 3IMFA 4DA9A 4KZPA 3BTSA 1XLTA 3ZV6A 1NM5A 7MDHA 5KJ1A 3I52A 4K9DA 2YHIB 3DAGA 3JQAA 4NU6A 2VHYA 3FF4A 4J0EA 4KUEA 5TF4A 4NJMA 2UDPA 1DIGA 3GZ4A 3NUGA 4H7PA 3RUDA 3MJTA 1WMBA 2EW8A 1B0AA 5DDIP 2FOIA 4K28A 1U28A 1U5CA 4B3HA 4CLRB 3U3XA 4LCEA 1A7KA 5AXCA 3OA0A 2CD9A 4EJMA 4M55A 3LT1A 3UGKA 1JAXA 5G4LA 3GVPA 2UYYA 4WE3A 2NU9A 1H6CA 2GD1O 4IJUA 1EVYA 3KYDB 3KYCA 4YR9A 4DC1A 1F0YA 3MZ0A 1JW9B 4L73A 3QY9A 3VZSA 2QG4A 2VCYA 4DPKA 1ULSA 1GADO 3OBBA 1PZFA 5A06A 3PEFA 1EFLA 3GA0A 3H5AA 3WSWA 2I3AA 4CUKA 3W4IA 3RUEA 3LT4A 3CINA 2P4QA 3EUWA 1Q7BA 4I9UA 4Z3KA 3G79A 4ZN6A 4XGIA 2Z5LA 4HFNA 4M86A 3GNTA 3GZNB 1BHSA 1R4NA 3NT5A 3M2TA 1GUYA 2BMAA 3V1TC 3V2HA 1M2WA 4XQ9A 3WQSB 2QW8A 5H81A 3HWRA 4RLHA 1LSSA 3ANNA 1DPGA 4HUJA 1WZIA 2VUUA 1UDBA 4JNKA 3Q6IA 4UEOA 4AJOA 4OXNA 1R0KA 3AY6A 5T5QA 1GY8A 5T64A 1P33A 1QR6A 1TT5A 3ZHZA 1IL0A 3WWYA 5KVSA 1P1IA 3GDGA 1DRUA 3NDRA 3O38A 2H1SA 1W8DA 4Z0HO 3GAFA 4I9NA 2BFPA 2EJVA 4M1QA 2O4CA 3NDJA 3IUPA 3G0OA 3ONEA 3ROQA 2IXBA 1B8PA 2B5VA 2PFGA 4K6CA 3DC2A 4XGKA 4GVLA 2IDZA 3MEQA 3CPSA 4CMEA 3QWBA 4II3A 1MXFA 4KWIA 5H82A 1O0SA 4GL4A 3WIDA 3OIFA 3VPXA 3K6JA 3VKUA 2O7SA 3F47A 4YB8A 1A71A 1YB5A 3PWSA 1DIRA 1N1GA 5DP1A 3HN2A 3P5SA 4E33A 1SCUA 1ADBA 1Y7TA 1C0LA 2DTEA 1LRJA 4ROSA 4Q3DA 3DB2A 3WWZA 2DAPA 4IZIA 1V3UA 2VZ9A 3OECA 4FGSA 4M8SA 1E7SA 2BLLA 3WOHA 4CM3A 1F12A 1Q0HA 3E82A 5KVQA 1OAAA 3CUKA 4B7UA 3MJVA 5ITWA 3KETA 3TZCA 2AQKA 3C7CB 4PLWA 3O4RA 3R1IA 1KVUA 4P22A 1DRWA 3HDJA 2C20A 1BXGB 2GSDA 1IY8A 3MWEB 1KOLA 2RAFA 3SVTA 5AOVA 2PD4A 3LF1A 3IAHA 4RF3A 3OSUA 4FCCA 2X8LA 4AJ1A 1D4FA 3E5MA 1TEHA 4E30A 4HFRA 5JAIA 1DFGA 4J6FA 2C59A 4UVGA 1ZK2A 4IMPA 2C54A 4A7PA 3AWDA 3C85A 3U62A 3TRIA 4BNYA 5K6AC 3JD1A 3RFXA 4UVHA 3AI2A 4BQRA 4HP8A 4E6PA 2O3TA 3Q3CA 2X22A 3PWKA 2JAHA 3UCEA 3VPSA 1ZK0A 5EN4A 5FEUA 1VPDA 3RFVA 3AY3A 1OFGA 5TS3A 2PD3A 4FIZA 2Y68A 1JTVA 3Q2IA 4KUHA 1YBVA 4E5PA 2PY6A 1QYXA 2V7PA 1JKFA 1BVUA 1VL8A 4BMVA 1PGOA 3F9IA 3SBOA 4BS9A 1MFZA 3AM4A 1A4IA 1EVIA 5JCXA 2O48X 1W0CA 2O7QA 4E12A 4LSWA 4E2XA 1QYVA 3VH4A 4PN3A 3ROPA 4YT5A 2X6TA 4RGBA 4CR6A 1UUFA 3ONFA 5BT9A 2V6BA 1MFPA 4HY3A 4UULA 3ZHBA 4BL5A 5IZCA 1XU7A 2BGMA 4E5KA 1RM0A 4RJTA 4RPLA 1F14A 1TVEA 1O95A 3U4IA 5G2OA 1B3BA 4FJ2A 1I30A 1LQUA 3ICCA 5L40A 1PQUA 4XR4A 2OORA 3S8MA 2WYWA 5F21A 1YKFA 2J3IA 5EERA 1BMDA 4J9UE 4ONEA 4C7KA 3QV1A 2VRBA 2JD2A 1Y6JA 1H6DA 2VRCD 4Q3BA 5IDWA 1NR1A 3FWNA 4Z6KA 1ZEJA 5L4LA 4NH4A 4XJTA 5CEEA 2SCUA 2Q49A 5IJZA 3H9UA 2I67A 4NQZA 2GNAA 1F06A 1N5DA 1E1NA 2YV2A 3HN7A 5KCZA 2JFGA 4Z3DA 2C5AA 3OQBA 5CAEA 3HDYA 1XSEA 4J4TA 1UAYA 4IPTA 3D3WB 3IUSA 3AUSA 5DBIA 3HUDA 3C7AA 2B83A 3UHAA 4U0JA 5GZ1A 1KETA 3V5NA 4WASA 5KTKA 3AUAA 4RQTA 4KOAA 1PJLA 2YHUA 3BA1A 5JDCA 2CVZA 1VC2A 2O4UX 1MX3A 3PJDA 4IGFA 3M2PA 1LU9A 1HLPA 1R4NB 4BGIA 4JX8A 2XXBA 1FDWA 1IZ0A 3PJEA 5L51A 3KHUA 3OFSA 4EEXA 4YAIA 2ZK7A 3ZNOA 3OETA 4L75A 2CF5A 4NBTA 3A14A 1KIFA 4P38A 1TB4A 4UAGA 3H5RA 1YDEA 4RF2A 4TSKA 1HDZA 1ONPA 2BELA 1NXQA 3S2IA 1A4UA 3KYCB 4CM1A 5FFFA 4DMLA 5ENVA 5IG2A 2QQ5A 2WEKA 1P45A 2NM0A 1T1SA 1N92A 1ISJA 4J16A 4X54A 