5ESWA

Crystal structure of apo hypoxanthine-guanine phosphoribosyltransferase from legionella pneumophila
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
190
structure length
190
Chain Sequence
HHMTIPDKIKAVYEKSTCLYTSNEVEAALDRMAIKIHETLQDKNPVIICVMVGGLVPLGNLLHRLDFPLEVDYVHATRYRGDLTGGDILWKVRPSSNLAGRTVLVVDDILDGGITLAAIINEIKAMGAAEVYSAVLVDKYRKRVPNGLQKADFVGLQVEDHYIFGYGMDYHEYLRNAPGIFIVHPDHEAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Apo and GMP bound hypoxanthine-guanine phosphoribosyltransferase from Legionella pneumophila and the implications in gouty arthritis
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila strain philadelphia 1
molecule tags Transferase
molecule keywords Purine/pyrimidine phosphoribosyltransferase
total genus 54
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5eswA00
4WMLA 2DY0A 2PS1A 3G6WA 1NULA 4X45A 1STOA 1GRVA 2XBUA 1QK4A 1OPRA 1DKUA 1QB8A 1U9ZA 4RHYA 3OZFA 3GGCA 1A98A 1MZVA 4P81A 1G2QA 3S5JA 1P18A 3ACDA 1OROA 1QB7A 3EFHA 1J7JA 4LZOA 3MJDA 3M3HA 1ECGA 2PRYA 4RAQA 4RQAA 1XTTA 4QRIA 5K51A 1P19A 5IPFA 1UPUA 4MB6A 1QCCA 1R3UA 5IAOA 1I13A 1XTUA 2P1ZA 1ECFA 4JLSA 1QCDA 4QYIB 2JI4A 2PRZA 1V9SA 1BZYA 2WNSA 3LRTA 4TWBA 1NONA 4LYGA 1ECCA 2JKZA 3HVUA 1QK5A 4M0UA 5BSKA 4OHCA 1XZNA 4QYIA 4RANA 5HKLA 2GEBA 4RV4A 4F8EA 4IJQA 1XTVA 2H08A 1L1RA 2HCRA 4P86A 1P17A 1CJBA 1LH0A 1OREA 1P4AA 1ZN9A 4PFQA 3GGJA 4S2UA 1U9YA 4P80A 5KAPA 3N2LA 1FSGA 3GEPA 4ZFNA 1JLSA 4RADA 4LYYA 1BD4A 1G9SA 5BQOA 1G9TA 2C4KA 1A95A 2IGBA 4RQBA 4PAWA 1G2PA 1O5OA 3MBIA 1VSTA 1ECJA 3QW4B 1GPH1 3LPNA 1Y0BA 3OHPA 4LZNA 1ECBA 4RHTA 1HMPA 2JBHA 1PZMA 1WD5A 1I0LA 1DBRA 1UFRA 1I5EA 3KB8A 1I0IA 4RABA 1A96A 1QK3A 3OZGA 4WN3A 5E38A 1TC2A 2YZKA 5ESXA 1L1QA 4X44A 5HIAA 1O57A 4P82A 4M0PA 1D6NA 3DMPA 4P84A 4RACA 5JV5A 1JLRA 1HGXA 5BQPA 2H07A 1ZN8A 1UPFA 5BRNA 3ACCA 1I14A 4P3KA 1XZ8A 1BD3A 1A3CA 3NAGA 4P83A 2E55A 5KAMA 1VCHA 2EHJA 4Z1OA 2VFAA 4FYMA 2FXVA 4M0KA 1AO0A 5ESWA 5JSQA 1YFZA 3ACBA 3H83A 1VDMA 1DKRA 1Z7GA 4KN6A 1DQNA 3DAHA 2AEEA 1ZN7A 1A4XA 4JITA 1DQPA 1IBSA 3DEZA 2JKYA 4RHXA 1TC1A 4RAOA 2H06A 1W30A 5EUCA 3O7MA 4LZAA 4RHUA 1A97A
