5ES3A

Co-crystal structure of ldh liganded with oxamate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
328
structure length
328
Chain Sequence
KDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title A Streamlined, Automated Protocol for the Production of Milligram Quantities of Untagged Recombinant Rat Lactate Dehydrogenase A Using AKTAxpressTM.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 113
structure length 328
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2015-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5es3A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5es3A02
5BQFA 1SCUA 4IQ8A 1DC4A 4QQRA 4RCVA 1Y5RA 3DONA 5BSHA 4A2CA 1R16A 5KOIA 4WK6A 5TLSA 4RVHA 2HSDA 2GF2A 2HJRA 4UREA 3GGPA 1QRRA 4G81A 3KBOA 4RF3A 1DC6A 1NWCA 4BMVA 3U3XA 1NNUA 1UZLA 2CF6A 4GBJA 3JQGB 4NU6A 1ISJA 3WB9A 5K0ZA 1A9ZA 1MG0A 3HWRA 2Y0DA 4I08A 5DCYA 2YDYA 1AGNA 6ADHA 4DYDA 3EVNA 1MG5A 3ASVA 4BKRA 4CM9A 3AU9A 2DTXA 4IJUA 3VPGA 1N5DA 3UOGA 1EE9A 1YO6A 5AQ1A 1W8DA 1MLDA 4Q3AA 3VKUA 3BHMA 2CDBA 3E5MA 1QSGA 4P22A 2Y67A 3JYQA 3PEFA 2D5CA 4B3HA 5EIOA 2IZZA 2R6JA 5CDSA 3WGOA 3LVFO 5G0TA 3JYNA 1YVEI 1WXDA 5F3RA 1MA0A 3PK0A 3WSWA 2W2LA 3RCBA 1PQPA 2V6MA 1YL5A 5HTOA 4NBVA 3VOSA 3D5QA 3FNHA 1P3DA 3UCFA 1WVGA 3JYPA 1JAXA 1DFHA 4BV8A 3QRWA 1KVUA 1E1KA 2C5EA 1X1EA 1SO8A 5A05A 1GAEO 2J3KA 5A3JA 1P1HA 1PJ2A 2ZTVA 5F5NA 3GVCA 1V3VA 1SZJG 2HMWA 1WZEA 4WLEA 3RUHA 3AY7A 1HYGA 5THKA 3D1LA 2JD0A 3BTUA 3RFTA 3S2GA 4CQMA 4F6LA 4FC7A 4JJIA 2EXXA 3RKUA 2NQTA 4FFLA 4WJZA 1RPNA 4CLDA 3JQFA 3JD4A 2X4GA 2HLPA 4E33A 5JPIA 3NTQA 1J49A 4TQGA 3LC2O 4ALMA 4CR7A 1C1XA 1D8AA 3DQPA 1K3TA 1I3NA 2VRCA 2HQ1A 4GSKA 4IJVA 4R1TA 5L4NA 1DFIA 3V1UA 1ORRA 3OIFA 1ARZA 1CF2O 4CQMB 1E77A 3TQHA 3I9JA 1O8CA 4GQAA 3VH1A 4FD3A 5JSFA 5AYVA 4YCAA 2BFAA 3KLMX 5DF1A 4E2XA 3KB6A 3DAPA 3WJAA 3WGGA 1JLLA 2FHSA 4HFRA 1C1XB 4Y6PA 1NASA 5IZ4A 5JDIC 4BNUA 1KEPA 2B36A 3F6YA 4ND4A 5FWNA 1NVTA 4WE3A 4BNGA 3ZWVA 3KOUA 4L4RA 2FZWA 2EKLA 3KZVA 2YQ5A 1EBUA 3WQQA 3G0OA 2ZJ1A 3DBLB 1LRLA 3OJFA 1NAIA 3O4RA 1A4IA 4XYBA 3GDFA 2OFPA 1PL6A 4R5MA 2IYPA 4ZRMA 4PLWA 2FPPA 1J4AA 1LI4A 1EUCA 2JJYA 4PLFA 4Z6KA 1DIGA 3WSVA 1PWZA 1ZEJA 3MWEB 3INTA 4RVFA 4TRNA 4E5PA 2NWQA 3W8FA 1D4FA 3CZRA 4FOSA 3S8MA 1EVZA 3EK2A 4KQWA 3SC4A 1C0LA 3IMFA 5I9NA 1P1RA 4L4SA 1QG6A 4PFJA 3PHHA 3ZWPA 4BB6A 2J8ZA 4D45A 1HRDA 1KC3A 5CDYA 1EUZA 1KIFA 1M67A 3OH8A 4HXYA 4ITUA 5HS6A 2DT5A 2YJZA 2YV1A 1WMBA 4UVGA 1HXHA 2VHYA 3K96A 2P4QA 4XRRA 4MIEA 2EKPA 4HKTA 3QE3A 3FD8A 4B7XA 4U6SA 3FNGA 2JAHA 4JBGA 3AUSA 1DHTA 4EEZA 1UXKA 4HX5A 4JIGA 1DRUA 4BNYA 2WD8A 2R00A 5GY7A 2DBVO 1VKNA 2B0JA 3Q6IA 3U0BA 2VOEA 4ROSA 4CUJA 1LDBA 1LDGA 5IZCA 3TL2A 5AXDA 3KEQA 1EMDA 4LVUA 1PJBA 2V65A 3DHNA 4OXNA 3JQ9C 1BVRA 5COBA 4HADA 3BTVA 3I23A 2PNFA 2NUAA 3WG9A 4E2ZA 2H5LA 1KVRA 3L77A 3DMTC 3I9OA 5A02A 2HU2A 5DULA 2X86A 4RPKA 4PN3A 2Y66A 1WAMA 4RV9A 3U4CA 3NEPX 4YT8A 1P74A 4YAGA 1ZMOA 3PYMA 4D0SA 4LCEA 1E3WA 2PWZA 3GOHA 4LN1A 5BNFA 5MGBA 1N92A 2X22A 5DCUA 2GGSA 1LRKA 4UVHA 2C7GA 4Z0HO 2EHDA 3HDQA 2Y1DA 3I3OA 3WGHA 4XCVA 1LQUA 3ZZNA 1TEHA 4MKXA 5I8ZA 4IDAA 3PQEA 2W98A 1U9JA 5F1KA 3CE6A 1Y8RA 1E3WB 5CFZA 1SB8A 5TGDA 2X9VA 2Q4EA 3DOOA 4XIYA 3QLJA 4UUNA 5MDHA 4IDDA 3OP4A 4DGSA 1DRVA 1HLDA 3E6AA 3TFQA 2ZYGA 3RC2A 4BO0A 1XHLA 1FDVA 3AJRA 5JMWA 1HETA 4ALNA 2Y99A 1ZBQA 4RLHA 1M66A 5A1TA 3Q1LA 3RUAA 1A9YA 1UJMA 4ID9A 3LU1A 2VYVD 3KTDA 2O48X 4W9NC 4Z0PA 3W4KA 4OGWA 4L8VA 3FTPA 3L4SO 4D79A 2VWHA 3QWBA 3VPXA 2RH4A 4R16A 1JKFA 2D5AA 3CPSA 3RBVA 3WGYA 2LDXA 3F4BA 3W8EA 3HFSA 2P5YA 4DPLA 1HSZA 4DPMA 2GD1O 5JS6A 3F47A 5CPFA 4BKPA 3VPFA 2PZKA 1MB4A 1LC0A 4PLHA 4RQTA 1ISGA 4OSOA 3V1TC 4CM4B 1XQ1A 2Y93A 3ONDA 4CMIB 1M2WA 2RCYA 4ZGWA 2PGDA 2ZYAA 1PS8A 3I6QA 1MXFA 4IJWA 3LZ6A 3DOCA 1CRWG 1UDCA 4E5KA 3NT5A 4AJKA 2HMTA 5TJHA 5TT1A 1EQUA 4XDZA 1YDEA 3OEWA 1ISHA 4EJ6A 5TX7A 3H65A 3AUUA 3P5SA 3FCOA 3ABIA 1RM3A 2A94A 4JK3A 3P19A 4M87A 4J3FA 4R5HA 2GZ2A 3FWNA 1XU7A 4HFMA 5G4LA 4YXFA 1PJ4A 3DAGA 3DFZA 1VE9A 4I5DA 4NFHA 2O23A 3NDJA 4GVXA 4IDGA 4Q3BA 9LDBA 3UF0A 4FOOA 3RUIA 1K89A 3L4BA 1U4OA 4MIOA 1ENYA 2Y1OA 1YOVA 1VC2A 5JC8A 1N9GA 1I2ZA 2C0CA 3KLPX 3NYWA 2PA3A 3LK7A 2Q1SA 1WDKA 2X8LA 2X6TA 4BNIA 4BO4A 3RQSA 1OBFO 4CLXA 1XCBA 2X0IA 4A7PA 3D64A 2DKNA 4LGVA 1DC5A 1U3UA 2OO5A 3JQAA 1UH5A 1QYWA 3RVDA 1SEVA 4DWVA 1EFKA 4QFCA 1YOVB 2Q4BA 4F6CA 1ONPA 5DOZA 1JVSA 2Q1WA 3DDNA 3ASUA 4UULA 4O63O 4BNLA 2ZIZA 3M2TA 4XYLA 1SAYA 2VHVA 2G0TA 1T4BA 1E3LA 4JCOA 1B15A 3BZUA 3VTFA 3W6UA 1OOEA 5JY6A 1B3RA 3EW7A 4L76A 3DZIA 2AG8A 5L53A 1OI7A 3E9QA 4AG3A 2AW5A 3O8QB 1KOLA 3NGLA 3JQAB 5G0UA 3I83A 3C1TA 3JQ8A 2D59A 3PXXA 4J43A 2BHLA 3EY4A 4KUGA 4DQUA 2CF5A 5DBIA 5JAIA 5IAAA 5T57A 2X0RA 1DC3A 4NK4A 1I5RA 4L75A 2OUIA 3JTMA 2BI8A 1PR3A 1CWUA 2CZCA 4YDRA 1ENZA 4Q3DA 3JQ8B 4C4OA 5L51A 2UDPA 3GNQA 5DCWA 2X5OA 1LRJA 1UZMA 3IP3A 3AY3A 1QV6A 5FI5A 2NVBA 1UZNA 4Q3NA 5ILOA 1U3WA 4O0LA 4A5OA 3WNVA 3KHUA 3RD5A 2OMEA 3QWAA 1H6BA 3GNSA 1CEQA 1QYCA 2GN4A 4YRAA 4YT2A 1CJCA 5L4LA 4OL9A 4XWYA 1BSVA 5CP8A 2P9GA 5C3MA 4UVIA 1NFFA 2W8ZA 