1N8KA 1VKOA 4J91A 5JDCC 5JY6A 4ZQFA 1GYRA 3PYXA 5HM8A 5U9CA 4D46A 4NI5A 4WLEA 3RC1A 1GYQA 1YBAA 1P1KA 5A5EA 4WK6A 4HNGA 4ND2A 3KYBA 4YJFA 3UXYA 1H9BA 3W8EA 1JQBA 1PS8A 3RWBA 3D1LA 4RL6A 4J1TA 2DFDA 2I9PA 4AICA 3H7AA 1QLHA 1CWUA 1PX0A 1UDCA 3H4VA 2WE7A 3L77A 1GUZA 4I08A 2Y67A 1GPJA 4LRSB 3HB5X 1XELA 3UVEA 3GFGA 3I9OA 2WD8A 5B4TA 3L6DA 3O9ZA 3PLRA 5EPOA 1IZ9A 3PDJA 3JQFC 5G4KB 1DIBA 3NT2A 3Q11A 4FGWA 4IDFA 3BZUA 4MIEA 1AN9A 1GQ2A 4CMIA 4R9SA 1WLYA 2VHXA 3FPLA 8LDHA 4S3MA 4CUZA 2OBYA 3E9QA 1KBZA 4D44A 1XQ1A 2X9NA 4XB1A 4Z0TA 5COAA 3U4HA 1SNYA 5JS6A 3U5TA 1ZJZA 4XYGA 3ZU4A 4J2HA 4IIUA 2CMDA 4F6CA 1LNQA 1Y8QB 1Y1PA 4QT0A 4IJKA 2NNLD 1XG5A 1NFFA 1PL7A 5KWEA 2EEZA 1LLDA 2DBVO 4WCDA 2W90A 4PFJA 5BNIA 4R9RA 1C1DB 1O89A 2PGJA 2HQ1A 3JTMA 1GQYA 3QVOA 2G1UA 2XPCA 2OMEA 3VH2A 4OOEA 3AUUA 1GAEO 3GNQA 4HV4A 1ISGA 3WBFA 3WFJA 4CODB 2BGKA 3JYLA 2A35A 3VAZA 4YPOA 3ANLA 5FWNA 3VVBA 4CM6A 4R1UA 1LX6A 2GN8A 1EBFA 4LVUA 4MIYA 2HO5A 2D59A 4HXYA 4Y6RA 5JNLA 3GVXA 1JAYA 4W99A 1Z73A 4J43A 5JLAA 4OO3A 3ZW9A 4CLOB 4PZDA 2PKRA 3DMYA 3E18A 4PLVA 4O6VA 3LYLA 1XDWA 4CV2A 2JCXA 1W73A 4UEKA 5IF3A 1NFQA 2EHDA 2WYUA 4CQMB 3DOJA 1K5HA 4UUOA 4BUCA 1PIWA 1KVSA 2DVMA 3ASVA 3GPIA 3PQFA 3A28A 3DAPA 4WCFB 3MJCA 2OUIA 1GPDG 3OA2A 5C3MA 2B4TO 1C0IA 1EUZA 3NEPX 5T8KC 4E2WA 3LC7O 5A1TA 4YAKA 2VRCA 3HNPA 1E6EA 3BMQB 3DXFA 3L0DA 2R2GA 4IXWA 1MG0A 3U0BA 2Y1DA 4E13A 2VHVA 1I2CA 2D5AA 1GD1O 4BKRA 3W1VA 4YYZA 2NTNA 4IJVA 5FYDA 3SJUA 1NQOA 2Q50A 3T4XA 1VJ1A 3F5QA 1DFIA 2HMVA 3KYDA 4GLOA 1GL3A 2EWMA 3CZRA 4IUYA 1IB6A 3O8QB 1UP6A 1N7GA 5IDYA 4ALNA 3CMMA 3T4EA 1EUCA 1ADGA 5CHEA 2Q2WA 5F5LA 3W4KA 1YH3A 2ZQZA 2AE1A 4RDIA 1AXGA 2Y93A 3H3FA 4CLXA 4DWVA 1LLUA 4U6SA 2AQ8A 5DT9A 4BNHA 2JL1A 1B3RA 3KRTA 3S2FA 3C1OA 8ADHA 5I7VA 3H9JA 1TT5B 3BTOA 5THKA 4CUJA 3JQGA 1YBMA 3F4LA 4IS2A 1J4AA 4JJFA 4NMHA 1CERA 1A27A 2EP7A 4OAQA 4YJDA 4Z9YA 2QIOA 2OGUA 5ILGA 2E82A 4R4JA 3A9WA 2HLPA 5DP2A 2ZJ0A 2NVBA 3PHIA 3KUXA 5A05A 1ENOA 1N9GB 3OHSX 4YRDA 1LSJA 2IEBA 4DREA 3X2EA 1Y9AA 2EGGA 2EG9A 2ZJ1A 4Y6SA 3RUCA 5F3RA 1B8VA 4JK3A 2O3JA 5B1YA 4DLLA 5AXAA 3DBLB 1R6DA 4XJSA 2TMGA 1HDGO 3DHEA 1W6UA 1R0SA 3H9EO 3TN7A 1HDXA 4MVJH 5MGBA 3H6KA 2OHXA 5JPIA 2C7VA 1M67A 1RM5A 4NDNE 4YJGB 5T57A 4GX5A 3BMNA 4PLFA 1LEHA 4OXKA 3CSDA 1A7AA 1SEVA 3JYQA 4RPJA 4R01A 4IDEA 2FMUA 1X7HA 2WDZA 3GDOA 4NBUA 2RH4A 1ENYA 5C37A
chains in the Genus database with same CATH superfamily
3IKVA 3V4FA 1QQAA 2ZS8A 2C07A 7ABPA 6REQB 1OH8A 1ZJJA 3FOAA 2XA9A 3BHIA 5AUPB 5AJWA 1ADCA 3GP3A 3AJAA 3QHQA 3TBKA 1UMBB 3DTVD 2ZXEA 3VR4H 1BYIA 4YUXA 1ZKDA 4TVKA 1UT5A 3RYIA 1IEXA 3IVAA 2B3TA 1BGVA 3VZPA 3DH0A 3GLHE 4MYUA 5FP0A 2P6OA 2VHWA 2FMKA 2R8BA 1US8A 1B73A 1W8IA 2RAUA 3H1EA 3G2IA 3GJ7A 4M60A 4PICA 4U2EA 3TD9A 2XRYA 3ZLBA 4B3JA 4B7CA 3BWMA 3CPHA 3PD7A 1ZNQO 4JYCA 1XD9A 3I53A 3IE2A 4BATA 2ZSEA 1I7LA 5BWLA 1TNDA 2IE0A 1I1HA 3CRMA 3O9VA 4FU0A 4NG4A 4S1PA 4TS1A 2YYYA 5CTAA 4ZGBA 3VTZA 4TVSA 1R4ZA 3MYRA 4GEGA 2Q5QA 3TIGA 4RGYA 2VTDA 3MQ4A 3NORA 2B94A 2QV0A 4FGZA 2R6DA 2PH7A 4GS5A 4IM7A 3KZKA 3GPDG 2Z5GA 3GD5A 