chains in the Genus database with same CATH superfamily
3HACA 4ER3A 1VLLA 3TTSA 3B1XA 5A5GA 1R4NA 2DQ4A 4B0OA 3PXGA 1INLA 3CTMA 3DMRA 3HJGA 4OO3A 2QP3A 4DS3A 3GDGA 2A88A 3UXYA 2GBLC 4LVOA 3T52A 1R0BA 1JQDA 4K05A 4QUEA 3KOMA 2JFYA 1C4WA 1AGYA 3L6DA 4YJ3B 5AI4A 3T7RA 1KZ6A 3ESAA 3ONFA 4F5DA 3X1WA 3C3DA 1ZR2A 1MGOA 4F2WA 4YONB 5CLHA 2F43B 1CCWA 3LXXA 3DVLA 2BFCA 2O3RA 4X3PA 1NXTA 3CE6A 1TYEB 2WA2A 1OCEA 1RABA 5HRUA 1U7DA 4J3JA 1FXWA 3JQPA 2JFFA 2FU5C 3B70A 3JYPA 3WSWA 1MF7A 1NOJA 1WMFA 1T29A 5DYNA 3SHWA 3LQYA 4J29A 2GVNA 1NLUA 2P1ZA 5JSUA 5FX2A 2H85A 4JL6A 5EWMA 1FL9A 1WOYA 1CR2A 4WCDA 4RJIA 4DIBA 1KDOA 4K26A 3PNLA 4O4HF 4CMJA 4BNIA 4PHCA 5IMBA 4NBUA 5IDQA 4F3CA 3QBDA 1U2RA 3B1JA 2NW6A 2ZRCA 1WRBA 3NXSA 1E7MA 3HBAA 4IRXA 4WEOA 5A4KA 2HBYA 1CBUA 1NUQA 3SZ3A 1DQYA 4LYYA 2FW9A 5BQOA 1YFLA 3IXQA 4RTMA 2WJGA 4HAYA 5HK9A 1C9JA 1NUPA 1XOIA 4DNXA 1OYYA 1YDEA 2Q6LA 1YI1A 3DEJA 3NX4A 3L6RA 1FBNA 2VBCA 1PT5A 1UXOA 4DUZB 2E4YA 2PEZA 4HYTA 4B8YA 4HS9A 4L5AA 4I50F 4E5KA 5BNTA 5AW2A 3ZDAA 2L69A 3DKPA 3FZQA 1LBQA 4UM5A 4I5EA 2QA5A 3K5WA 2FFBA 3VAAA 3FPKA 4OI4A 2MT9A 3H6GA 3W77A 2ONZA 3GA5A 3KZCA 4B2PA 4KVAA 1XZBA 3G1UA 4ZMRA 1M6EX 2Z8ZA 3I3SR 4JXJA 4PIMA 5H82A 3VHXA 4LHXA 4ZDIA 1M1NB 5BPFA 1OXSC 2JA2A 4OHPA 4HAIA 4ALKA 5I9NA 1XJ0A 3NTRA 3SS9X 5CD1A 3K4HA 2OSBA 3UENA 2O2SA 2WJZB 5E3HA 4O4IF 1DINA 2XQVA 4RH1A 4MV7A 4M1EA 4DLXA 3U7HB 2ST1A 3ZX5A 2FN8A 4ZOLF 4YUAA 5KQSA 4EHNA 5FUQA 1D2GA 3SQDA 1LBTA 1Q6YA 5JS8A 1Z8NA 5K6TA 4CMIB 1O54A 2AMFA 1FDSA 1D0SA 3PQ3A 3LWZA 4BOYA 5JQGA 2RGEA 4PNHA 5DT2A 4BQRA 1GXSA 3QMWA 2TMYA 4PM4A 2PKWA 4AJ1A 4MIEA 3E3NA 2OHFA 1Z34A 1BMFA 2K87A 4XLLA 3LYUA 4Q19A 1WW3A 3RB8A 1BE8A 1ORRA 