2ZTLA 3ANNA 5ER9A 3NTRA 5A5FA 3ANLA 3GVHA 1EDZA 2O7SA 4Q39A 1TLTA 3UXYA 4RZHA 3KYBA 4Z9XA 4IDEA 1RKXA 4JNKA 2VUTA 4H15A 4BO2A 5TQVA 2C7VA 3EZYA 2HCTA 4GGOA 2NTNA 4BS9A 3WGIA 2IODA 4JROA 5TS3A 4M49A 3UICA 4BNXA 4CJXA 2E6UX 3VVBA 5KIAA 1GCUA 3LT0A 2UUOA 1H0KA 4B4UA 1TT5A 4GL4A 1R37A 1DIBA 4CUKA 3WIEA 4BNTA 5A9SB 1I8TA 2H6EA 1GZ3A 2Q2WA 1LXCA 3OA2A 4KTTE 5KVQA 3VH4A 1YJQA 3IKVA 4UAGA 2I67A 5KKAA 4MVJD 5GMOA 4QO8A 2DVMA 1VL6A 3INGA 3SJUA 5KVCA 2WE8A 5JXWA 4TRRA 1C0PA 4BGEA 2GO1A 3ETGA 1F0YA 2POQX 2VYNA 1LQTA 1TT5B 4N54A 4XKJA 1GDHA 4IS3A 3AY6A 1K6XA 2E37A 4KUHA 4BO1A 5JW6A 3F9IA 3AFMA 1U1IA 2HK8A 2DC1A 1IPEA 2JHGA 3QY9A 5L9AA 2FWMX 4E4YA 5FI3A 5JBIA 5JO0A 3LF2A 4J6FA 1O9BA 2ILTA 3HHPA 3MJSA 3VPSA 4K6CA 5BSEA 1I33A 2CVQA 3AM3A 2DFDA 3GAZA 2JKVA 4K9DA 3VKVA 4ND3A 4JQCA 4A73A 2ZTUA 1B26A 2D3TA 4CPDA 2PKQO 3I52A 4XR4A 5JLAA 3GNTA 2Q45A 4GGPA 4WOJA 3ZW9A 3TSCA 4BKQA 3SX2A 5DP1A 2YFHA 3GUYA 3GT0A 4WUVA 5JAZA 4JJFA 2QRLA 3IOYA 1CYDA 2AA3A 4MVJP 4EJMA 5H83A 4ZJUA 1ZO8A 3N58A 5ENDA 3KEOA 5HM8A 5KJCA 4N5NA 3VVCA 4YEDA 2VRBA 1ZJYA 3DZKA 4B7CA 4AJOA 4P4LA 4HUJA 4DL9A 1Z73A 4CMHA 3TOXA 3ZWNA 4OKNA 4UVEA 4DIOA 1Y9AA 1MXHA 4J2HA 4R69A 1PTJA 3NJ8A 3BTOA 3EGOA 4WLOA 1TT7A 4FDAA 4EUHA 4X54A 1GCOA 1DSSG 1Y81A 3STHA 1PZGA 2ZYDA 1PJQA 3KM0A 5KKCA 2V7PA 4TZKA 5ES3A 4FFRA 2G17A 4IDFA 1HDCA 3C8MA 4PG4A 3JQDA 4ZQFA 1K6JA 4NPCA 4Y6SA 4CL8A 1I3KA 1QV7A 5I9LA 3GHHA 3HUDA 4A03A 4XYGA 3VZQA 2PK3A 2FR1A 4NK5A 4YBZA 4K1LA 3I9NA 1T2FA 3ZWWA 3X2EA 6LDHA 3BXXA 1H94A 4TVBA 3PTZA 4DYVA 4E32A 3R6DA 3MZ0A 3QJ5A 1DRWA 3PJGA 1DHRA 5THQA 2JD1A 4RPHA 1KBZA 5L3ZA 3ZV6A 2EP5A 4EDFA 1UUFA 1BDMA 5AXAA 2Z1NA 3ZWOA 3NV9A 3OQ1A 2B35A 2WYWA 4XGNA 4DIBA 1UP7A 3IIEA 4H7PA 3UFXA 1PQWA 2Y0CA 4HP8A 4NMHA 3PZRA 2ET6A 3NGXA 1LA2A 3GMSA 4OH1A 5A3VA 5I8WA 4NNJA 1LLUA 2G82A 4WLFA 5EERA 3LDHA 3ENKA 2D2IA 4IZIA 1L7DA 3ZU4A 2B5VA 1GQ2A 4YYZA 3DMTA 2YQ4A 1BXKA 4BGIA 2NACA 1H9AA 1ONNA 1LX6A 3A4VA 3JQ7B 1E3IA 2PR2A 2X5KO 3M6IA 2OL4A 4GPD1 4GX1A 5TT0A 4Y9DA 1T4DA 1FK8A 4AJJA 1I10A 1J6UA 1Y5MA 1PZFA 1LC3A 2ZCUA 3N74A 4K26A 4XX0A 4EZBA 1K5HA 4GMGA 1RWBA 3C7DB 4E6PA 1BVUA 4LRTB 2GLXA 1QMGA 3CIFA 3Q2IA 3AI1A 3PIIA 4BQRA 1XG5A 3EAGA 3GFGA 4BMNA 4GKVA 2BGMA 4E5YA 3NTOA 5L7YA 3U5TA 2OXIA 3KUXA 2E4AA 2FSSA 2YY7A 3H9JA 4IINA 1O94A 1A5ZA 2AHRA 4KP7A 2O3SA 4KMSA 2H63A 3UHAA 4MVJM 5DT9A 3GF4A 1JU9A 1PIWA 5CDGA 3F3SA 4PG5A 4YJGA 4O5OA 2VTEA 3VPHA 2YHUA 3B20A 3K73O 5B37A 2V6BA 3ZNPA 4CM9D 5EPOA 1NQTA 3MJVA 3QW2A 4W9NA 3WBBA 3KETA 1XA0A 5A9TA 3K92A 5DBGA 5IDYA 2Y0EA 1MC5A 1R66A 3E48A 5CG1A 1AHHA 4F45A 4Y6RA 3RWBA 3ZU3A 1GADO 1XLTA 4I9HA 4FCCA 1FXSA 3NRCA 4RVDA 3WGQA 4RDIA 4YJGB 4E30A 3VHRA 4CMEA 3K2EA 1DAPA 4BUCA 4ZU3A 2QRJA 2W2LD 3PLRA 4IDBA 1NR7A 1S6YA 5ILGA 1WWKA 3GZNA 1K0UA 4J0FA 2DM6A 4PLPA 3VAZA 1EEHA 1NTOA 1A7AA 3GA0A 2RHCA 5CEJA 2ZB8A 3W4IA 4NBRA 3DBHA 3QA9A 1P44A 1NQ5A 5AXBA 3B1FA 4UEKA 3PGJA 2HKIA 3LLSA 4KWHA 5H81A 4DUPA 3RC1A 4BOYA 3V5NA 3K30A 4OM8A 4CQMD 3NAQA 5TC4A 3ST7A 3GZNB 1VI2A 3EMKA 4BO9A 3EHEA 4NG5A 1DB3A 3DC2A 2WTBA 3DBHB 4IJKA 2QW8A 1Y6JA 1UP4A 1C0IA 3IUPA 5J23A 4GSLA 3COSA 4CV2A 3IUSA 1DOHA 3M1AA 1O5IA 5CHEA 3E18A 3ZHXA 4RVUA 2AEFA 3WYEA 3SBOA 2Y68A 4OMUA 1NQOA 5B12A 1GPDG 4B4OA 3DAFA 5JAQA 4R1NA 2AQ8A 3KVOA 2X23A 3V2HA 4CMCA 3VZRA 2Y1FA 3JCZA 3DBLA 4GX2A 4URFA 3LT2A 5A03A 1ZXBA 1Z7EA 4CQLA 1BXGA 2FOIA 2HK9A 4MVJF 1ZH8A 2EWMA 4DBZA 1MV8A 1CERA 1WMAA 2NM0A 4L0QA 4RF4A 5G0VA 5TF4A 3CZMA 3GPDG 4P4NA 3KSDO 2IXBA 1F8FA 3W4JA 1Z6ZA 1CQJA 3HN2A 3CEAA 5TNXA 4BMSA 1AE1A 1PGNA 3ZW8A 3HB5X 2OP0A 4O1MA 5B4UA 4KWIA 1HEUA 3LF1A 4CQLB 1BXGB 1NWHA 3FNFA 3OECA 1T1RA 2CY0A 3O9ZA 3OIDA 1T2AA 2P5UA 4NJMA 2HMSA 2B4TO 1R15A 1C1DA 1ONOA 2CUKA 3MJ4A 4DLLA 4IBOA 5ITWA 1VKOA 3RFXA 1RM0A 1M6WA 4JP3A 1JWBB 1GYRA 1DJQA 4OYRA 3L9WA 4J1QA 4CR8A 4EYEA 2GRAA 2WM3A 4ND1A 2GPTA 3IP1A 4A26A 1UR5A 3P7MA 3QIVA 1QYXA 2E82A 3GVPA 2P9EA 4J0EA 4NH4A 3BMQA 4Y98A 4NJMB 1HT0A 1X7GA 4PLTA 1JDJA 3EZLA 2GNAA 2VHWA 1C1DB 2CFCA 4A10A 2C07A 4DC0A 3BHIA 1VJTA 5AXCA 1UAYA 1BHSA 1YS4A 2IRWA 2O3TA 3PDJA 3ZHBA 4J16A 2O4UX 4M8SA 5CAEA 4JXKA 5DZSA 1XKQA 1GU7A 4UUPA 4Z9YA 3BMQB 2EKQA 1V3UA 1JW9B 3MJEA 4BVAA 4B7UA 1E5LA 3MWDB 4AJIA 1LDNA 3DEYX 4QUKA 3RASA 1UAGA 2E48A 3PLNA 4TKMA 3DHEA 4F3YA 4DREA 3OA0A 3Q3CA 1DBVO 3E03A 2FZEA 1DIRA 4MJLA 3OJLA 3NDRA 2VZ0A 1Q7GA 3PZBA 5BSFA 3LYLA 1GYQA 4CODB 1K2WA 2C82A 2Q3EA 1HE5A 1Q2XA 3ONFA 4NDNE 5BNTA 2Q99A 1ZCJA 2A4KA 4CL3A 5I7VA 1SOWA 1IOLA 1IY8A 1Q0QA 1B7GO 2PKRA 5LDGA 5CEFA 3Q0EA 3RROA 1NR1A 4ESOA 4FS3A 1P9LA 4DXHA 4TSKA 3RC9A 5TIIA 4MKZA 4RL6A 4XYEA 1G1AA 2QZZA 3ITKA 3IJRA 1DLIA 2O2SA 1PZHA 5BSGA 1OZAA 3C1AA 1HDYA 2O3RA 5CEEA 2QG4A 3FNEA 2DPHA 5G0SA 3H9GA 1XWFA 2J3IA 3TDKA 1GR0A 2OGUA 1YKFA 2B83A 3RBXA 4EEXA 3HNPA 4RO0A 3UW3A 1B14A 1KETA 2BFPA 2CMDA 2NTJA 3VH2A 4R4JA 4BNMA 1RYEA 3PHIA 3GK3A 1B8VA 1PR9A 3GRKA 3CTMA 2P4HX 3H8VA 1ML3A 2YFQA 4DLAA 4EJ0A 4GAEA 4XB2A 3GG2A 1ULSA 1T25A 3QQPA 1YBVA 3U09A 3WMWA 1HDXA 4FGSA 1DLJA 2EGGA 2Q2QA 1VRWA 3EVTA 1OC4A 1PL8A 1U7HA 2B37A 4I8XA 4NZ9A 1OAAA 4CM4A 4CMIA 4E3ZA 4IQ0A 