2X0JA 1Q91A 1T5TA 2VKQA 3DFMA 3NZEA 3STYA 4B9AA 4F7DA 3OT1A 3R4VA 3R7SA 2WJ6A 2O3SA 2ZPTX 3GY0A 4N6GA 4HR7A 3UPDA 1HYHA 2Y6VA 3LQFA 1IQRA 3T5BA 2PKQP 4DCUA 1AK2A 1Z12A 3FTQA 2AJLI 2BH9A 1UK8A 4HWKA 3PS9A 4MCJA 1AH2A 1J7JA 2C9YA 2OZLB 3BGDA 4Q5IA 4D98A 4L8WB 5AVSA 5JAHA 1QTQA 5I7HA 2V3WA 2HEIA 1RYYA 5L3ZA 4O2BA 3RRZA 1YI1A 5EJ5A 4RCYA 5FBRB 3EJWA 3IVCA 3L4BC 5KDOA 4RACA 2FMXA 1SCNE 3H5NA 3PFIA 4IOKA 3TG2A 1TD1A 3O1IC 4JJ8A 1P81A 2XCTB 1SBTA 3H9QA 4J0JA 5JE8A 5AOCA 3V2GA 3WK5A 4CIBA 1NI3A 1R18A 1CKEA 2EJBA 3O75A 1LLCA 2P9FA 2H0QA 4Y9DA 3VHXA 1G8KA 3HYSA 5DCLA 4B4UA 4KN9S 4BO2A 4GP9A 4LDRA 3OPYB 4P4UA 5KYXB 3KPYA 4OLBA 4FHCA 1YASA 2ZWPA 3MBKA 1X2BA 3WMFA 5CB4F 1HDIA 1EM6A 2R5FA 4X7BA 2ZI3A 1WCV1 1Z08A 4HDCA 2HPVA 3U17A 1SN7A 4WBNB 3CX7A 1JX6A 1B76A 3GBSA 4US0R 1IY2A 1GZHB 1A7UA 1Z7WA 3LW8A 4MUFA 5KINB 1NBMA 2XCQA 1ZWKA 1NPDA 1RS0A 2J3MA 2QN8A 3BXOA 2VPYA 4DMGA 3SQWA 1MUUA 3M6AA 5KYYB 3ZHCA 3DZGA 4Z9BA 3BQNB 1IVSA 5IJAA 3GCWA 5BP7A 4JGIA 4L2IA 4AJNA 3WQHA 3ZCRA 1L0BA 1U11A 2ECFA 3CRRA 2C9MA 4Q7LA 4G5OA 3GZNA 2IHYA 4ITUA 2XW6A 2E2WA 2O14A 2X8AA 3DE3X 4ZRNA 1I7QB 2FN7A 5LXTF 2WSMA 5EI5A 2RAVA 1N1MA 4EH1A 1TCUA 1K63A 1YR2A 4QPJC 4RE6A 5K5EA 3DHWC 1AKQA 1IATA 3MJRA 1EAMA 1Z9BA 1J97A 2A1TR 1NW9B 3AIOA 5LB4A 2PJUA 1JAZA 5F23A 4WGFA 1SKYE 1KARA 2G0NA 3GOHA 2IYZA 4M54A 3TCNA 4ZQEA 5A3VA 1RMYA 3CW2A 4HSEA 1QNFA 1BWQA 1ZH8A 4Q4JA 1IZZA 3I76A 3FLMA 3D4OA 2IXAA 4G0OA 3LPAA 5JFGA 1FDTA 1S89A 4BMYA 3BFJA 4Y18A 4BTVA 2Q3EA 2L82A 3R7AA 1CV2A 1KXJA 1P5FA 4BFVA 1QTNA 3AF4A 2XGOA 1QF6A 4UE6A 5IT9A 3SZMA 5CBKA 1R64A 5LQNA 4WCFA 4MO2A 5BSRA 1GRVA 4KRFA 1SY7A 4JB3A 3KOZA 4FILA 1T1GA 1CS0B 3B1JA 2UYHA 3MLEA 5A9TA 2J45A 4UHJA 4I5IA 2WSLA 2ZVDA 3KT3A 1V5WA 1V6AA 1X8JA 3SIXA 3QI7A 1BSVA 2C3UA 5AQ1A 4GGOA 3AM3A 1QE5A 3FJOA 5IYZF 3THXA 3IAS1 1GWNA 4K81B 2UZ1A 1XF9A 3BIFA 3AJ9A 2CF6A 1DINA 2H5IA 5A7GA 3F1KA 2P40A 3U7RA 1RNLA 1ZM7A 3DZKA 5FPHA 3PEYA 1M2VA 1GGHA 3W79A 3L0ZA 4OHUA 3D43A 5DLPA 4AZ3B 3SVZA 4FKBA 4LX8A 3TQHA 4XW2A 2HSDA 2VAVA 5BVHB 1M6HA 1NRJB 4IDCA 2EZTA 1NVWQ 3EDOA 3F8SA 1HT0A 4RA9B 4OQXA 1Q20A 2FCAA 2XRFA 3IERA 3RSSA 3V34A 4LF7B 3HRHA 2RMKA 2GRJA 4DUGD 1I4OA 4DS3A 4ACAA 4JQCA 2E5FA 1UJNA 1R8YA 3D8RA 3PNPA 4FQ8A 4TL7A 1A04A 3FUVA 1XVIA 4MB2A 1NYTA 3HI6A 2JEYA 1EA7A 2RONA 4P8RA 3RM3A 3WBJA 1ETUA 4OYRA 4LE2A 1I5EA 1MF7A 1QFMA 3Q5DA 4XEHA 1CEXA 1M5TA 3LBHA 2VOEA 5EUBA 1TU4A 2WMYA 3V48A 2JS7A 3RBVA 1ZBDA 2VA8A 1UBTS 3H2BA 4PFSA 4ID3A 3FJYA 1VZ3A 4WVFA 3SWWA 1FYWA 2C4KA 1PTJC 1W76A 5EE3A 4Z8YA 3PGA1 1K4YA 3OESA 3L1JA 2BD0A 2IZZA 1YJCA 3KQVA 3GK3A 4CMHA 3U6KA 3HJNA 3P4YA 4JWKA 3GGOA 2ZJ7A 1MTOA 1PL8A 4BNIA 3COSA 4O2BF 4KQKA 1UZLA 2WG1A 3MW8A 4BYGA 4Y6QA 3H5OA 2Q8PA 3PHGA 4ZOEA 1E6LA 4KXXA 2AJCA 1NGSA 4QFBA 5IM4F 1W5FA 2FGJA 3FNIA 3KM0A 3AETB 4BQOA 1Q11A 3RRYA 4P4TA 3I5YA 2HRDA 4ZC8A 3SHTA 1J2YA 3BUSA 2FWMX 3HCBA 4WY5A 1U0FA 4H1TA 1SC9A 3T4PA 1ZQ1A 4XX1A 1DAPA 2GARA 4RPCA 3H1PA 3UWPA 1YJAA 3FYCA 1GTMA 3UH0A 2DF8A 1F6BA 2UKDA 3ASUA 2CCKA 3T7AA 4K5QA 5K01A 2F3PA 2NPOA 4O29A 3T41A 4A36A 3Q3IA 1KR2A 4Q3NA 1W30A 