1BEEA 3GXOA 1GQYA 5IFLA 2PR2A 4B6EA 2DTXA 3BK1A 1MMFB 4NOJA 1F14A 2ZZKA 2J3KA 2RBKA 3AVWA 1GR1A 3NETA 1MIOA 2ABWA 3FR8A 3W3AH 4ENTA 4Q3DA 3ID6C 4KSYA 1SG9A 3RHFA 5AUOB 2FK8A 5LLSA 4FMCB 1M34A 4R51A 1KMQA 3MPOA 4ZCQA 3V00A 2AZDA 1U7XA 3BHMA 1D2NA 2ZS8A 4Q7QA 4BLTA 1HT1E 2YJTD 3UMVA 1JL3A 2WWGA 4FR2A 1G5RA 5ENVA 3K73O 4HH1A 4C0BA 3WLIA 2CF5A 4DMFA 3GLIE 1E8MA 3LIIA 1WZCA 4TL6A 2M6RA 3PDCA 5HTKA 3GT4A 4CLDA 1ECGA 3CEJA 3IT1A 1PJZA 3USES 1ZCJA 3OEWA 4HX9A 1F1BA 4ZVUA 5JHHB 5IUNC 3QE9Y 5CT4A 4NPAA 2XLCA 2NU7A 2ZU6A 4NPCA 1CHDA 2ORIA 3TBHA 4BFXA 1EFKA 5I3ZA 3ZI7A 4DYDA 3LBIA 1USVA 5BV7A 1L4HA 1HE1C 3GELA 3SKXA 3K0HA 1PS8A 4EITA 3M3DA 3TXAA 1WDMA 4GZLA 2D0PB 1P5RA 4KUEA 1Q5PA 1EBUA 4L3OA 4W99A 5C46F 4J16A 5ITZB 1YTUA 3QFRA 1NTRA 4FOPA 4IDFA 4LJ4A 4O2BA 1XEWY 2Q45A 3WRWA 1U0OC 4IJQA 3GHHA 5CNJA 1KPGA 2B1JA 1XG5A 1IZ8A 1ZUIA 1ZN9A 2QJRA 1GSHA 2GB4A 2KE5A 3B1KA 3HU5A 4JJZA 2WINI 3GJYA 4UBKA 3R5XA 5K3DA 3WGYA 5I7UA 1RZ3A 4G4JA 4OQXA 2W2KB 2RAUA 3C5EA 3IAS1 2XPCA 2JGMA 3ZGVA 3VO9A 2WHPB 5JU6A 1XP8A 3CUKA 1NXPA 1Y9AA 4WZZA 4TV9B 3C4QA 4IJWA 1L7XA 2G04A 2NVOA 3NWJA 4M6WB 3UMFA 4DCMA 3OFVA 4MQFB 1AGRA 4NCIA 1GKLA 1DXQA 1N7GA 4RFVA 4CTOA 4RVNA 5HF6A 5I9LA 1ODJA 1WLSA 2XV1A 3QTTA 5IKPA 2QL7A 2OLKA 4BWFB 1NVVQ 5K3EA 1IPFA 3FRHA 1YONA 3NDRA 1PFKA 1L7BA 1DKQA 1LLQA 1H1LA 2R8OA 2JAXA 4A6XA 1H2EA 5L3VA 4UFOA 2WVHA 4GDFA 2YJGA 4WNAB 5ALWA 5LP1A 4YCNA 1V16A 4GM4A 1TADA 1NI4A 3CNOA 4LJKA 1E32A 4BNKA 1Y4DE 2QZ9A 2Y1XA 1WAMA 2Q1SA 1KR2A 3U4GA 3U9SA 3L40A 5JUWA 1YS2X 3MS7A 3A1EA 3D5TA 4OIMA 1D7AA 5P21A 3WI7A 2VTBB 2Q4TA 5TQJA 1MU0A 2XGOA 3RFCA 2K2WA 2E7ZA 4ZKEA 1CV2A 2A6PA 3ZXUB 4OP1A 2C83A 1U3FA 4FFLA 1W4LA 4HC4A 1R1DA 3M33A 4HDSA 4N5IX 4OAOA 2I2XB 2OT3B 1MAAA 1TCCA 4JLUA 1GTSA 3KEQA 1OZFA 1SFRA 1VL8A 3KRTA 3LOQA 3RNOA 1VDMA 4DDHA 5JCOC 1YB2A 4WLOA 2NU9A 2IEYA 1RIIA 2WMYA 4TT3A 3D6NB 4KL8S 2I7VA 3DEZA 1BE6A 4LYJA 1WLYA 1VXOA 1A50B 