1YONA 4FQ8A 2HDHA 5DDIP 3ZI0A 2I66A 4F46A 4BNNA 5DOVA 1BGVA 2ZB7A 5IJZA 4BNZA 1XSEA 5AVOA 4KOAA 4LW8A 1I01A 1E7YA 2W2KA 4RQUA 2FRDA 2P68A 3OETA 4KUEA 3BMNA 3PQDA 5JAMA 1BTOA 2PH5A 5HBRA 3GQVA 4Q3CA 1HLPA 1H93A 4IXTA 1U3VA 4CLHA 4CMEC 3X2FA 3GEGA 3S55A 4LVCA 3GR6A 3LSYA 1MX3A 1YQGA 4DMMA 4PLYA 3TF5A 4M55A 3WQSB 3CH6A 3RUDA 4IMPA 4J7XA 1RYDA 4YJDA 1QR6A 4TZTA 4YR9A 2VT3A 1DPGA 1LDMA 2W2KB 2DU8A 3CKYA 4HNHA 1ZJZA 1AUPA 3BMNB 4MDHA 4YVFA 4TRJA 4FFNA 2NV6A 2VYVA 2PD4A 3ORFA 2VZ8A 2ZK7A 2C29D 3FHLA 4E5NA 1E1MA 2JCYA 3GZ4A 3QSGA 1ADBA 2GUGA 3Q9UA 4GLLA 1QYDA 2I65A 4R1SA 1W4ZA 4K6FA 4PGFA 4YWJA 4G5HA 3VH3A 3MOGA 4B79A 1EVJA 3A9WA 2NLOA 2XPCA 1OFGA 3F1KA 3W1VA 4MP3A 4IGFA 3ENNA 1XU9A 3GDGA 1DIHA 4YJHB 5BNIA 5I7SA 1IZ9A 3EC7A 4KQXA 5ITVA 2EERA 4I5FA 1WDLA 1X0VA 3L07A 3ZNOA 3AI3A 3HSKA 2BFMA 5B1YA 2GZ3A 2Q1UA 1JAYA 3GRPA 4DQVA 3L6OO 1Z82A 4ZHSA 2QX7A 4FN4A 2Z1MA 1D3AA 3RU9A 4AJHA 1K6IA 3O8QA 1H2BA 3FN4A 1CQIA 4CMJA 1P1FA 2CD9A 2QRKA 3FR8A 4CM3A 3FF4A 2BELA 1V9LA 4NHEA 1NXQA 3GN1A 2D0IA 2DBRA 1ISIA 1D1SA 1KEUA 3RU7A 1I24A 1YH3A 1KVSA 1XEAA 2YV2A 3L9XA 4WPGA 4AL4A 3GFBA 3ICCA 2OP1A 2WYVA 3I9LA 3H2ZA 4U5QA 3S1LA 4MVJI 3F46A 5KWEA 4E21A 4XQCA 1EZ4A 3FI9A 1PL7A 3G17A 5IF3A 2DTDA 3C24A 3DHYA 3WS7A 3DZBA 1NPTO 3UUWA 4ZICA 5EINA 1RJWA 1WZIA 4CM7A 1EK6A 3LC1O 4DPKA 4JBHA 3QVSA 1E7QA 4XZ3A 2NTVA 3GPIA 4GVLA 1P77A 3N7UA 1Q0LA 1YE3A 4MVJE 4XJSA 2O2YA 3IJPA 3WICA 4RPJA 2ZB3A 3HDYA 5KNLA 4B3IA 2EGHA 4U6QA 4NU5A 1I3LA 4J9UE 2J5RA 1A71A 1BDBA 2AE1A 1U2DA 2EP7A 2C59A 3DTTA 4CMAA 4IMRA 3DBVO 1AXGA 3ZHYA 4AFNA 5JCXA 3DZHA 2ZJ0A 2YV3A 1HWYA 1R4MA 1UP6A 2HUNA 3S2IA 3UCXA 3RAJA 2AQHA 4A27A 4WASA 3G79A 4OOEA 2I3GA 1G0NA 2DPGA 1IPFA 2P9CA 3DOJA 4YQZA 5A9SA 3WIDA 4II3A 4LMPA 2CVZA 4LK3A 3ETDA 4XIJA 4FC6A 3QWFA 1GPJA 3ROMA 4TKLA 2BFOA 1ZVMA 5HA5A 1H5QA 3H9UA 2XXBA 1TB4A 1ZSVA 3PJFA 1PQUA 2TMGA 4PLGA 1R4MB 3ETEA 4ALKA 3AOGA 4CV1A 4YRBA 3SLKA 2D4AA 3Q11A 4RGBA 5EMHA 4R1UA 5DBFA 3A28A 4DBVO 3GY0A 1ADGA 4KTVE 2QIOA 3QVTA 3TZHA 1W6UA 3DFUA 4CLOA 1U2GA 3EDMA 4GH5A 2VYND 1T1SA 1W0CA 1ZXLA 3PHLA 1YBAA 4WEQA 1GUYA 3KYDA 3AUAA 4CM6A 1WP4A 2OOSA 3K2BA 5ER6A 3DL2A 1KYQA 4GLOA 1DAOA 3B6ZA 3LT1A 3HZZA 2NU7A 3EYWA 3U4IA 4UEOA 2PV7A 1YL6A 2IZ0A 5EQDA 4W99A 4ALIA 1C14A 2VZ9A 4FPXA 3PI7A 2D8AA 3RUEA 4IY1A 1E6WA 4CR6A 4CLOB 1IHYA 1LLCA 1EDOA 1UXGA 3E8XA 1ZEMA 3ZV4A 2FPIA 3BMOB 4TMFA 5H82A 2PGJA 4WLVA 4YACA 4RJTA 4D7AA 4DMLA 3D3WA 1Y7TA 3KYDB 3H4VA 4RLSA 4RORA 2AG5A 4L4XA 4QEDA 3GUCA 5CDTA 2BLLA 4IGEA 3RKRA 1ZK0A 2JFHA 2O50A 1Z74A 2Q49A 3ZV3A 2QYSA 3PWZA 4S3MA 3V2UA 1CDOA 2I99A 1GQYA 4D46A 4JP2A 5T64A 3SC6A 1ZK4A 1EVIA 5T6BA 4C7KA 3D3WB 2J3JA 3NT4A 1L1FA 1EK5A 3FRJA 4DA9A 1DJNA 2G1UA 3GVXA 3TZQA 3QVOA 1LEHA 3B1JA 3JQEA 3OM9A 4MVJG 5LDHA 1LU9A 3OICA 3S2FA 1ZZEA 4CLRA 1U8FO 3L0DA 1R6DA 1M75A 4LCJA 2JL1A 1ZW1A 4Z9FA 3ZHZA 4DIFA 3I9KA 1Y1PA 1EE2A 4AJ2A 1F12A 4FBGA 4NIMA 4MINA 4XA8A 3OF2A 1X14A 2GERA 4D44A 1NAHA 3E1KA 1IB6A 3MTGA 1RM4A 4RVGA 2I3AA 1O95A 4PG8A 2HMUA 2J6IA 3PIDA 1FMCA 1DDOA 1EFLA 1R12A 1YRLA 3U4DA 3PFFA 1LSUA 1YB5A 1NVMB 4PLCA 3AUTA 4CLRB 3OJ0A 2GZ1A 4NJOA 1PWXA 4XQEA 1VL0A 5F1PA 4Z3KA 3KSZO 2DFVA 2VT2A 2BGKA 2J3HA 4NR0A 3QWHA 3WLEA 4NFYA 1DO8A 3KO8A 4CMKA 4CV0A 1IZ0A 5KCZA 3K31A 2DQ4A 4J7CA 1NPYA 3PDUA 3MJTA 4YTEA 4Z0TA 1QLHA 2DBQA 1GD1O 2H9IA 1HZZA 1LDYA 4ZQHA 4GX0A 2CDAA 2HO5A 4N7RA 4OSPA 3ZWCA 3D3EA 2NU6A 2UAGA 3FPLA 5L45A 3WOHA 4WECA 4YT5A 5L95A 1NM5A 3IL2A 3I4CA 3WQRA 2EV9A 3JQ7A 4W4TA 1B3BA 4XQGA 4PCVA 2VNAA 4PVCA 3HFGA 4WKGA 5DN9A 4YB8A 4WNCA 1AXEA 4BL5A 2XXJA 3HDJA 4D0RA 4R51A 1E7RA 1E1LA 3QVXA 2IEDA 3NUGA 3NX4A 3RFVA 3UH1A 4EUEA 5HRUA 2DUUA 3QV1A 4I5GA 3LC7O 2RIRA 1ZK1A 4DLBA 3D4PA 3K6JA 1EUDA 2BKAA 1YWGO 1N2SA 1U3TA 2PKQP 2RH8A 2Z5LA 2ZQZA 3V1YA 4JN6B 5U9CA 2FPGA 4BQPA 2GN8A 2I6TA 4AJNA 4NI5A 3JQBC 4E2WA 1YDWA 2I76A 3GDOA 3BMCA 4BKOA 2O3UA 4ZD6A 1E3JA 3OQBA 1ULUA 5L40A 1KC1A 5I7EA 1LJ8A 3U62A 4BNWA 4MIYA 3TPCA 1LDEA 4WNIA 4J1TA 3D4NA 3AM4A 3VTZA 3V2GA 5I9MA 4GWGA 3ZH2A 4W7IA 5A9RA 3G3EA 5F1OA 3RUCA 3IDSA 4FJ2A 2X1HA 4K28A 3TZKA 1YQXA 3WMXA 4B4VA 1GZ6A 1SOVA 2WYUA 3LQFA 4YRDA 2CNBA 3WBFA 3BMCB 3D4OA 2YW9A 1HZJA 2Y1EA 1HDGO 5COAA 2IDZA 3QHAA 3I5MA 4CM5A 4RDHA 5IXYA 4R01A 2JHFA 3K5PA 5KJ1A 2R2GA 1GUFA 3E9MA 1BWSA 5JCJA 2IZ1A 8LDHA 1C3VA 4R41A 3INRA 5FFFA 5JYEA 1U7TA 4D43A 2EIHA 2WSBA 4YJFB 1UDBA 3GHYA 3C3XA 5K9ZA 1GQQA 1RM5A 4HWKA 4PG6A 2F00A 1SMKA 3PFWO 4BO3A 2Y1GA 4QFDA 4UVDA 1A4UA 2VUSA 1JKJA 1IULA 2OBYA 4M89A 2O4CA 1PS0A 4QXMA 4KDFA 4INAA 3H9EO 5TRTA 4ALJA 1N7GA 1QKIA 1DEHA 1PS9A 4M1QA 4NBTA 4QX6A 1XIVA 4Y8VA 3WR5A 4JJGA 3DZGA 4OHUA 1UDAA 4YAEA 4J2OA 1SBYA 3ZWMA 2E49A 2WE7A 2I9PA 1A7KA 2GASA 3PWSA 3WX0A 3VZPA 1FDUA 1ZIDA 1U5AA 2WWRA 4XJTA 1PJSA 1YB4A 4JX8A 4TROA 1EBFA 1V0JA 4CMBA 1Y9EA 3PWKA 4WGGA 1R4NA 2I5PO 1VJ0A 1YBMA 2HAEA 4FIZA 2X9NA 2EG9A 1JWAB 4QECA 3MEQA 2PH3A 3G49A 1FDWA 3DBRA 1X15A 3HE3A 1DXYA 2YZ7A 1O0SA 1ZUD1 3U9LA 3R3JA 3RJ9A 1UXHA 2XAAA 3ZGYA 2D1YA 3ITDA 3KRTA 1U5CA 2VRCD 4TRMA 2VQ3A 2J5KA 5T67A 4DQXA 3ZWXA 2YDXA 1R4NB 4N5MA 4OAQA 4TWRA 2YUTA 4C7JA 