3MXTA 3KLPX 1JFVA 4U7HA 2NTEA 3A11A 4TTTS 4AO6A 3HZOA 3IBGA 3DOHA 3CWCA 5FFNA 5KC8A 1RCTE 1O8BA 2EXXA 4CQJA 5B4UA 1ZITA 2PSSA 3BSSA 2NYAA 4W1SA 5C8VA 2AC2A 3RV4A 2P77A 5K0GA 4U2BA 3M1IA 4BVFA 5CLGA 1F0PA 2BFBB 2XZPA 1NBME 2XMZA 2ZIXB 5ECYA 4Q48A 1ZFNA 4GIBA 2CUKA 1VL0A 1Z4PX 2WUWE 3EZ6A 2WKRA 4NZPA 4UBOA 3AZQA 4H16A 5KWVA 4GWKA 5DKFA 5H83A 1Y63A 3A1UA 3UPUA 1EIZA 4OP3A 4EF6A 1Y8CA 3I64A 4KE6A 2GHRA 3KKMA 1E2HA 1U2QA 3P32A 4LFBB 4TLCA 2YJ5A 5E6SA 4DMFA 1J42A 4OJMX 1SUIA 3LPLA 5CEFA 4F5DA 1GPBA 2X3UA 4N0PA 4YRJA 4KH0A 2JAUA 2V7QA 5LBUA 4CQLB 4QUAA 1WDKA 1RXVA 1I36A 1BWSA 1QZZA 5FI1B 3R0XA 5MN5A 1AHIA 4QPZA 2ZYTX 5T3YA 2UYOA 1ZJWA 1TXGA 2QE7A 4O4HA 3L41A 4R84A 4FP9A 5ER9A 2A4KA 5AKHA 2ID4A 1J0AA 1VCIA 1G2IA 5AXDA 1CK4A 1PJTA 1QYRA 4C4OA 4DT1B 2O19A 1BGXT 2AJDA 2XRMA 2ZZKA 3BM5A 4ESOA 4ARIA 3WRYC 3CTPA 4FFVA 1L3BA 2HRZA 3B20A 3NGXA 1SUPA 4KI0A 1TTHA 2H3HA 5AESA 2Z3ZA 4BHTA 3OPYI 1UP7A 4FR0A 2ZYAA 3PHHA 4N47A 1D0IA 3HJHA 3MCTA 3SLRA 2XUAA 4HB2A 4OL9A 1U7HA 1XWWA 1Z62A 3R8CA 3A9UA 3G9UA 2Z2IA 5I4KA 4BAGA 1V7PC 2PL1A 1DEXA 3H6GA 4PEVA 5DLYA 5IF9A 2VYQA 1X1SA 1VHJA 2WWRA 1CNMA 3RYCB 3D6VA 5A9SA 1TLFA 2FW9A 4NHOA 3IT2A 5H80A 2D6FA 1IEQA 2D2EA 1LPAB 3QP9A 3U3OA 3MWDB 1I94B 2J31A 4LMBA 3F71A 1EJ0A 5E9JA 2PMEA 3PU6A 4DYVA 5BSEA 3CUEF 3TK1A 1H93A 5G40A 4TKVA 3RVKA 4CU2A 2BSXA 4LF6B 1MPXA 2PXXA 2HMSA 2R7KA 1Y8RA 1DO2A 2RHCA 4UFOA 4CI0B 2FMHA 1Y6GA 4X1IA 1YT5A 1JRLA 1RLMA 2W6MA 2WJPA 3LE8A 1RZRA 3WL3A 1A3CA 1JHUA 5J3JA 1GZDA 5CVTA 4XYLA 4HB4A 2FSFA 1Z06A 3LQ2A 4IIEA 3ZKWA 1AJEA 2AL7A 1MRNA 1TF5A 2HJRA 4MRRA 2XX3A 3E1SA 3AT1A 3SSNA 3U7EB 4CDNA 4E4RA 1LBQA 3BBPA 2IY8A 3TRFA 4B6SA 5ADHA 4CM5A 1KRWA 3DQQA 1LPPA 2UUPA 4BAZA 4XWYA 2FPGB 2RCNA 2JD1A 1AT1A 3IDZA 4WXYB 1XOIA 1WUHS 4GRAA 4HN2A 1RE1A 1APBA 4OK3A 4WUVA 4BNZA 3R3UA 4EZEA 3W4JA 4UBNA 1W1WA 2ZEJA 3OCXA 3I04M 4YJ3F 5EKTA 3FVVA 2Y77A 2HEGA 5A4IS 2PJRA 1YVDA 4M1KA 5BQFA 3QLVA 1XLVA 3FYDA 1PV2A 2B7LA 1P7ZA 1UWVA 3R4CA 3FTNA 3FR7A 1BXKA 4AKIA 4LDQA 4AMVA 1HK7A 4X44A 1WVMA 4UAVA 2XBMA 2YFHA 2CLMB 2XUFA 4TPKA 3VJKA 4NIMA 2FPUA 1BZYA 4S2UA 2IELA 4A0SA 4DMKA 3V8BA 1M5UA 1EINA 4LE0A 1PT8A 3ANTA 1VMDA 1G6HA 1T3LA 3D7MA 2EFDB 1GU7A 1NWHA 2X5JO 1IUOA 3AR6A 5HE8A 4ZEOA 3SZ3A 4ZARA 2O57A 3ZZNA 1UXHA 4GUAA 3DMRA 3NV7A 4M89A 4OLFA 1ZRMA 2ATEA 2EW1A 3O4JA 3WB1A 3L06A 4O4JB 4CFYA 1JHRA 1KEWA 2ORYA 1CIPA 1L7DA 1JL3A 1SC4A 4OUDB 5TX7A 4WRRA 5IZ4A 4ZO7A 4DC0A 4EPRA 3IUMA 4R8KA 3W6UA 2JZNA 2VNHA 5TGDA 5HOQA 1VFPA 2QTMA 2GCEA 1YMUA 5TNXA 2PO7A 4J29A 2AE2A 1B2RA 5I5EA 4QQNA 1T34A 3QLUC 2DRIA 4DQUA 3DEZA 1D2AA 2VHUA 3SKVA 3SOZA 4EIWA 1JYEA 2OY0A 2X4GA 3K8OE 4JLWA 5LIPA 1JFLA 1DIOB 1UADA 1O3YA 1L7XA 5F52A 2Q9CA 4O02B 4EMSA 4JJIA 5CHYA 3ZXYA 1JDJA 1JE1A 4IG9A 1KFCB 4JHLA 1W94A 4PG6A 1KAEA 4GO1A 4PZEA 2VNKA 4FE3A 4INPA 3RS2A 3W2GA 1YQXA 4EY7A 3KIPA 1JWAB 2BP7A 1RHJA 3K2IA 3CH5A 4B6RA 4WLUA 1JH9A 4ER7A 3E7DA 1I2MA 4GICA 4XDGA 3KPWA 5EE1A 3E2PA 3T1VA 2QD5A 2VZ8A 4LDZA 3WNZA 1IBCA 2ZROA 4HMOA 2QTNA 5C5DA 2FSIA 4HPXB 2YRXA 4IYJA 1GPKA 2OAQ1 2IK8A 3OIGA 1MA3A 4EA8A 1QG0A 1YR1A 