3UJPA 1DC5A 1Y4ZA 3HXLA 2G9NA 5B6IA 5CD9A 1X8JA 3JU3A 2FQWA 4WI1A 2WM8A 1J8FA 1DEAA 4TV8B 1H42A 4F1KA 2I7TA 5KJCA 5JPIA 1F8FA 2V7UA 2YW2A 3O1JC 5JY6A 1G5IA 1KSJA 2G9ZA 3I9V6 1C29B 1BYUA 3HKDA 3ZWQA 2QUIA 4Z4FA 2R4QA 4FHZA 4US0R 1DKUA 3A6EA 4CWAA 4TL8A 2BGWA 4R9NA 4KK4A 1V3QE 1ATZA 1DG3A 4Y2YA 1GFWA 2Q2NA 3TEMA 3ZHVA 2O5RA 3AOEA 3CCBA 3ZJTA 1WMEA 3KHSA 1J7JA 1J1ZA 3MCZA 4Q01A 4XB2A 1CUBA 3NKLA 5B1DA 1AVTA 2IXGA 4OFZA 3OSUA 3HVHA 2G08A 5IJAA 4C6TB 1IBKB 1T0JB 5BSVA 1VP9A 2P8JA 3SYNA 2VZLA 4AWXA 2QHXA 2GEVA 4PLTA 3K0EA 4EJ6A 2JAPA 4GR9A 4KBGA 3MOGA 1VJRA 2JPDA 2WJ6A 4EATA 3NNDA 1GQ2A 1Z3IX 3T3DA 3Q40A 2FDRA 4CN8A 1EUCB 1OGIA 3NDBB 2I7CA 5HKOA 3BFJA 4I81A 5HZHA 4HNQA 3F9IA 3K0FA 4W5HA 3AR6A 1JSLA 4L27A 1IM2A 1UBOS 1IHUA 4Y0AA 2GHTA 4B3TB 1IJFA 4FQ8A 1G20E 1Y5MA 4E5YA 2DT5A 4RXTA 1OX4B 2OB2A 5I48A 5HOQA 1N2XA 2GPAA 3QUQA 1UMCA 4OMFG 1C3JA 3OCWA 2BJWA 1NN1A 5AOVA 3T7DA 5LU9A 1R4NB 4BKQA 4KIFA 2CDAA 3GLHA 3U2QA 3VKUA 3OJ0A 4A0FA 2VT7A 2R7KA 5DLQC 4BFTA 4BPBA 1I4LD 4N48A 2WFLA 2X15A 5B7QA 5ELLA 3K6JA 1U8CB 3FTCA 3G5LA 4H4DA 4CHTA 3LLUA 4DCJA 2HF2A 2BF7A 2AZTA 2ZUWA 1U2GC 5AK3A 4Z7JA 5L40A 1T9GR 3HWX1 2V58A 3OKFA 5C4MA 1ZD2P 1NDUA 3AK4A 4RA6A 2GETA 1HT2E 3ZR4B 4RY9A 1FP1D 4UREA 4PYOA 3N2EA 2AN4A 4TQAA 2O4CA 3WSTA 5IZCC 1KEPA 4CQJA 3KLBA 2C31A 1A9XB 1NG1A 3MTAA 3EZLA 1N8NA 3BA6A 1L5MA 3FIJA 2CL7X 4FGUA 4PPFA 1XLWA 4MVXA 3BUSA 1WQ3A 1HORA 2Q5QA 3WL6A 3MT7A 5ITVA 4TPKA 4Z4HA 3G2KA 2PGOA 4OFWA 1CUEA 2WHYA 2C4VA 4D8VA 5KDDA 4GX2A 2O7SA 4Y1FA 4GZMA 2FMHA 3D2BA 1ADCA 3OZTA 4MUMA 1EFTA 3OMXA 3PUXA 4ITVA 2QGFA 4UUNA 1JJVA 5T3YA 4R1LA 4ZRMA 5CA1B 3PEFA 4C0JA 1XUOA 3AXTA 4NU5A 4Q66C 3OIVA 4MWSA 4NP6A 4R1PA 3U0VA 3TW6A 1E79D 5CB4A 4PZYA 3OBIA 2TMKA 3WQRA 1V41E 2FP4A 3R41A 4RIIA 4MCHA 5KNBH 3LBHA 1CRZA 1TYZA 5FPHA 2AR9A 5LBUA 3SICE 5EHZA 3AEKB 2PIDA 2P9HA 3AF1A 2PR7A 2ZTVA 2BR4A 5B12A 3TZ6A 2JL1A 4EIWA 3MM4A 1CDEA 5JS1A 3RWBA 