1PJLA 1JA9A 2PD3A 3DBRB 4XRGA 2NVUA 3CINA 5G0WA 3IKTA 3IAHA 1CETA 1X7HA 1F06A 2C2XA 1R0LA 3K9QO 5A4DA 4PRLA 5BT9A 3DMYA 2XF8A 1ZK2A 2A92A 4O6VA 4Q9NA 4PG7A 5GZ3A 1NX6A 3TOZA 5L4SA 2O3QA 2IE0A 3TWOA 3TFOA 3WNQA 1YXMA 2TMDA 4YAIA 1GL3A 2HMVA 3LLVA 5LC1A 1YL7A 4BIIA 4RPLA 4IS2A 2DBZA 1X0XA 1NFQA 4D3FA 2X58A 3PRJA 2NVUB 4YAJA 1E6UA 2OHXA 3WTCA 1T2DA 4MVJH 2FP4A 4QO7A 5IN4A 1H2HA 3E82A 3Q2KA 4J4HA 1L7EA 2WD7A 1MFZA 1WPQA 3MOIA 5JFOA 4OKIA 1Q0HA 2BMAA 3UVEA 1N8KA 4NBUA 1BXZA 1HYHA 3RIHA 3GAFA 1C0KA 1I2CA 1TVEA 4OJNA 4R68A 2QZ9A 1HE3A 3T7CA 1B2LA 1LUAA 4IQGA 1B8PA 4OXKA 3O03A 1I2BA 3QWIA 4FR5A 1YGYA 1ENOA 5DNAA 1NYTA 5FYDA 4J1NA 4E5MA 3C7AA 4U0KA 1SNYA 1H6AA 3W8DA 3S2EA 1MC4A 3KYCA 2JCXA 1VJ1A 2AQKA 2FY8A 9LDTA 3JD2A 1WW8A 3T4XA 4HBGA 1HYEA 3BIOA 2WD7B 1LBEA 3U4HA 4DTIA 1A27A 4WEOA 1I32A 2EF1A 2VTDA 3F4LA 3BA1A 3R1IA 2GN9A 4R54A 4XGKA 3SVTA 4N18A 2VHXA 5T5QA 2C20A 2CVOA 2GN6A 4PLVA 2NU8A 5FEUA 3KYCB 1GV1A 3OEYA 1VLLA 3FPCA 2FN7A 5F5LA 1D1TA 4U0JA 1GZ4A 3TJRA 2HK7A 1P1KA 3WWYA 2V6FA 4HFNA 2X0JA 5C7OO 4PRKA 1E1NA 1B8UA 4YPOA 1ZK3A 4J49A 3AK4A 3ZN2A 1NVGA 3DZJA 4J4BA 5HS4A 3H3FA 5G4KA 3AFNA 3CXRA 2X7HA 2VHZA 3H5RA 3RUFA 4BNVA 4BO5A 5IXSA 1YQDA 1Z7BA 3A14A 4IPTA 1G6KA 1V8BA 2UYYA 5EJ2A 1SB9A 4EI2A 3FSRA 2X0NA 1PJTA 3H9QA 4UUOA 5GZ1A 2IEBA 2QYTA 2RBEA 5IG2A 4H3VA 3ZNNA 1NFRA 3WJ7A 1JVBA 3HADA 2A35A 1XQ6A 2Q46A 3SLGA 4LISA 5G4KB 1E3SA 3GH3A 3VZSA 1EQ2A 4NBWA 5BR7A 1A72A 1NHWA 2PZJA 1N1GA 4AJ1A 4P38A 1PX0A 3C85A 5ENVA 5JYDA 1FDTA 2EJVA 3AOEA 4ZQBA 1HDOA 2G76A 1XR3A 4AJLA 5L7WA 3FTNA 1BMDA 1HL3A 3CMMA 1BW9A 3QP9A 2B4RO 2O7QA 3OQ6A 3WTBA 3JYOA 3WYBA 2GSDA 2VNSA 4D42A 2NU9A 4TVOA 2HRZA 3GG9A 4EGFA 1F17A 4BNFA 1Z45A 2V6GA 2NQ8A 1J5PA 1O89A 4LMRA 1JQBA 3RI3A 1N7HA 4E2YA 1SC6A 1PU2A 2AXQA 5A04A 8ADHA 3CMCO 3TZ6A 5JDCA 4BNHA 3FBTA 3MJCA 3HN7A 3ZWAA 1GEEA 4ZVVA 1BG6A 1BW9B 3KV3O 3PJDA 3WWZA 2WJPA 3CSDA 3R0IA 2CSUA 4E31A 5A5EA 4UUMA 2EEZA 3DWFA 3C1OA 4LSMA 4Q3EA 4P4GA 3BAZA 1Y8QA 4QTZA 3WXBA 4KZPA 2VWPA 3IC5A 2H1SA 4EUFA 3OFSA 3OBBA 1H6CA 4R9RA 1KEVA 4FFOA 2UV8A 1ADFA 4IIUA 2JFGA 4IDCA 3ZU5A 3A1NA 4I5EA 1TI7A 3GVIA 1MGOA 1Y8RB 4AVYA 2VWGA 2ZKLA 1N1EA 4I9NA 2C2YA 4CM1A 4LSWA 4QT0A 1Y8QB 2B69A 4B3JA 3DXFA 1HDZA 4FGWA 1OMOA 1IL0A 4R9SA 2JFFA 3DO5A 1V3TA 2O3JA 4MP8A 1JN0A 2YHIA 4MO2A 1E92A 4WLNA 4YJHA 5AOVA 1SEPA 1LLQA 5K6AA 2WDZA 1HTBA 1HDRA 2AQIA 3PHGA 1V6AA 1LLDA 1E0DA 2JAPA 4BB5A 2NADA 3NKLA 1KEWA 3GGGA 4XEHA 1T26A 5ICMA 1E3EA 5HWSA 3NT2A 2X5JO 2NNLD 1VM6A 5U4QA 1O6ZA 1P1JA 4EW6A 3JQCA 4CMGA 3E9NA 5CG2A 4ND5A 5C37A 2VOJA 2NVWA 2YHIB 1CIVA 4RZIA 5IN5A 1PSDA 1GFSA 5TSDA 4OO3A 3GMDA 3IQDB 3PQFA 2BI7A 2EW2A 1P0CA 3H5AA 4NQZA 5T8KA 5KJ6A 1SPXA 4XB1A 1KVTA 3OJEA 1JTVA 4AJPA 4BNKA 1WNTA 2Y1CA 2YYYA 3JQAD 5EN4A 3JV7A 5LCXA 2ZQYA 3JYLA 2PTGA 3T4EA 2Y05A 3ANMA 2Z95A 2ZTMA 3WGZA 2J5QA 1E7WA 2ZB4A 4PIVA 2QQ5A 4MP6A 5IDWA 3G1TA 3DB2A 3TRIA 4BO6A 3ZCXA 3VDQA 4D41A 2CDCA 3MCVA 4ALLA 3JQFC 3GLQA 3AW9A 2GYYA 3ROKA 1XYGA 4J1SA 1EVYA 4GKBA 4RF5A 1KERA 3CUKA 3ZU2A 4WCFA 4PLZA 3JQBA 3UGKA 1QYVA 1Z75A 3H7AA 2W4QA 4IXWA 4DRYA 2P2SA 5CDUA 4ZA2A 1N9GB 7MDHA 3TN7A 2IXAA 5B4VA 2OBNA 3KSUA 1ZFNA 1X7DA 4GMFA 3O26A 1PJCA 2PZLA 3OMLA 1I3MA 2BF7A 3T7EA 4OIMA 3GC6A 1AHIA 1F8GA 2HRBA 1H6DA 4MKRA 4XD2A 1T24A 3TZCA 4WCFB 1QXSA 1P33A 4G65A 1QP8A 3WDSA 3WLFA 1F14A 4W7HA 4BGUA 3PP8A 5CPBA 5B4TA 5A06A 4JBIA 3ROQA 1XGKA 1GEGA 1YB1A 1G0OA 4NFSA 3TNLA 3ADPA 3V8BA 4D3DA 2DAPA 3L6EA 3PPIA 4FFPA 1IYZA 3RC7A 3FR7A 2VN8A 4HNGA 5COQA 5ADHA 4RVSA 4PZDA 1VL8A 3Q9NA 3HQ4O 5KVVA 1J0XO 1B0AA 5F21A 1VSUA 4H16A 3GEDA 1TA4A 1NHGA 1E6EA 1HSOA 2DUWA 1IE3A 2FSVA 3RBZA 1AN9A 3UN1A 3ZV5A 2EJWA 4GI2A 4BO7A 1I36A 1GTMA 2HJSA 3F5QA 5I7FA 3QVWA 1GYPA 5JE8A 1MP0A 2P91A 1ZSNA 2RAFA 2AEJA 4ILKA 4ZQEA 4XGIA 2VCYA 3UKOA 4OOFA 1PEDA 3O38A 3PYLA 3ZWBA 1E7MA 1PZEA 3GN2A 3JQ6A 1E7SA 1S7CA 3SEFA 2A9FA 3ULKA 5ICSA 1FF9A 4ND2A 5JO9A 4I1IA 2PGLA 3BMOA 3BTSA 2R00C 2VWQA 4PVDA 4BO8A 2GR9A 1I30A 5IZCC 3ZDFA 2Q2VA 4R3NA 1GUZA 4GX5A 1U28A 1VSVA 2B5WA 3AOEC 3ADOA 4II2A 4IUYA 4U7WA 3WFIA 2QHXA 4E0BA 2WMDA 2Q1TA 1M76A 3I4FA 4J7UA 3AI2A 2LDBA 2ZATA 3D5TA 5EQFA 4J4TA 4EITA 5C5IA 4BV9A 5L7TA 4J90A 3HG7A 1ISFA 3RSHA 3M1LA 1HKUA 4J9VA 1IUKA 1FDSA 3OJOA 4CM8A 2AEMA 4W82A 1GV0A 3P2YA 2FR8A 3A06A 2FR0A 3HJAA 1X13A 4W6ZA 4MVJA 3OHSX 4IM7A 1ZMTA 5G2OA 5JDCC 2PFGA 4GWKA 1PGOA 4MPDA 3P2OA 4N5LA 4J91A 2PY6A 5U1PA 4YT4A 5JMPA 5JNLA 4E12A 1X1TA 5JC1A 1MUUA 2BD0A 2DLDA 3F1LA 1KVQA 2W90A 4CM8B 3PJEA 1NPDA 2JCVA 3ONEA 5FF9A 4AJEA 5KVSA 3PVZA 3GGOA 1BRMA 2BH9A 3E5RA 1HF3A 4P8RA 5JY1A 3OIGA 5TJ9A 3SXPA 1LTHR 3I6IA 4PZEA 1KS9A 1WDMA 1NQAO 4R3WA 3U49A 5JDIA 4UEJA 4FJ1A 4YQYA 1ZSYA 1P0FA 1KY4A 2UVDA 2DTEA 3D7LA 3IS3A 4L74A 3H5NA 1HE2A 2NSDA 1OC2A 3RJ5A 5K6AC 3H6KA 1UXIA 4O59O 4BKUA 1Q1NA 2EW8A 3EUWA 4XYMA 4S1VA 1XELA 3ICPA 1PGQA 1M6HA 3BHJA 2ZCVA 1HE4A 5IFLA 3AM5A 3SJ7A 3VC7A 2JD2A 1R0KA 4ZN6A 3BYZA 1ADCA 1P31A 4KDEA 5DP2A 4CLEA 2GDZA 4Y67A 1LSSA 1T2EA 3JD0A 1FJHA 3JD3A 1E5QA 4CUZA 4HV4A 3UAGA 4AICA 3G1UA 5KJFA 3W6ZA 3D0OA 4IZHA 1YJ8A 3F5SA 4FW8A 4DC1A 1U8XX 