1TT7A 1XQ6A 1BOFA 2OILA 2GD2A 3LYAA 4HQRA 4F9FA 3A8TA 3IOCA 2C58A 4H4CA 2Q7DA 3TQRA 3ZJ4A 4G5HA 5I9BA 2DOKA 4XVHA 3EVAA 1QRRA 2ZJYA 4R4JA 4TWAA 1A9PA 3PEVA 4DB2A 1QVRA 1M8JA 3CF0A 3TAHA 1XA4A 5GADl 3EARA 2JH3A 4ZRDA 1E7RA 3L7OA 3THXB 1EU1A 1U8XX 2JGDB 4FUQA 4R68A 5I7FA 4BRWA 2CNNA 4RABA 2NV0A 5I8WA 4ZPJA 4AURA 4DDHA 2IIVA 4BFXA 2QK4A 1YB4A 4RVFA 5CFLA 3SF8B 1XKTA 3H6HA 5DNDA 5G41A 2ALJA 3MA0A 3ST7A 4ZYZA 3OZVA 1RYBA 4Q9LA 3S70A 3EA5A 4I8DA 1BHJA 4M98A 1GEEA 3ETCA 4PSUA 4QG3A 3I1JA 2KS6A 2GJKA 4IFEA 1XEWX 4CKEB 5BSGA 3LHFA 2W2LA 1RWVA 3PPYA 1BTOA 2WTUA 4M22A 4BOYA 3WWDA 1RWPA 5KOJA 2JAPA 4NENA 4UJ5A 1E62A 2MINB 5JAPA 3GLIA 2AQIA 1SVWA 2XB4A 4K26A 1NY6A 4RC9A 5H70A 1XTRA 4QATA 2EX0A 2HK8A 3C87A 2FK7A 4ZREA 2FW6A 1PQ4A 3BIOA 2VT6A 1LBHA 2E6KA 2VJAA 5GTDA 3ZIDA 2CNDA 3JQ6A 1IQ0A 3FNFA 3GJ4A 3P9YA 4XGQA 4Q7MB 1HFJA 3KSZO 2PEYA 5HSGA 1R16A 4YVFA 5KAPA 1U7OA 2GZMA 4E32A 1HYQA 5B6JA 3RAJA 4LA4A 1N5MA 1DAEA 3SFTA 3G0GA 1TMGE 1B26A 3KJFA 1GNQA 2F00A 5JZVA 4XI9A 4RORA 1MX1A 3SYRA 1T35A 2OV8A 3R7FA 4DQKA 3GRAA 3E3LA 4GPAA 3N87A 5FNZA 4EUSA 5A3RA 3BOSA 3CS3A 3OQJA 4GI3A 1SXJA 2XNSA 3LCVB 4LNUB 3PPVA 4M6WA 3SPXA 3VDNB 1G21A 2QYTA 5J2TF 1YR8A 3NTUA 1LK7A 4G9BA 4Q4AA 5KS2A 1SZJG 3WFIA 5HEKA 1Y8RB 5D85A 3OQ6A 3L8HA 3ENZA 1AS0A 4AJ9A 1ZM2A 2RGNC 3ORQA 5FV7A 1Y9ZA 2H2IA 2ZRAA 4NBRA 1T3HA 4G0QA 2IRWA 2QF7A 4L0DA 4PYMA 1L9KA 2QOEA 3VZCA 5CDTA 1KAHA 4KN8A 5FOUA 5EWLA 3N2NA 5FTWA 3EW7A 1V45E 3BJIC 1IN6A 3MB8A 1HNXB 1GVHA 1PLKA 3SQDA 1GFWA 2KX7A 1Q0SA 2WKWA 4J1QA 4P4SA 4OKSA 4QUHA 5D8DA 5FIUA 4BNNA 4ARUA 5HUJA 3EEOA 3BCSA 1P29A 2ZB7A 3H13A 4OK5A 3HKBB 2FWBA 3QPAA 5K0EA 1QP8A 1T2VA 4I6EA 4D6XA 3RUIA 2Q4EA 3U7GA 3OQIB 4YXFA 3AUYA 3OCZA 4UPVA 3DWFA 3LAWA 4I1IA 2H31A 1Y7LA 3WWPA 4D42A 2VQFB 2J9FA 4GYYA 4PQYA 3NH9A 2D1SA 2QDKA 3AF5A 2CGEA 5LJIA 3JPWA 2Z9BA 5CDYA 2FP4B 3VI3B 1ISMA 3WLTA 4TKUB 2V3VA 5BN1A 5FWDA 5H0IA 4BO8A 5BN5B 3RVLA 4PRZA 2JF0A 2ZANA 4DQXA 3TQQA 3I6MA 1ZJ6A 5C31A 3WP0A 5FX2A 2VFAA 4PO9A 2Y1FA 3HCFA 3DYVA 3OM8A 3V8MA 4EGCB 3HVRA 2IW3A 2XXAB 3ZWDA 4LJ9A 3N76A 5HOEA 1CU1A 4HKTA 3D3EA 3NW9A 4R71A 3O91A 2QJTA 2CXSA 1AN0A 2QRMA 8ATCA 1UPFA 2IOHA 1J1ZA 3B12A 1U2SA 4YRPA 4B17A 1I3CA 4DV5B 2BTQA 4ZI7B 1T5SA 1KYYA 2W2OA 4OBWA 2X0RA 1EX7A 3CVJA 4OHFA 3TZ6A 4P33A 4B40A 1HWYA 3QKSB 4XD2A 4MS4B 2PCLA 5KWSA 1QP0A 1G17A 1ZD4A 3KUDA 5I4IA 4NCJA 3ZDDA 1DMRA 1C81A 4QSMA 4DLTA 1U7ZA 1UWCA 1BXZA 3D6TB 4NK5A 2IYNA 5DTJA 2VXYA 4K7JA 1QYWA 2FVYA 4O4IB 3V9AA 3Q7IA 4EKDA 1P31A 2R1VB 5JCJA 1NU6A 2JGLA 2AZ4A 1N78A 1IY1A 3WGNA 1QVAA 1ZC4A 4XSHA 1Q0TA 1JXOA 2H1HA 4I14A 5DO9A 2UZIR 3K96A 1KPHA 1OHHA 1Z6TA 3GUUA 3ZDQA 4RD4A 3HB7A 1AXRA 1W75A 1SQ6A 1U7WA 1Y9EA 4N6OA 4QAQA 2VCHA 1KZ6A 4B47A 1CETA 2O23A 3OP1A 4JP8A 4L8FA 1G3QA 2X8JA 2QRKA 4HATA 3V7WA 3C6YA 3DULA 3MILA 2I4NA 4ZT3A 3E9CA 1HETA 1U1GA 5HRUA 2D5LA 5CA0F 3W5DA 3CLVA 2JCYA 3PUXA 4JEIA 2JZCA 4YR7A 2NU7B 4GEKA 2H2GA 3TL2A 3ORYA 1H1LB 3NXKA 2J5RA 1KMMA 1H2AS 4LXTA 2O6LA 3LM8A 4KQMA 1RAGA 1W85A 3CT6A 3KL2A 4MLDA 3WLMA 3GFTA 4GMKA 5ERYA 5HIAA 5B30A 3OCCA 3UC5A 4ZT4A 4B6JA 