1QYWA 2UYGA 2NO9A 4Z8YA 3R7LA 3R7SA 2PSEA 4FQ7A 3C2QA 3ASYA 1O95D 2MINA 5GJWC 2ZSDA 2C9DA 3E84A 4KNVA 1N1EA 4B7CA 5AVQA 1RAEA 2OHGA 1XZEA 4PVCA 5JRJA 1JDTA 1BU8A 2D2IA 4P9NA 2R7MA 1EGMB 1AOXA 4QELA 4BZQA 5B7NA 5E2BA 2XUHA 1D2HA 1T3SA 3FOAA 4RESA 2H65A 3BREA 3BGIA 4RBNA 1GL6A 4V0MA 4QUGA 1NHWA 2H9YA 1UPAA 4V38A 4I50A 3WRYC 3ZJYA 4AF7A 1Y5RA 5A4FS 4PGFA 3HXTA 4LRUA 1KFKB 1YCGA 1V3TA 3OZFA 1FTNA 3RSHA 3H97A 1EXNA 3NPMA 3PICA 1XZLA 4UEQA 1KMCA 3F78A 1ZOOA 2CVHA 1N32B 3O4GA 4XGKA 3L6BA 1OH6A 1MX9A 5JC1A 2AXNA 3I30X 3G88A 2CDBA 3QNUA 1KJYA 5FDFA 1G4UR 4BYGA 1Q0SA 2WVGA 2EZ8A 2JAOA 1U2ZA 3KYCA 5AJXA 4D1YA 5EIAA 3BQ9A 2WABA 1U1FA 3CUUA 4JJIA 4EO9A 1TT7A 2G76A 4MQMA 4YMLA 1FU7A 3EUWA 1NF8A 1FW6A 3PKJA 4NNPA 4IDNA 3VGJA 1DQRA 3K9CA 4EG5A 2ID8A 4M3NA 4BGVA 1TYBE 3TXYA 1MX3A 3WNBA 1RHJA 4PPQA 2XHEA 3SJUA 4U2GA 4ZDKA 4JP1A 3CX8A 4I1RA 3VPDA 4FFDA 4M89A 2HW8A 4UBMA 3B53X 5ALXA 1Z2OX 2ZUUA 4K9SA 3IURA 2Q27A 3TKLA 1XLTC 5J4HA 1QO0D 2C7BA 2PMBA 2PLAA 5EMHA 5FWAA 5A4JA 3ZE1B 5KPDA 1I7LA 2Q3FA 1BA3A 5P8WA 4PYQA 1YZQA 4G5GA 1AK9A 1NIJA 2C3UA 4HQFA 3ZCVA 3HB0A 4GPZA 1PK7A 1SCQA 1EX6A 3ETEA 4HP8A 2O0LA 1GPWB 5EPUA 4XWWA 3TS1A 4KGVA 4M46A 4KIGA 2ZRAA 3ZUPA 4L16A 1HOXA 1YHNA 1VZ3A 2WOOA 2EWMA 2XWQA 3FZEA 2YBEA 3EGEA 2WMDA 5F21A 3R75A 4E2XA 1T1JA 3MA0A 2ZT7A 2Q1YA 3KOOA 1A9RA 4F4JA 4Q24A 4OU5A 3L8HA 4ZVRA 1EVYA 4UHFA 3RT1A 2ZGVA 1SAYA 3QEMA 4ICIA 3ZV5A 1UJNA 4JUDX 2WQ6A 3DUFB 2IS1A 1SCBA 1Y9DA 1BH6A 4F9TA 2ZBGA 2MYNA 1D4FA 3NRBA 2B1IA 2JVJA 1CJUC 4IHKA 1WO8A 1DAHA 2VSOA 4PS1A 1KYYA 4MGKR 4QG7A 4UHEA 3RCBA 2C00A 2OTCA 2IH5A 1PR1A 3OQNA 2QB5A 1ENOA 4UNPA 1XDBA 2A9KA 2J0EA 3CYFA 4PSDA 3TR5A 1GZ5A 5G02A 2VDKB 1UT5A 5DYTA 2LD4A 2XOKA 1JQLB 4MI6A 3Q7TA 1XCMA 2DBQA 4INPA 4L9RA 2LKDA 1VCHA 1T13A 1E9EA 4HYYA 4D45A 1GT6A 5AMXA 5E7QA 4DWVA 1M0EA 2CWDA 2HN9A 1G4AE 1X6VA 1Y8QA 3DLCA 3L1IA 3VPHA 3BJIC 3STVA 3ZV4A 4B5LA 3H3FA 1KZ9A 1OJ7A 2FF5A 