5C7LO 1H9BA 3I1JA 4MOWA 4QSMA 4BGVA 2GCGA 1DFGA 5T8KC 4M86A 3AWDA 3FWZA 3GEMA 1UXJA 1Q7BA 3OSUA 1VPDA 3PGXA 5KTKA 2C5AA 1QLJA 2BRUA 3C7CB 1JKIA 1ENPA 4LRSB 4FFMA 4OXYA 3MTJA 2B4QA 1D7OA 2RHRA 3NJ4A 4ZRNA 3H3JA 3K8ZA 2XOXA 3WGTA 3L4BC 3I9MA 4I9UA 1PGJA 7ADHA 5EESA 3AU8A 4BHTA 1P45A 2PD6A 4IIVA 4RPGA 3KXDA 3PYXA 4L9RA 4XDYA 2OZPA 3ON5A 2PZMA 1T2CA 2Q50A 3DZFA 1QORA 3PHJA 1WLYA 2F1KA 2SCUA 2AE2A 3L6DA 3R3SA 4ZQGA 1DIAA 1P1IA 4M54A 4B4WA 4WCDA 3JQ9A 4FSHA 4FB5A 2BGLA 1B16A 4WCFC 4WLUA 3ZWYA 4XQ9A 1I0ZA 2WEKA 4DVJA 3FBGA 3H2SA 4HFJA 3ZNQA 3JSAA 4U8GA 1Q7CA 1ISMA 3DTYA 2AMFA 2VUUA 4PZCA 5IDQA 1U4SA 3LT4A 4ONEA 2FMUA 5IDXA 1KY5A 1ID1A 4Z3DA 4B8ZA 1TXGA 4XR9A 2PLAA 3VDRA 1NBOA 4AJ4A 1ZKMA 2OORA 1LSOA 4WOKA 1W73A 3B70A 4E13A 4EBFA 3HDHA 1V35A 1IHXA 2C54A 4YJFA 2UUPA 2G5CA 4CV3A 4YAKA 4BNJA 3M2PA 5KJEA 5JCJD 4D3SA 3TL3A 4YA6A 3UCEA 1PJ3A 3B1KA 3ROPA 1MFPA 4A0SA 1ZNQO 4JGBA 3WYCA 3WFJA 1R0SA 4L73A 4B8WA 1LNQA 1XDWA 4HY3A 1GY8A 1NP3A 3DR3A 4JLWA 4OQYA 5C7IO 1PGPA 5EL0A 3JQGA 3NDIA 2X9GA 4OQZA 4RF2A 4G2NA 1LSJA 3HB4X 4FJ0A 5GZ6A 2IYOA 3JD1A
chains in the Genus database with same CATH superfamily
2K2QB 2H5IA 1DC4A 4QQRA 5JZ9A 3PKJA 1Y5RA 2C5HA 1AKQA 2H00A 5BSHA 2G72A 1LY1A 2FSVC 4FD2A 1R16A 6GPBA 1XMOB 1XCOA 2Q9CA 5L3QB 2H1CA 2X2PA 4CG0A 5TLSA 2XBUA 4RVHA 2HJRA 4DR6B 4F6RB 4NABA 5A1JA 5K0NA 2XBLA 3VXKA 5ALSA 3P9XA 3NHAA 3U3XA 1T2VA 1Z4NA 1NNUA 1RBMA 1UZLA 2ODTX 2P78A 3ZBUA 4DOMA 5IFKA 1G42A 1W25A 1A9ZA 3R5XA 2ODWA 3TW6A 3AEYA 3EVNA 1MG5A 3ASVA 2DTXA 1G3MA 3C3EA 1N5DA 1ZN2A 3BE4A 3UOGA 1KZGB 1X42A 2FKNA 4M7PA 1YO6A 3AR9A 1A4XA 1MJGM 1F4LA 1S4QA 3SSMA 1MLDA 3E1GA 4Q3AA 5D1HA 3BHMA 3IVRA 3VKUA 3E5MA 1QSGA 3KQMA 1K3UB 4DLUA 1EUYA 4UTRA 3PEFA 3T5DA 1JA0A 1E6MA 4B3HA 1QHHA 3U4MA 3E9EA 2R6JA 1WD5A 2EX0A 5IU6A 5FBLB 1U0JA 3I2JA 3LDFA 4XD7D 1DOAA 1YVEI 1WXDA 1U28C 3W3AD 4BX0A 4ERXA 5F3RA 4DW8A 3NXKA 5EZSA 2FQXA 4IIHA 3ISVA 1O03A 4TWJA 1U0EA 3DPIA 4XLZA 2NPFA 3ROGA 4BFYA 1N3IA 3OFVA 4EF4A 3B78A 3PA6A 2O8NA 3FM9A 4EG4A 3OCZA 3QXXA 4X62B 1YL5A 2X40A 1SHJA 4F2PA 1U3DA 3VOSA 3UCFA 3FNHA 4EB6B 1B00A 3CHYA 1PHRA 5JBQA 5EXSA 4X7RA 1QF7A 1QHHB 1KVUA 1NF8A 1TYZA 1E1KA 2RI6A 4ZT3A 2C5EA 4F8YA 4C3ZA 4B3GA 4J3JA 2J3KA 5E9JA 4LJAA 5CU7A 5A3JA 1PJ2A 2CNLA 2ZTVA 2O19A 1WUIS 1YB6A 1NW6A 3GVCA 3IPXA 1V3VA 3ZE8A 1IK6A 5HOQA 5LUAA 1SZJG 4B4KA 1H2FA 3RUHA 2DX7A 3RFTA 3D1LA 4GNRA 1NN5A 4F6LA 3KTAB 3DEFA 2JJ1A 3ZQ4A 3LOPA 3A4MA 3D6TB 1M73E 4B48A 4M1SA 4WJZA 3VA7A 3JQFA 4DN6A 4KQ2A 4E33A 4Y2XA 2ZRAA 2JHPA 1KL7A 2ZROA 4TQGA 1FIUA 2QVYX 1SXJE 2WNSA 4CR7A 5HG0A 3OOSA 3I32A 3DQPA 3M83A 4R1TA 1S89A 2HCBA 2HQ1A 4YUZA 5L4NA 1BQ4A 2AK3A 2GT1A 3B12A 2XE4A 4FOLA 3IT0A 5F4BA 1FMFA 3I9JA 5BP7A 1WTCA 3WK5A 3ZBPA 1YQQA 2FW9A 4GQAA 3VH1A 4CU2A 4LVOA 4KVFA 2PSEA 4DSUA 2FUG1 3CRRA 3HKBA 4KXMA 2CVHA 5CB8A 3Q7IA 4ZZ0A 5AHRA 3NALA 1JLLA 2ZB2A 4KNWA 4Y6PA 4RMIA 4C03A 3NATA 2IOYA 4BNUA 3EFEA 1Y7LA 3GRUA 3BB1A 2XMCA 3GP5A 3K9FC 4WGFA 3Q7PA 4LX0A 4L4RA 2ZYVX 4OHFA 3UV6A 2AR7A 4N3CA 4RM2A 4F7DA 1KRXA 2Q4OA 2BUBA 4J29A 3G0OA 1XBTA 3DBLB 5LBIA 1XJ0A 1LRLA 4MEBA 1AS0A 2AF3C 1NAIA 5FV7A 2PT7A 4FQ5A 3EIEA 4DABA 3RTCA 2WYIA 4KSYA 4E2FA 2AUTA 4YCMA 2QD4A 1JLLB 4V2UA 1J4AA 1T9ZA 1EUCA 1S2DA 3ND9A 1DIGA 3GCZA 4KV7A 3NORA 3HS3A 3OQVA 2PGIA 2C95A 2XVAA 4P3PA 4YWHA 3LDAA 4TRNA 2YJTD 3P4UA 1Q6ZA 4O2RA 2VHQA 3S8MA 3GFFA 4DRXA 4JB3A 1GOTA 5JJLA 1QF9A 3IMFA 3LWNA 4U6NA 1PV4A 2YN4A 4PFJA 3S2SA 3AFGA 5H59A 1Q7EA 3GEIA 1Z34A 2IPLA 2NT3A 3O47A 1HRDA 1Y98A 1XZBA 1M67A 3OH8A 4O4JA 4V0NA 3SHOA 5CDYA 2G9ZA 1ZVKA 3JVUA 2DT5A 1KMCA 3CJRA 2REOA 3QLTA 1EUCB 4JLBA 4MW6A 4MWTA 1PG5A 1FFDA 2N9UA 2OOKA 1RS0A 4UVGA 2H1HA 2IQ5A 3K96A 1J8FA 5A7GA 5KX5A 3L8GA 3L04A 4XRRA 5KYXA 4MIEA 4DRXB 5FH9A 1XVTA 2EKPA 3L7LA 4K87A 3NASA 3DF9A 5DYNA 1QP4A 2JAHA 1ZA2A 4BEWA 5AVVA 5CCBA 3DV0B 2AR0A 2QL9A 1F7UA 3F6CA 2XMRA 1KMIY 4BNYA 1ZGCA 2IEYA 2F1RA 1R0CA 4O4JB 1V8ZA 4F93B 3C14C 3Q6IA 3QYFA 2VOEA 4KR0A 4KB5A 5D7BA 1LDBA 2EZTA 1LDGA 5IZCA 1D09A 3PXUA 3THSA 3TL2A 1N2ZA 3AP1A 2JH8A 3BRWA 1H1LA 3CX3A 4OUKX 5IBPA 4B34A 5KX5B 5KYXB 3J7AC 3RYHB 1W4BA 4DJEC 2QTHA 3KYJB 2AD1A 2QN6A 3K9WA 1KQPA 3PUHA 5TPZD 2YZGA 2VTBA 4NZOA 2FPSA 1KVRA 3TRKA 4R2JA 1FUUA 3L77A 4BQNA 3F2IA 2FFAA 1GJRA 5DULA 2R6CA 3CH5A 4RPKA 3TBKA 3DDUA 1ZGBA 1YJBA 2Y8EA 4UNPA 5J9FA 1GXSA 3G7SA 2DE0X 2ZSHA 3PYMA 4LCEA 4F8EA 3GLHA 1MU0A 3GOHA 4TSFA 2P9QA 4GI5A 3IIMA 1N9ZA 5BNFA 2GBLC 3V8MA 3VR4A 4QLBA 1H1LB 2XUDA 4B7AA 4UTPA 3CO5A 1XTSA 1LRKA 1KGSA 3EXFB 4UVHA 1V3QE 5IT9A 3BDVA 2NSLA 4Z0HO 1M2JA 1YMUA 3HDQA 3WGHA 2WIFA 1A8UA 1H2YA 5KVAA 3JWEA 4LOJA 1K75A 1RWWA 4XCVA 2VTBB 1P2VA 3BIXA 2P4SA 2PXCA 4BBJA 5HUQA 3ZXUB 5DYTA 4P3KA 1JG2A 1GXSB 1Y8RA 3EMBA 1L2TA 1ML4A 3GLHB 2E6KA 1K7SN 2OM2A 2A0WA 3G6WA 3EX7C 1ZL2A 3IVMA 3DOOA 1N5LA 1FMTA 3CPJB 3QLJA 1WMSA 4IMIB 2X3YA 4MYSA 4XIYA 3CLVA 3M3HA 4IDDA 1O94C 1EE1A 3D6UA 3FJOA 4NNOA 4KPFC 4DGSA 4DMFA 2JI6A 1HLDA 2R97A 4FWIB 4MV0A 2I9KA 1ZHHA 1VLHA 2TS1A 1II9A 1NVFA 1NUAA 5JZVA 1W0KA 2QORA 4BO0A 2VXCA 5DGIA 2QQEA 2D1TA 3AF4A 1ZBQA 5BUZA 4P5EA 1UADA 1M66A 2ACKA 