5CFZA 2MCFA 2I8LA 2AV6A 1L4HA 1JFTA 3FOBA 2BZ1A 3G59A 2C1ZA 1ECPA 4L6AA 3QV2A 2R6JA 1KA9H 4NRDA 4RVUA 2CLLB 5DISB 5DSXA 3P96A 5J4VA 2IXEA 1X19A 1Q3KA 5EFZA 2JFBA 1XE3A 2I6FA 3JWPA 4HDSB 5DBGA 3HUUA 5A4KA 2BEKA 2DFVA 3I0MA 4HGZA 4IFBA 1A9RA 3GFQA 1P1HA 4YXWD 1R4AA 3VR6A 4M1TA 4AJ2A 4LGVA 3TOSA 1RDFA 1JYFA 2FSVC 5AVRA 4REOA 1WMDA 4JB0A 1PJ2A 2PNJA 3ZYZA 4BN5A 1ZZGA 2WJYA 4L27A 1QB8A 3MMNA 1KQPA 4MR9A 3B3GA 3QU4A 3T5DA 1XZLA 4L57A 3USZA 5BOSB 2EIXA 5ALJA 2MYTA 1JLLA 4LXGA 1KDYA 1U2GC 3RT9A 4FB4A 4KGDA 2EP8A 3FA2A 3JARB 3QF4A 4NU5A 1T15A 2VQDA 4JD5A 1MVOA 1YRLA 4GSLA 5AI4A 4EEKA 1U2DA 4YRAA 4KYIB 5JS1A 1ZDMA 4KR9A 4HWTA 4D43A 1HUQA 3LX6A 3CCFA 1AQLA 1HO3A 1Z6XA 1K2VN 1EH5A 3BERA 1D8TA 2V59A 3ZWBA 3OT5A 1P2SA 2OFWA 3O90A 4W6ZA 3ZDEA 2ZYSA 3KTFA 3AFMA 2C3YA 1EE9A 3P0JA 4KYTA 4CIXA 1LPMA 4R2IA 1LVUA 1KMHA 2HTFA 3FUCA 2GMWA 4JI3B 2WSBA 4ZHQA 1DUSA 1NP3A 3ZH9B 1BW9A 3EGDA 1WPXA 4RTMA 4YFVA 3RFUA 3W8RA 3P5BA 3G8BA 3QOYA 3KWLA 3GJTA 2XMDA 5HM6A 5HKKA 1WO8A 1Q0QA 2RGAA 1JYSA 4LZJA 4PLZA 1PKXA 4C78A 1ZN7A 2LKDA 3GJYA 4C0JA 6ADHA 1I3NA 1T8TA 2C31A 3WMEA 2OBMA 3AZPA 2QSUA 3IIIA 3ZD7A 1U9ZA 3DM9B 4GVXA 3WJAA 5FWXB 1ZZEA 4REMA 2WZQA 1HH4A 1X9GA 2P3LA 1PYDA 2WJGA 2WWTA 3A4IA 3EZNA 2WQ7A 1NN1A 1K6IA 3JASA 4ENQA 1GNPA 5AM3A 2P9HA 4INZA 2P9ZA 4EBFA 5LQRA 4NZ9A 3R41A 2QTBA 3LRTA 2FSPA 4HX2A 2W6ZA 3G2QA 3IPLA 5LM3A 1FIUA 4C20A 5C2JB 2JI8A 1M0SA 2PT9A 4ZMBA 4WSOA 1JU9A 3NM5A 1E79D 1P0FA 2BEJA 4D41A 3RDPA 3A3YA 1LD3A 4MA4A 5E7MA 1OI7A 2OLEA 1CR0A 4GECA 3SEFA 2O2HA 1HQKA 2IYXA 5ESDA 2QTRA 4L7VA 5GP1A 4H0FA 5TQ0A 5H8WA 1P4HA 1RPTA 1TE2A 2WD9A 5EZSA 2WFZA 3NYIA 4HYEA 2ZJ2A 4RH3A 1LI5A 4XIFA 3DDOA 3KQKA 4N7RA 3PGJA 4L74A 4RJKA 1UDWA 2I29A 3BZWA 2ZUWA 2Y1XA 1JEEA 3PX3A 4JLNA 4CN8A 4YAUA 4QEKA 3R09A 2OCXA 1TTQB 3TM5A 3Q3EA 1QIHA 1BEEA 5B2FA 1STOA 2PS3A 1XD2B 3OM1A 4OOFA 2EJWA 1CG6A 4CJXA 2XE7A 1H42A 1P39A 1Z16A 5EWMA 1PT7A 4OI2A 4F7WA 5KKNB 1FJXA 1PF7E 3AHDA 3EDCA 2H54A 4R8SA 2OCIA 2VUTA 3BXPA 3H97A 3HV2A 3CKMA 2O2SA 4L5YA 4FZRA 2E6UX 5AM4A 3CWQA 3KB1A 4AN0A 4DHWA 4BXOA 1BE6A 1Z7EA 2GNOA 2LRHA 4Y2RA 4PNEA 4B3SB 5A0VA 1KEPA 3RSGA 1AHPA 3CEJA 2CE2X 4EW6A 1DELA 1X8XA 2RI1A 2XZTA 1SMKA 1UZUA 3BORA 3K9BA 4O2AA 3LX5A 3ANSA 5JS8A 3C3XA 4FLMA 5IT0A 1KO5A 2XOEA 5IU6A 1X86B 4Q47A 4J4HA 3C3MA 4L50A 4MWDA 4YGXB 5GQSA 2QUHA 4JMLA 4QGGA 4W7HA 2H7CA 3I3OA 3L8DA 1R6VA 1VB3A 1G66A 4NV0A 2NUAA 5IVKA 4I1VA 2UYQA 4LISA 3EEBA 4C6SA 1XO1A 1VYTA 3LP5A 4WZAA 1T8RA 5JSZB 1E3MA 1U9YA 1YDFA 3KQWA 4IJMA 5C8ZA 2ZW9A 4RK6A 1NMQA 1GCGA 5EMHA 2G72A 3DVLA 5CK4A 2EQ5A 2X1HA 5B3LA 1V5FA 1EP2B 3OQ1A 1A4RA 3A27A 1EWYA 3EBOA 3K8ZA 4YJ3A 1ZICA 1IZ7A 3WLPA 3SZRA 4BVBA 4XA8A 5DEIA 1UMDB 1F8FA 1WL8A 4M38A 1W5BA 2PLRA 2QIPA 4C4TA 3IOYA 4GP6A 3KFLA 5AVOA 2I6QA 4B6QA 4TYNA 1PJ4A 2A4MA 1DUIA 4MIOA 2FP4A 1LY1A 4MVJG 4GOKA 2X0IA 4R2LA 4ZYWA 2C5LA 3VPHA 1IUNA 4TWZA 1CHNA 2IHJA 4MQ6A 3L7CA 3RR2A 2A7QA 4BMPB 3A58B 3OO0A 1J09A 1PJ8A 4A15A 3M6FA 1FY2A 1HE5A 3DWIA 3V8QA 1J6UA 2QRVB 3LT5A 4FYPA 1Y5MA 1H9AA 4LVOA 2G4CA 4TXHA 3RIMA 3VJMA 1H4TA 2X0DA 1T0HB 4TN1A 2EGUA 