4BB0A 2R0QC 3Q1LA 4UHDA 1G63A 1IBRA 3RT9A 1H8ED 2VYVD 1H42A 1ZYUA 4MLDA 1CJKC 3Q98A 1SKAA 2V45A 3KAKA 3AG5A 4JJ4A 1Z6AA 3L4SO 4K6OA 1G4UR 1N2CA 3QWBA 4ZVLA 4HX2A 4ZVOA 3TNJA 2RH4A 4D2IA 3RBVA 3G8AA 3FLEA 3F4BA 3IUEA 3COVA 1T9HA 5HKOA 4DPMA 2BJVA 2O7VA 2GD1O 3ZKWA 1R6AA 2QN3A 5CPFA 3VPFA 4KREA 3MTIA 4FILA 4QUBA 4DCNA 4RQTA 3AEKB 5LLTA 4NE9A 4PXAA 4J0GA 5C31A 4CM4B 2ZBRA 5M5BA 4JV5B 1GNLA 2Y1WA 2ZYAA 1OWOA 3CJQA 5KYUA 2FVXA 4IJWA 5KPJA 3LZ6A 2ZIAA 3NT5A 2YC4C 2B7BA 4RH0A 2L2QA 4XDZA 2YJ5A 3H8SA 1JEQA 3EEBA 4FYIA 4ZAGA 5FYQA 3ZKWB 3EODA 4N49A 5TX7A 1XQXA 4X0EA 4DR5B 5DB4A 1Q5PA 4IVPA 3THXA 3CWQA 2E87A 1XZMA 3VFDA 3C8DA 3VNBA 3DVAA 2A94A 5F35A 5BMVA 1DTWA 3P19A 4Y2GA 5C52B 1LB1B 1Z2EA 3K71B 3CIOA 1KOJA 4HFMA 1ZDMA 3MAJA 4YV2A 2F1OA 1U8YA 3DAGA 2P69A 3DMNA 4TS9A 5A5GA 2O23A 4GVXA 1M0WA 4IDGA 2XOKA 4BX3A 5ICEA 3IPLA 3PSHA 3RUIA 3HPQA 3L4BA 1U4OA 2QM8A 4MIOA 3EBOA 4DIUA 2XRYA 1TJ5A 4D9MA 5JANA 3HA2A 3AFOA 3UWDA 1YOVA 3THXB 1L5ZA 4JLPA 2VG8A 4N3BA 4EFKA 3CGGA 3KLPX 4PYIA 5JZOA 4O2AA 2PA3A 5AVWA 3AXSA 3NM4A 1PJAA 3LPAA 2RHDA 3I6BA 4CLXA 4EJFA 3D54D 3RYCA 1XCBA 2X0IA 3KQNA 3IIKA 3AHHA 1QONA 1CVIA 5DBHX 2SKCA 2OO5A 4R1OA 3ZYCA 2X9LA 5TB5A 4F21A 3EDRA 4GRDA 3CLSC 2PQ0A 3G5UA 3JVEA 4DSNA 5E8RA 3C1UA 1CQXA 1YOVB 2D8MA 2WA1A 1L8XA 1OY1A 5DOZA 2Q1WA 1EK0A 1RYMA 4QJBA 4BNLA 4O2AB 2ZIZA 4QDZA 3SQDA 2NZVG 1T4BA 1UC5B 2GZMA 3HEAA 1ZOSA 3I12A 3PICA 1B6RA 4O33A 4DS3A 2GFQA 3K4PA 3BZUA 4JEIA 4X9XA 3SDZA 4GLBA 4E6PA 1OOEA 3PXAA 4KJZA 3SJCA 4NCIA 4X7BA 4AI6A 1ITZA 3RS0A 5ICFA 4YCLA 1VXOA 3TX6A 2ZWMA 3BSYA 2WNHA 4HAYA 4ARUA 3FDFA 1V16A 2Z6QA 1OSNA 5KYNA 1DQNA 4TKVA 4MDFA 4TXHA 3C1TA 3JQ8A 2DCUA 3HCOA 4YRGA 2PMWB 3V4ZA 4J43A 2BHLA 3BE8A 3QK7A 4DQUA 1W0JA 3R0ZA 2CF5A 1J0DA 3PC6A 4PGHA 4UOQA 1IG3A 5IAAA 5DYIA 3LQ2A 5T57A 1J8DA 2Z30A 4JVOA 4L0DA 1RT9A 1K86A 2DQZA 2PVCA 4L75A 1NVVR 4JJ6A 1LW6E 3DFFA 1BE6A 1JIXA 2Z4RA 5LQUA 4ZVKA 2BN4A 2BI8A 3GD5A 3BAFA 1V16B 2QTLA 2Q27A 1UDRA 1KOFA 3JQ8B 2UDPA 2TYSB 2YYAA 1NUUA 3GNLA 4KVAA 5K3FA 4DIBA 2NPIA 5CBPA 2WHXA 1OPRA 3QGMA 5GP1A 1E1QA 3TIVA 4Z1OA 1QV6A 3ZHVA 3W1EA 5KWVA 2C2HA 1TNDA 3CLRD 3NBUA 3BWBA 2YRWA 2BFEA 4O0LA 4PR3A 3WNVA 4N03A 3T0IA 4DG9A 3RD5A 3JALA 2QVGA 1CEQA 2GN4A 4MQEB 2WIAA 3ADCA 3DOIA 1LWNA 2RSLA 1M34E 1ZXXA 4XWYA 1SC1A 1I2DA 1BSVA 1WE2A 4OY3A 3SQOA 4C7MA 5C3MA 4UVIA 2DCMA 2ZR9A 3KB8A 4A4DA 4V3CA 5K3FB 1ORVA 5CBPB 3QPWA 1A98A 4BDTA 3W90A 3WO0A 3I61A 1ZMXA 2V59A 1GLNA 1XA3A 4JUAA 4LHSA 4Q39A 3UXYA 3AL2A 4JT8A 5A5VA 2A9OA 2J0UA 2QZ4A 2AX4A 1QFMA 4J16C 4MULA 4RZHA 4Z9XA 1RKXA 2BFEB 3EQZA 1DWQA 2VUTA 4AY6A 4XVHA 4X63A 4BO2A 2XZTA 5TQVA 2I6XA 2B98A 3EZYA 4R84A 4PZLA 5TS3A 1L5SA 1SVMA 5DGHA 5HQ3A 4P86A 2CYCA 2G9NA 1EBBA 2E6UX 2TSYB 5KIAA 2Q4TA 2VQ6A 3HB0A 2PMDA 4G07A 1H0KA 2DLCX 1ZH0A 4YUYA 4ZC1A 3TIGA 2H65A 3EVFA 1VECA 2C4TA 5A9SB 3L7DA 4CKWA 3G0BA 3TKLA 3EZ6A 1MH1A 1XZGA 5L3SA 3A7DA 3UPTA 4RTRA 2PFKA 1XXHA 2YJNA 2E21A 3WKCA 5EIHA 5KKAA 1N6KA 3D4IA 3ONWA 5GMOA 3NHRA 2DVMA 2XDAA 3INGA 3FROA 4P82A 5KVCA 4H31A 3MHTA 2IGBA 3PEEA 2VHUA 3UBMA 4U4AA 3V9AA 3Q7TA 4W5NA 3ETGA 2CBGA 3ZDEA 4LY6A 2POQX 4D9KA 1Z0SA 5K01A 2B8NA 3MJRA 3NBZC 4FDUA 4K9NA 4XKJA 4DR1B 4DBLE 1DQSA 3AY6A 1K6XA 2E37A 4CKWB 1T5DX 1M5UA 3F9IA 1UMCA 5F3WB 1TJNA 1U1IA 3HCDA 4WKNA 5MGNA 2WG2A 2HK8A 4IYJA 3AIMA 2WPDA 5HUHA 1XXHB 5L3SB 4MS3A 3D2AA 3MA0A 1YTLA 4BPBA 5L9AA 3LK6A 1GPLA 2QMQA 1P9WA 5EMNA 5E1MA 2WHPA 1Y6GA 1N0IA 2ILTA 2C4UA 2J31A 3DUFA 4LBYA 3VNAA 3VPSA 1Q3TA 3WYNA 4BVJA 3L7JA 1QHFA 2DFDA 3UJPA 4OYYA 3SN6A 1UQUA 4RY2A 3C5HA 4XR4A 3UEOA 3PXCX 4M46A 5JLAA 3GNTA 2Q45A 3UAYA 4RADA 1W34A 4GGPA 2WSSD 3T6KA 2JDIA 5ALGA 4LDJA 4MS3B 1OI2A 1O6GA 3F6PA 3BSWA 3IXQA 1H05A 1X94A 3X0DA 3A1DA 3KWJA 1DO2A 3PI6A 3D6NB 4H1UA 2VSYA 2WHPB 1BVYF 3HCBA 4US2R 2GTIA 2WILA 2YXPX 3L0ZA 1TK2A 4IQFA 5AKYA 4LC0A 4MVJP 3K2IA 2FPMA 4ZJUA 1GQRA 1B0PA 1JUDA 2JFBA 3QOFA 2BE9A 3VDXA 5E9QA 2JAXA 5K3SA 4ZWNA 3ERCA 1Q74A 5GAJA 1KPGA 1NMXA 4J75A 4NG4A 3GLGA 1CRZA 1V7CA 2HV8A 4N5NA 4YEDA 5LZ7A 2UYOA 3TQQA 1W76A 4UARA 5ALDA 4AJOA 1MAHA 4PS0A 4HUJA 2NP6A 4FXPA 1JX6A 1PV1A 2VIIA 4NBKA 1D2RA 1ZM7A 3GRFA 3ZWNA 3O9MA 5SYMA 4U9IS 1HRKA 1PFWA 4J2HA 2J4CA 3OI7A 1QFJA 4QNMA 4R69A 3O9VA 2OSBA 1CZUA 1O77A 1TT7A 1THZA 3COPA 4G26A 4HAWA 5LZ9A 4ZOQI 1MDFA 2CVFA 4YCSA 1DAMA 5K99A 3A4YA 1DSSG 4FYWA 2FZ5A 1S8OA 1PZGA 3KM0A 3GLGB 5H8WA 3TNFA 5ES3A 3TLEA 4IDFA 4KQKA 5KQPA 1M2KA 4ZI7A 2BC9A 4PG4A 4RDXA 2BGTA 2VQFB 1CUVA 4O29A 5B5SA 1DWUA 3NM5A 2F9FA 4Y6SA 4DQLA 1QV7A 1YS2X 1CVRA 1P8JA 4OJYA 5K0CA 4GOND 1Q84A 4F5ZA 2H2FA 5ESXA 4G0OA 2WLSA 4HPJB 1N2GA 2PSHA 1UFOA 3G2JA 3ZWWA 4EMBA 3O7WA 6LDHA 3I2YX 1XD9A 3IPAA 5EJGA 3UWMA 1J9GA 4HMOA 2WM9B 3AEXA 3MZ0A 4XVUA 3B6MA 1RHJA 3OZDA 3DP7A 3TXXA 1B76A 3ZXIA 2Z3ZA 3W5UA 1NP7A 2EP5A 4A6DA 3LUDA 1BDMA 4HEHA 2GVNA 2H1WA 3EGVA 2WUEA 4G09A 3QEKA 3VISA 3OQ1A 2HIGA 3RBAA 3QMWA 4LZWA 3LGSA 3KDSE 3WL6A 3UFXA 1SKYE 4KQ9A 2Y0CA 2JBAA 1KDYA 4NMHA 1HT3A 1I4EB 1ECFA 2ET6A 3OPYI 1LA2A 3O4GA 3R7FA 3GLTA 1HNNA 2XTJA 4YI5A 1L9KA 1T8WA 4FFBB 5EIAA 3BOSA 4BRSA 1IWOA 1Z8FA 1OBVA 2B5VA 