1Q15A 1VM6A 3NUQA 1ZONA 4Q7KA 1QIJA 3AR4A 3D6NB 1CY0A 1RLTA 5IBPA 3NC0C 3W8FA 1YULA 2WILA 4BJ1A 5G0UA 5IVPA 4F4HA 3A05A 3ZG6A 3S2EA 2XYQA 1SCJA 1VE5A 2NVWA 4G5YA 3WZ2A 4XXHA 4NTZA 4Y2XA 3M49A 3SBDA 1U63A 4BO7A 4JEMA 3CCBA 5CIWA 2R751 5I7RA 3W3AH 4JKYA 2GYYA 5EOVA 5H68A 1U3TA 1K9VF 4A6EA 3AIMA 2FPOA 2QVZX 2GAJA 1NW6A 1P2GA 2H1LA 5FULA 1KI6B 4I5FA 1DWPA 4Y1FA 2ZI6A 1JAHA 4JKIA 4QFCA 1QK3A 4FYKA 2QI9F 2WIJA 3T1HB 4JEUA 4XKJA 3BL5A 3VPGA 1DX6A 2R00A 3D1JA 4EKIA 3LP8A 5AW7A 3HE3A 1W36C 5B2EA 3PFFA 1ULAA 1L4MA 1G8YA 2VC2B 2J33A 4PLTA 1DWUA 4AS3A 4DSAA 1F51E 4LRXA 4DSOA 3WGZA 2UUAB 3FKQA 2HWWA 4J8PA 4DGQA 3F3SA 3QFTA 4KDCA 4D4LA 2ZUFA 1A72A 1F60A 3L0CA 2FTKE 1LTQA 2OXIA 3ZWOA 5JT1A 2Q1SA 3H4TA 1FYDA 3LBYA 1THGA 1G16A 4FS8A 3SLGA 1SM4A 4JAVC 4LRYA 4TRNA 4W1RA 3GUYA 1Q57A 5DCUA 1TQ6A 1LDGA 1NVBA 3GRFA 3NU1A 1IOWA 3O2NA 4OREX 4QOJA 2H1VA 2OA0A 2VYND 2ZIZA 3K32A 4FONA 1VLQA 2HBZA 3ROFA 1ZH4A 2OPHA 2Q2QA 3IX7A 4F6LA 4ZI3A 4KNVA 4XJVA 5IH3A 1G3MA 4MCIA 1ORVA 1V1RB 1DFHA 4BV8A 1ZSYA 2XVAA 4IOMA 1K1EA 4POOA 2IF2A 1Z2CA 3PGKA 2I7TA 3R9IA 3TOVA 5J2TB 3IMCA 1ECGA 2ZJ5A 2H29A 3NHBA 4PVCA 4RXTA 5A5DA 1K8XB 5CDFE 3K6SB 4MPDA 1DC4A 4FFRA 4JXZA 2R66A 1JFFB 4N0EA 1ZJYA 1QR2A 4LX0A 2DBZA 3IQEA 5IM5A 2BRUA 1NJ2A 2A57A 3P9RA 2AC7A 1KGSA 1FJHA 4KWHA 5CJ2A 2I99A 1AMNA 2RHJA 2JKZA 1E6WA 4M21A 2F1JA 2DM6A 4CDGA 4HVTA 2ZSHA 3ZWWA 1F17A 2CBXA 3LXMA 4MW1A 5AKXA 4C1BA 4DKJA 1KDPA 2BJHA 3COZA 3DDCA 3COVA 1LCIA 1VPWA 4P80A 1ZXBA 2XKBA 2I4RA 4IFIA 1DTWA 3D7RA 3UWOA 2BONA 2XQVA 2YYSA 3JSAA 2PX2A 4ID9A 3RYFB 4UTZA 3V2IA 2QXTA 4A92A 4ZHSA 4S05A 1RYEA 2VF5X 2ATCA 3FCOA 3WISA 1N0IA 3PYMA 1PUJA 2D5CA 5FA8A 2DECA 1KJIA 4YLYA 1V41E 1JMYA 3EIXA 4ML3A 1L1RA 4M0EA 1P7YA 2AHOA 2V7VA 4BX2A 2VH1A 3JYOA 3NEYA 1XTVA 1YHNA 4NABA 3BWDD 3OMLA 4JYZA 4FQ5A 2CJPA 4LCBA 1PZMA 2IYSA 1ADFA 3NJ4A 4PG8A 3DZDA 3E8XA 1BMTA 1I3MA 1R8QA 3ENQA 4IAOA 3T7JA 3WYCA 3HJTA 3G2NA 2FE1A 1N2GA 2EZ4A 2XUQA 1W5AA 3EODA 3LX4A 4JIMA 3AF1A 1VJ0A 4B48A 1SBIA 2NZJA 4BBZA 4ZTZB 2HO4A 1ZD9A 3NWPA 3IQFA 1RWQA 3EC7A 1SHTX 3EPRA 3I45A 1Z0IA 4COOA 2PZMA 3DS8A 4S1TA 1TM2A 1LPBB 2HQBA 4X93A 1U9JA 3ONWA 1AKNA 4KV7A 4LE1A 1PJSA 2HRQA 3GH1A 1NW3A 2HDHA 1K89A 1W2WB 1WNTA 3QG1A 2ODPA 3VU1A 1NQTA 1O8CA 2FSVA 2QN3A 1WUIS 5I9MA 2EF0A 1TJ5A 2ERYA 3LO8A 3NHZA 2REOA 1X80A 1K4MA 2W8BB 5CFMA 3SR0A 3RBZA 3L79A 2EARA 2K5UA 4FK8A 4GPEA 1SBQA 1UXOA 4NESA 5DGTA 3MCWA 5CURA 4BZWA 4D8YA 2F55A 4AS1A 4UPEA 4TYMA 3Q40A 3ITDA 4YP9A 3NBQA 1J2TA 3LC2O 4LJ8A 4E07A 1RRMA 1O96A 1ZMXA 2YY5A 1U8TA 2BUAA 2G5CA 3T3IA 2VWQA 4YRZA 1EK0A 4MW5A 3KT8A 3E9MA 5TJHA 1Y6ZA 4G2NA 1A9TA 1LRLA 4YALA 4FJ1A 1EWQA 3WJ7A 1T8SA 2Q9BA 3DV2A 4F5ZA 2FX2A 4OH7A 4IOJA 4I4LA 1UXJA 4QELA 4MB6A 4HQKA 1J2EA 2G5TA 2OXCA 5ALGA 3TLEA 4F11A 4D25A 2VS1A 1X7XA 1K7CA 2H18A 5EQDA 1W0JD 3UAXA 5ERXA 1UBUS 1MBZA 1W4BA 3RTEA 3U4MA 2B5WA 2TMDA 2GJSA 1H8ED 2FZKA 2QUKA 3OJWA 5H3CA 2ODWA 5HZHA 4M87A 1NLUA 5K6AA 1OUMA 1VJ5A 4OQEA 4FOLA 5HWSA 3WK8A 4OP2A 2OV4A 2FUG6 4NLLA 4FGLA 1RJGA 3A4MA 1GGVA 2VJKA 3OZBA 3H5VA 1FNDA 4IIHA 1V4BA 1XD2A 2IQ5A 3F8WA 