4OQNA 3WY9A 4BGIA 2NACA 3G68A 1D2NA 4JT4A 4E08A 2BEUA 5JEDA 1ZAKA 2HC9A 2PR2A 3L8HA 4UM5A 3TQIA 4BQSA 2OL4A 2QMOA 4P4TA 4AS1A 1Z38A 2JBAB 2R65A 4A8TA 3IQIX 3OM0A 4G8CA 4KV9A 4MQ5A 4WJLA 3HJGA 4S05A 3CEMA 1ZKDA 1Y8ZA 3N74A 3HJRA 2VPXA 4GG1A 1K5HA 3WWOA 1CD5A 4NZPA 2C96A 4NYJR 1E1RA 1KNXA 1Q57A 1P0PA 1U7DA 4RMHA 1IC6A 5G40A 4DR2B 4A2PA 2ZSKA 1SRRA 1QMGA 2GLXA 1IQRA 2QLFA 1P4RA 2IPOA 1GG2A 2JLQA 3CIFA 3G8BA 4KEAA 4BQRA 4UXJA 5AK4A 4DA7A 3KXKA 4OMCA 4Z4HA 1KQOA 2BEUB 3E3MA 5J2TA 1J0AA 1R3DA 1K06A 5HFNA 3ETJA 4DCPA 3T5CA 2FSSA 1SHKA 3TRDA 4BEBA 4DF3A 4PU0A 4F4DA 5KYKA 1CZHA 2I4NA 4XCXA 2O8BB 4OK3A 2X2EA 4FX2A 2P9BA 4U7DA 5K0LA 1SHLA 2GKGA 2VHEA 5FA8A 1IBLB 1AQLA 5P21A 1H3EA 3GFOA 1ATIA 2FUNB 5FA6A 2X1VA 1GGVA 1U8AA 2ID9A 4IRXA 1W1IA 1AB5A 2E4UA 3GF4A 1PIWA 2QAGA 3N07A 4LZOA 4YJKA 3CRMA 2Z43A 3N1UA 3QEOA 1R8XA 5DHQA 2GAJA 4PG5A 3ZQJA 1TZ2A 4O5OA 1ZGZA 4G5SA 3H5WA 2OAGA 2PPVA 2QK4A 1ZWLA 2RGBA 3A4LA 2VK2A 4WN3A 4ZCLA 4W9NA 5H0IA 5GPBA 5B2FA 1D0IA 3PT9A 4XWGA 5A9TA 5GONF 3UAOA 5IDYA 5HJEA 4E7PA 3GT3A 3E48A 1MC5A 4L95C 1YQTA 4NYMR 3UIEA 2V0GA 1AHHA 4RLFA 4F45A 2I3ZA 4JD5A 3ZU3A 1YI1A 2FAXA 4PX3A 3VGPA 1M7BA 4FCCA 2AKAB 2FFQA 4KE9A 4MGEA 5C8VA 3ZVMA 3NRCA 2W6OA 1G64A 4BJ3A 3QOXA 4RABA 3VHRA 4R3UC 4E07A 4E30A 3K2EA 4HLUA 1DJOA 3LZDA 2CL6X 4AZTA 3T61A 3CNQS 1JH8A 4MUXA 5BV7A 5EE3A 4C5AA 3G8DA 3I01A 4MEAA 1SZDA 4QXOA 4ESEA 3W5DA 2WIJA 3NNSA 3QLEA 1ZNXA 4CQNA 1S6YA 4QDKA 1PVOA 1SWWA 4P0TA 3TVYA 5A4FS 1K0UA 3IEXA 3IH5A 2DM6A 1EEHA 1C7FA 3GA0A 4FNAA 5CEJA 2QUAA 1II8A 3IOEA 3EC2A 4GFDA 3DBHA 3QA9A 4GDFA 1W1WA 3IQHX 1Y3FE 2ECOA 3B1FA 3OTGA 4QU5A 5J63A 2QGNA 1GNRA 1T4MA 4MW4A 4DUPA 3BE6A 3K30A 1H8HA 1KS2A 3NAQA 2JJ1D 1E96A 2P6UA 4KH1A 3RYFB 1RLOA 3H11A 5AFSA 3PC4A 1VI2A 1G8JA 1DTEA 3P45A 2WJYA 2IX3A 4X7MA 3EHEA 2XA9A 4NG5A 1KAMA 1R27A 2XYVA 3PE6A 3TM4A 1Z6QA 1II8B 3DBHB 4GVPA 4BTLA 3HXLA 4IJKA 2GWHA 4JLJA 5J1TB 2QW8A 1NXWA 3IUPA 3ZXXA 3H86A 4GSLA 2Q2NA 4X6LA 4DIEA 4F91B 1YR9A 2IY8A 4BLRA 1TIPA 5IRCD 2I3DA 1N0VC 4JYCA 3R0XA 5KWJA 3SLRA 1XK6A 2RHBA 3NM6B 5JAHA 2I03A 2AFIE 3WYEA 3OO1A 3TXAA 3JAMA 1FJXA 1SXIA 2IJGX 4NLLA 5HMLA 3DPUA 2GJAA 3H11B 4C6TA 1ORDA 3BD8A 4FUQA 1O7JA 3A1CA 3U4QA 3JASA 3DAFA 3GZJA 2JFNA 1RFLA 3OUZA 2RHHA 3KVOA 4K88A 2X23A 4ZTUB 4CMCA 4ID3A 3T3GA 3VZRA 1CFJA 3A3OA 3RJMA 1R10A 3RREA 1NRJB 4GX2A 4YAWA 3CEPB 3I9FA 1J07A 2GAOA 1RLUA 1H85A 3HJBA 4CQLA 4GPBA 2WI8A 3N0VA 2AYYA 4IHKA 4TT3A 1GN9A 3ASZA 3GRCA 4DBZA 4MYHA 5TF4A 3L0PA 3CZMA 5CNJA 2LIPA 5CURA 4C6TB 4EUSA 1RXYA 3U4QB 2Q6OA 3JASB 3R23A 1T1EA 2IXBA 3W4JA 1Z6ZA 3HFJA 1CQJA 5AO9A 2NOAA 4DEVA 3K70B 1GG5A 3X1MA 1A88A 4RY8A 1YU6A 2C5GA 1OWMA 1FP4A 2KLHA 2OP0A 4O1MA 1L5RA 4E5UA 5B4UA 1HEUA 4JR0A 4JI1B 4CQLB 1NWHA 2PAFA 4YQFA 3OECA 2FW8A 4RCZA 2EFHB 4LZJA 3QMPA 3OIDA 2OHGA 1JXMA 4MVCA 2RGDA 4UCQA 2LR0A 3E3OA 3CLUD 4D4HA 2B4TO 3CVXA 3VYVA 4TZ6A 2AZDA 3H75A 2B1QA 1QQBA 1T8SA 1TJ4A 2ZRPA 1CQJB 3FKJA 1EFDN 1QZUA 5HYVA 3W9YA 3O91A 3MQ2A 2O06A 1VKOA 4LWQA 5C4MA 1RM0A 1GQOA 1OZGA 1FP4B 3DEKA 5JTTA 5AIBA 2ZIXA 2IKSA 3N05A 4J1QA 2JI9A 1ZGHA 2GRAA 3NXSA 2GPTA 3U31A 4QHYA 1UEXC 4CHTA 3QKWA 4Y2RA 3VPCA 3DA8A 1RVDA 2P9EA 3GVPA 3ZPXA 3RSFA 4PLTA 1B6TA 1DJMA 2IZOA 3MBOA 2F64A 2GNAA 2VHWA 3KK0A 3RO7A 3B7WA 1G7SA 5FL7A 4L8LA 5F64A 3SC3A 3V8VA 2C07A 1YFZA 4A10A 3W9BA 1UAYA 4IEEA 3TGLA 4WZBE 3HCCA 4MUAA 4A0HA 2H7VA 2V97A 4TYWA 2ZIXB 2GBCA 3BRWD 4M22A 4MW7A 1LNZA 2O4UX 1TZMA 4HVTA 2AMYA 4IILA 1XKQA 1GU7A 4HH4A 4Z9YA 2EKQA 5E7MA 1JW9B 4IIGA 4B7UA 4QM6A 3L92A 1VBKA 1LDNA 3ESRA 2VXOA 5AOAA 4TKMA 2AJBA 1CZNA 3HL0A 1SXJA 3PHCA 5E4JA 1ISPA 4A15A 3K0AA 3TLCA 1DIRA 1FVXA 1I4TD 1OLXA 4BLTA 1KJ9A 1L5HA 3NDRA 2AG6A 4G8BA 4S35A 1Q7GA 1XLWA 3PZBA 4G5FA 2ZXUA 1GYQA 4UAUA 2A0YA 4Y3UA 2PZAA 2AOTB 1P2UA 1A9XA 4YJ3A 2J3EA 3AZQA 4CL3A 4BFXA 5BW6B 1KP2A 1IOLA 3VR5H 1IY8A 1Z07A 2DH6A 2HIMA 1BX3A 1U0SY 5CEFA 1VIDA 1Q44A 2CJWA 2QRHA 2M32A 3Q0EA 1G5RA 5FKJA 4FS3A 1P9LA 4L9AA 4P7FA 1SXJB 4ZREA 3IRVA 4N0EA 5FR2A 3K0AB 1Z0FA 3A4NA 2X14A 4KO3S 4TSKA 3REFA 1OLXB 3A32A 5IJAA 1Z12A 2RHMA 2P2YA 5IVDA 3UJCA 4LFAB 1L5HB 3KR2A 3D7MA 4HR7A 3SS8A 1PZHA 1JG6A 3GLVA 5AHKA 1I7SB 3CCFA 3C1AA 5CEEA 1QFZA 2VPQA 1YFKA 4JXJA 4XLLA 1A9XB 1UT8A 4YJ3B 5FBHA 1WUHS 1ZI6A 4AUNA 4ETIA 4F38A 1WMDA 3HNPA 2PRKA 2O54A 2Q5OA 3R5JA 2BFPA 1W0KD 2NTJA 1POWA 4URWR 4RE6A 5LYJF 2CJWB 1RYEA 1YCHA 2YX1A 3PHIA 4RZXA 3OEHA 1G3QA 1PR9A 4ZO4A 2O2IA 621PA 4L4YA 2HSZA 3CTMA 4CIYA 2C0PA 2JCSA 4DLAA 3UV7A 1E89A 3A6KA 2XCSB 2FWPA 2FMIA 4DM4A 2O8CA 5L3RA 1KQGA 1ULSA 1L6IA 3EXHA 3H2BA 3QQPA 2IC5A 3BE5A 1IHUA 3FE2A 3K7EA 4DLSA 1T4GA 4FGSA 1VYHA 1LBIA 1VRWA 3K53A 1OC4A 3BGWA 1Y48E 1PL8A 2HU7A 3DXZA 3PPXA 4I8XA 3GXOA 2UYQA 4NE7A 3SQNA 3VI4B 1UPXA 5ALHA 4TOIA 3R2JA 4F46A 4BNNA 3P1JA 1VSQA 2ZB7A 3MSCA 4OHMA 5EYPB 3CISA 2H2AA 5GM2A 5FPTA 4LW8A 1U0HC 5ELLA 1FFBA 3ENZA 2FRDA 3OETA 4IMJB 4L9SA 2P2CA 5JAMA 4ZVQA 2O8CB 2COKA 3EXHB 2HWUA 3KPYA 2G9VA 3NVMB 1YR3A 2FZKA 3KLBA 2GWRA 1FFAA 4EJSA 3H18A 1WQ4A 1BYIA 1U3VA 4CLHA 1Z6PA 2GM5A 4NOKA 4CFSA 4W5RA 1W2GA 1I4LD 2I6SA 2D2FA 5HR5A 3LSYA 1MX3A 3R0JA 2EATA 3KQUA 4M55A 4YMIA 2PPLA 5DW0A 4HB4A 3RUDA 1MKYA 4BAUA 4IMPA 3SIRA 4MYRA 4EVRA 3PQ2A 3STTA 4YJDA 4OF4A 2AI2A 2GETA 2FMXA 1ZQ1A 2ZJ3A 4YR9A 3CVWA 2JAOA 3PEUA 3UT6A 4M9SA 1JDNA 4MDHA 4Z99A 3UW1A 2HF7A 1IQPA 1DKQA 3VZDA 2WSMA 2PD4A 3UJNA 4PPGA 1OWPA 3D4BA 5AJUA 4IV5A 5B64A 2ZK7A 3B3FA 3FHLA 4ZV7A 2GUGA 2C4VA 3Q41A 5JZSA 1QYDA 4PQEA 1QTNA 3A1TA 2C4MA 2XNJA 4YWJA 4Q24A 5E9AA 1QFXA 3V8EA 4KFTA 1D4ZA 1IEQA 4AP6A 3D0QA 1ORTA 3OD5A 4HO1X 4M1MA 1NQXA 1XLUA 3I8SA 4LBVA 3V4LA 2PZBA 3F1KA 3I64A 1JE0A 4ENQA 4BFZA 5BWNA 3ZVNA 1L4UA 1FNDA 1EU1A 1NDQA 1QVZA 3KYIB 1LBSA 4S24A 4YJHB 4B4DA 2O2CA 4KL8S 3NHLA 3A1EA 4ARAA 2ST1A 2QZSA 1SVOA 3N8KA 5I7UA 3LOQA 4TYMA 5DGCA 2GK7A 4H7FA 3AI3A 1W93A 2QSYA 3QVGA 1CE8B 1X87A 4K5QA 4Y6QA 2VAWA 3TEJA 3C6YA 4X6YA 1UWLA 2ZSUA 5EP1A 2GZ3A 3O3OB 1JAYA 2Q1UA 2Z2IA 4LDQA 4R9NA 1DKOA 2DB3A 3RODA 3U1VA 2KS6A 5JRJA 4DQVA 3A6PC 1F48A 2YCBA 3D7KA 3H2GA 5EHNA 3RIEA 4ZHSA 3O83A 3FNQA 3B60A 2Z1MA 1O6BA 1K6IA 3FSJX 1TLLA 3GWZA 4R6WA 2GA8A 2DECA 1R5JA 2ODBA 1CQIA 5ALKA 3K70C 5JSKA 5DRTA 2JLSA 2XYQA 4MUMA 5K45A 5BN1A 2RI1A 4CM3A 1CU1A 1JDBB 3FF4A 2OD9A 3IMCA 3L7NA 4NHEA 2Z2JA 2FFRA 3W5HA 1OD6A 2DBRA 3CXUA 1J23A 3OTHA 5KPDA 1KVSA 3GAMA 2EYQA 1JHPA 1LF5A 4FDLA 4WPGA 1YRYE 2P75A 2WYVA 4HATA 3GEHA 4I1UA 2QP3A 1G60A 3NBQA 4Y2HA 2IV7A 3OLZA 3KKQA 3CT4A 3BCSA 1IOZA 3HVUA 3OE1A 4MKIA 2XWJI 1E4OA 1YS1X 3R76A 1O6FA 1CQIB 2HBYA 1CDDA 1QM5A 1PVVA 3G17A 3R3HA 2ZXFA 5BYBA 1XNHA 1ZJ4A 2DTDA 2X4DA 3K6RA 3MUOA 4B71A 1BQ3A 2CT8A 1UIMA 5EINA 5TF0A 2FG5A 1EK6A 3R6WA 3LC1O 4CM7A 3DL4A 2IYEA 3JU3A 3QVSA 4C88A 3EQ9A 5HM6A 1FFGA 4XZ3A 4GVLA 4XJSA 4B2IA 4G67A 3F8WA 5FBVB 3QBVA 4AULA 1HKHA 5E2IA 1BMQA 3HVKA 3C3CA 4HLQB 4M9RA 4PF1A 4WKOA 3STWA 1RXIA 1P4HA 1LK7A 1PL0A 3C3PA 4KN5A 1A71A 2WWHA 3FJYA 1BDBA 4PAQA 4PX5A 1U2DA 2EP7A 1U8UA 1RAIA 2J46A 2W2QA 3PFBA 1RQNA 4MITA 1IWPB 2WVJA 5EPEA 3UJ3X 1AXGA 3GGDA 4K6HA 4ARBA 5GJWC 2LBPA 4KLRA 1U63A 2YV3A 4IZOA 3FWPA 5KEIA 2V7TA 1QGAA 5BN3B 3QLVC 1XAIA 2ABWA 4PC6A 3GLIA 2PXAA 4Y2SA 1EI9A 2NYAA 2XCIA 3NKVA 1KAHA 1MR3F 2E1RA 1LBHA 3LD9A 4FCVA 4F11A 2IYWA 2I3GA 1SXHA 2V5AA 3PD1A 4H08A 1GSAA 2DF8A 2P9CA 4MQUA 4YQZA 4B9EA 4DY4A 1UCFA 5K8JB 3BXFA 1QBGA 4Q1DA 5KYVA 3ETDA 4FC6A 3QWFA 4W8OA 1VCNA 1H5QA 2UZIR 4CN8A 3IODA 3R7AA 4F12A 1TB4A 2XUZA 1PQUA 1QANA 1ESNA 2II6A 1C8BA 2MIIA 2QE7A 4CKXA 3AOGA 4D81A 1XZIA 4DDMA 1ZD4A 4JVNA 4O4JF 3GLIB 4F9EA 3ZCTA 1SXJC 4RGBA 3VPBA 3MRXA 3L41A 3BJZA 3SR4A 4F72A 1JHRA 3A28A 2FSIA 3GY0A 4RVNA 1MDBA 5J40A 4EYKA 5JXIA 4IVNA 2H11A 3QVTA 5KX5F 4RTMA 2XB4A 3A2MA 1AGPA 3D8RA 4OHBA 5MN4A 3T3OA 1TQ4A 4PRYA 4G4SO 1JNYA 3MAAC 4MS1A 4C30A 2Z1DA 4XE5A 3TLYA 3ZY2A 1DXQA 2ZIFA 5KSZA 3OY7A 5ER6A 2V5VA 2CNNA 1C29B 3MT8A 1K68A 4JJKA 2XWBF 3EEQA 4MI3A 4Q4JA 4UU7A 4V3BA 3LT1A 2XB2A 2VUHB 5BRJA 1BD4A 3U4IA 1JFFB 3J81A 2GPSA 1YL6A 3S8EA 4RZ2A 4W99A 4WZ6A 3ZIAD 2BL4A 1NMSA 3K16A 2EQAA 3P2MA 2D8AA 3PFIA 4YFYA 4B1FA 4R1MA 4L51A 1K3FA 2FGJA 4MS1B 4BJ6A 5BSKA 2FPIA 2GM4A 1E2BA 3KJGA 5GM1A 5H82A 4AMGA 4IAOA 1W46A 2C8VA 1P5HA 3D3WA 3O0DA 4D7AA 2AG5A 2ZRHA 4DYHA 4Q4JB 4DA4A 2G67A 5CDTA 4D0GA 2BLLA 1E98A 2J7PA 2PWYA 4BX9A 2YOGA 1SOMA 4KR9A 1YNOA 3MGGA 2JFHA 5CGQB 3U7JA 4EGCB 1YVDA 2GCNA 4J0JA 2O50A 3AEUA 4DUYB 5A3QA 1E4VA 1HTTA 3A6DA 2IH2A 2VF4X 3EXHC 4DDKA 2QYSA 1A5TA 4C87A 4S3MA 5HP4A 5BXQC 1U3FA 2BF4A 5A4IS 1ZM4A 4L57A 2FPIB 4D46A 1YJAA 2YMPA 4DQ0A 4NTZA 4RESA 3EULA 1EVIA 3D3WB 3PQ4A 1N6PA 1ODLA 5H5JA 3EEOA 1YR7A 1PFQA 3KL2A 2RKOA 1DAIA 2G1UA 1RKBA 3TSYA 1NLZA 1VJ5A 3F49S 2GPNA 4EWLA 5AESA 3ANYB 3LXXA 1OPXA 2WYHA 3OOWA 4MVJG 3S2FA 1ZZEA 3MFQA 5KYYB 1AGXA 3AEUB 4O5AA 4PPYA 1ZW1A 1SWVA 1M34A 1GN8A 2FRDC 3I9KA 1JAHA 1Y1PA 4RFLA 4PWZA 4HEA1 5JATA 1Z39A 1B1AA 5DM0A 1FXUA 4MQMA 4Z8XA 3SHFA 4ZT6A 4D96A 2XQFA 1F12A 4LSZA 3MTEA 1YK0A 4MV7A 3OF2A 2R3SA 2GERA 2G63A 3PUXA 4RD2A 2O20A 3L8YA 3MTGA 1RM4A 4RJIA 1Q0RA 4F3KA 2HMUA 1QNFA 2R6DA 4EA9A 1DDOA 1YRLA 3M34A 4HG2A 4TYPA 4ZCPA 4X64B 3AJ8A 1RHMA 1YB5A 4UE6A 1NVMB 1U2EA 1XAGA 2PUWA 3B2QA 3BBLA 3BJIC 3G8CA 2HRRA 1KY2A 1TUIA 2GZ1A 2IYAA 4IH9A 4S2UA 3SYLA 3TCXB 3DD5A 4Q7MB 4OQXA 1BFKA 2Q28A 1VL0A 2INGX 1SCAA 4Z5XA 5K8LA 2DSNA 4GZ6A 4N5IX 3TVDA 1MZPA 3M5WA 1NBAA 1JFRA 2BGKA 5CJPA 3ZI0A 4DCJA 1ZLXA 3GRVA 5EKSA 1ZI9A 3QWHA 1JL3A 3WLEA 1MIOA 1G5FA 2HSGA 2G1PA 3KO8A 4XI9A 5F2EA 3ZDYB 2XE7A 4CMKA 4H6PA 5KCZA 2DQ4A 3OX2A 4J7CA 1NPYA 4WIAA 3UYLA 4YRJA 3PDUA 2BEJA 2XT9A 2ZU6A 1QLHA 1QIGA 2DBQA 4CF4A 1L4KA 3HJFA 1UKAA 5LMZA 1UC4B 1X1BA 3FDXA 3D3EA 1IN6A 4G1UC 4Q4DA 2UAGA 1JIUA 1YRHA 1E2EA 4TTPA 3NP9A 2I2BA 5L45A 1Q15A 3WOHA 4U63A 5DJ5A 2EKDA 2XUFA 2ZTSA 4YT5A 3UYKA 1K0FA 4EI9A 1NM5A 5IANA 5ESRA 3OP1A 2I2WA 3WQRA 3IL2A 1MIOB 4FYHA 2WF6A 3Q7QA 1JDBC 1RJFA 1WV0A 3O2QB 4CG3A 2CL0X 1GVNB 1N8NA 5CW2A 1Y37A 3PRYA 5CLIA 5UKDA 5AICA 3ZHUA 3OCXA 4ZZIA 3QEJA 2F59A 2NZXA 5ITZA 1NVXQ 3A36A 3GFTA 2XLBA 2DH5A 4BL5A 3HDJA 1V4NA 3T0FA 2BTQB 5I7WA 1BHJA 5IAKA 2B0CA 5FT9A 3ZV6A 5JAOA 5FOSA 2ATVA 3MB8A 3PUYA 3BZWA 3NAMA 4QLOA 3EFOA 4MV4A 4XM1A 1LI7A 2IEDA 3NUGA 1I7LA 4EUEA 3PL5A 3EAQA 1QKJA 2RIRA 3ZHOA 4EMUA