3UFXA 2HNBA 4ALIA 4D8WA 4QKQA 3MOIA 4YRKA 3W05A 1JS1X 2VH2A 3WGQA 2ID8A 4CIWA 1WXGA 3BL6A 4GNKA 1NVVQ 3UQYS 1FXWF 5LKRA 1EX1A 1IN8A 1Z2PX 3CJTA 5HUHA 3IP6A 5EUQB 4BDTA 2QRUA 5C4MA 2QL6A 2JATA 3PGXA 5CTJA 4WNIA 3C5HA 1TUEA 1EDZA 3TDKA 4DJAA 2MWMA 2XT0A 3ZGLA 2C4MA 4QPCA 2ZETA 4MS1A 4FGUA 4HPWA 2AFIE 2OAP1 4MWOA 4JI1B 3IAFA 4WJKB 5AJYA 5AI0A 2A5YB 2YICA 3MT9A 1OXXK 1H2HA 3L6RA 3DV0A 3Q87B 2G88A 2YWDA 1J8QA 1Q12A 1PTJA 4R5MA 4DR7B 3A3OA 2ISCA 1E2JA 3CUSA 3WKBA 2R8RA 1O6FA 1RKUA 3C7KA 3EK2A 1G9XA 3ZI7A 5EMLA 3VRHA 1IIRA 4YACA 2B20A 4NAHA 4GZ5A 5K0JA 3O8CA 3WOVA 1DG1G 4G1UC 1QKKA 5KPDA 3R7LA 1O6CA 2QVGA 4Z7QB 1Z82A 3CNLA 5FA6A 2KM1A 2DPGA 4BAUA 1P2DA 4X1OA 5IUJC 4XUGB 4LVNA 2OENG 2VYVD 4MVWA 2RHBA 3KV3O 3RU9A 3MIIA 1XMJA 4CQMA 5LD2B 1SKUA 1TMKA 3SICE 3IUEA 4UE2A 2AIRA 1L7NA 1YR9A 1H3EA 5CGQB 4X85A 4LF9B 3R7WA 1ISFA 4MRNA 2GF2A 3ABRB 4G0PA 4HAXA 4LUCA 4PBSA 5DBHX 4ZGWA 2QL5A 4RZXA 9ABPA 3RO7A 5E3IA 1NPYA 2JC3A 1GDDA 4X1KA 2YY7A 5CJJA 2BEVA 2VDOB 3N2EA 1T9GS 4P86A 3UAWA 1ETHA 2CEKA 3RG8A 2L42A 2V55B 2C5HA 3NBXX 3P9IA 4EI7A 1DO8A 1XCPA 5BSWA 2X6RA 3Q98A 4CFSA 1E0SA 4KN6A 3HUFA 5AUOB 4G1VA 1Z75A 3IJPA 4HBZA 4O2LA 3NVKI 1CY7A 1PI3A 2DCUA 4DYDA 1T1EA 2V97A 5EVCA 1UR5A 2LWIA 2IV7A 4Z4GA 3FBGA 3M3HA 5BW4A 2FFQA 4YMVA 3WAGA 3HP4A 3C74A 2Z2KA 4MVJD 5DTIA 2FFRA 2PUHA 1NNEA 1R0CA 4RWZA 3I4FA 3OX2A 4RMGA 1S3FA 3I9NA 3OOWA 2PXAA 4IXTA 4JUCA 4UVIA 2HUPA 3ESBA 5A3SA 1DLIA 5ALRA 3FLBA 3C70A 1EFPB 1LA2A 2WTNA 4I55B 3ADBA 1VPTA 2DERA 3QQ5A 2C97A 2ZBVA 1G98A 2TMKA 3VTFA 1YA6A 2CMFA 4L7QA 3VU3A 3V55A 3DF7A 1NUTA 4FDLA 4WZBE 1IHOA 3R7BA 1HTBA 3MMXA 2QE7D 4L5CA 4RY9A 3C0KA 3PQ6A 3RRJA 3KSUA 3TSYA 2PRJA 2RHRA 3WG9A 4ZK2A 2JLVA 4Q1DA 4G0VA 3WMRA 1C30A 1RPNA 4BQFA 2IP4A 4WLVA 1QS0B 2W43A 4OQZA 2V65A 4OY3A 4YDSA 2UU9B 1Z83A 4QJ5A 4A2WA 2FEAA 1PGPA 4OXQA 4HWSA 3A6ZA 4PNZA 1X1AA 4GSKA 2E4ZA 5DYYA 3LX8A 3LTEA 2Y99A 4I4TA 2ADOA 4NKRA 2QJFA 2IEAA 4QVKA 5G0VA 1EJ6A 2LD4A 1IE3A 4EA9A 1CJVC 7REQA 1F5SA 1XZJA 3JAKA 3PC8A 3PL5A 2XUZA 3T3EA 3GLGB 3R44A 4DRZA 1GKUB 4ACBA 1C1XA 2Y1WA 1PK7A 4HEQA 4R9UC 2NU7A 4BCBA 3U56A 2IZ7A 1E18A 2QBYB 1H6BA 3F8TA 4TZTA 3LC0A 3FW1A 2PLAA 2OP0A 4GT1A 4YX9A 1JKXA 4D82A 4ZAFA 5KCMA 2OQRA 2GBFA 3GEPA 3H42B 3IAEA 1UOQA 3L0YA 3IXMA 2VSOA 5DCYA 2BGLA 3U48A 3JZDA 3KTAB 4WBSA 4JU9A 1QQ7A 1XDUA 3DMTA 2EOAA 3ANMA 2KE5A 2WYIA 3EVZA 3HFJA 4OFBA 1J8VA 1PGQA 2BHRA 4E2ZA 4YDQA 4UE3S 1P19A 2PO5A 2WT4A 4KSYA 2HNKA 2AMFA 2FFJA 5TB5A 5AW2A 5JJBA 4IDBA 5DU2A 2K2WA 3WTBA 2NQ8A 2OB1A 4N3NA 3MTGA 2LDXA 1FVXA 1MJHA 2ZIVB 1YHZA 4BLSA 5B5SA 3CZPA 2P11A 3GLTA 1IWBB 2CFSA 4TVBA 2X7JA 4UEJA 1YVEI 3JCZA 3RTCA 1C41A 2BFCA 3V97A 5DM1A 1ZLYA 4F8YA 3WYEA 2P2DA 2GAAA 3OKFA 4BB6A 4EVSA 2D7DA 2B8TA 4RNCA 1N5KA 3KVVA 4FJ0A 3RABA 4ZVRA 5HTOA 2BH2A 4RIIA 2J7KA 2H7XA 4BPBA 1WY7A 5IT4A 2OYSA 4JBIA 2O07A 3BG5A 2HKIA 1SIWA 5EIBD 4JU8A 3AF2A 3K70B 1G21B 4K6HA 3FGOA 3BTUA 4GW3A 3VHQA 4LY3A 4R83A 1VXRA 1E3EA 1O5IA 4MUGA 4II2A 4WDQA 3SJBA 3OJ0A 2VJCA 4LK2A 2VPTA 3O73A 3AHEA 2ZR0A 2CK3A 1UMCB 2Z95A 4DV0B 2J0SA 4P81A 2V3CC 3WK6A 4PN7A 3QX3A <