4MI1A 1GYRA 2ZVQX 4MPPA 3ZE6A 1DQNA 4S1NA 1DX4A 3I37X 3IUYA 5LQRA 2N75A 2EERA 3BA1A 1ZXLA 4Y6OA 4COOA 1YBHA 3A1FA 3MSXA 1C14A 3R5KA 4N03A 1BCRA 5FWXA 3AYZB 1Q77A 2PGNA 3ILVA 3ZX4A 4N01A 4BIIA 1ZR4A 4Q9NA 1II8B 2FX3A 1VG1A 1ZDMA 5AJZA 3GB9A 4ARZA 1VG8A 3MJHA 2XI4A 1U0EA 3MJSA 1AT1A 1DMSA 2XA2A 1RPAA 3IDOA 1X1EA 5LMZA 1AKTA 2QNIA 1ZA2A 1VCIA 2XGMA 4G86A 4M98A 5FV7A 3SZLA 2Z6QA 2WD8A 1EMDA 4Q9IA 5LMCA 1DRVA 1OV4A 3TZCA 1NQVA 3KELA 2ILVA 4JOQA 5H80A 1JQAA 2XZDA 2HK8A 3S1AB 4RSRA 1E6EA 1T1SA 4FFRA 3V42A 4C3ZA 4E2WA 4L4YA 4YN3A 5JH7B 4RZHA 5K1ZA 3W2FA 1E2JA 5K0TA 2QK4A 1SUPA 4I3GA 3AF5A 2H2DA 2NZXA 3S1LA 5KKNB 3UMMA 2Q41A 5J1TB 2AFIA 2PRSA 4CHGA 1QU3A 4OQ4A 1NVUQ 4LHYA 1TKRA 4P3XA 1G3RA 2GN1A 1SKYB 1JWLA 4D26A 1FJGB 4K9OA 4NG4A 5JROA 2W6PA 3PG5A 3AF2A 1K08A 3EDMA 1G3IA 3I6BA 2QTRA 2QRMA 2X1MA 3TSWA 4GC9A 1TT5B 3E9QA 3Q5GA 4D44A 3IR5A 1ELOA 3K1JA 4HN2A 3T7AA 3E22B 4CT4B 3LQFA 1JHUA 5DVZA 2WKPA 3WHLA 5AKJA 5G3ZA 5KKAA 4MPJA 4YMHA 1IN6A 3NVAA 1SWWA 1BCSB 1POWA 4RLHA 4U2DA 1T2VA 4A8JC 4UBNA 3U17A 1NOIA 3ZYZA 4OUDB 1ZIPA 3IQDB 4W9NC 5LC1A 3T5PA 4GNRA 3U7QB 5WRFA 3CLSC 4MYSA 4BNHA 4UUAA 4EKNB 1X39A 3RJ5A 1MX1A 4FHEA 4LJLA 4RO0A 2J67A 2QTMA 2RBGA 3QQPA 4RXMA 3ANYB 3PGJA 1TXGA 1EA5A 1GA6A 1ZX1A 3VZCA 3ZW9A 1QIMA 2OY0A 4RSHA 1UZAA 3GO4A 3AG5A 2PZLA 3TLEA 2ZYSA 5KYYB 3C98A 3QBEA 5JD6A 3DF9A 3TLKA 3N0RA 3RRNA 3F9RA 2PT5A 2ZDQA 3H86A 1AK2A 2W6ID 4DBZA 2B9EA 4GG1A 3ZCSA 3HP7A 1TNDA 2DWCA 4CMIA 5C8YB 1FYVA 2HJSA 3CEHA 1T36A 3A6KA 1YMQA 3DAGA 1GZVA 5BYBA 5K45A 1SWVA 3DKRA 4D8UA 3P9ZA 4S1WA 3R8FA 5J40A 1E63A 1XTIA 2X9LA 4HI0E 4U0KA 1Z4KA 1E6UA 4XFJA 5AM5A 1Y9EA 3EW7A 5AM2A 3F5FA 5H0IA 3H16A 3OPQA 5BRNA 1YZVA 2LIVA 3U6BA 4RVSA 1CIVA 3NHBA 2JGDA 3BL6A 3D3NA 3UJHA 3EODA 1Q50A 5D01A 3FRJA 4YALA 3ZU5A 4QDTA 3GCDA 5AT1A 2GSDA 4CDRA 5JSHA 2J0UB 3VZQA 4A23A 1Q0ZA 1ZLXA 3I6IA 2XGJA 4E11A 5JSQA 3BX1A 1XEFA 3GLFE 3NYRA 4YFVA 1ZD1A 2WF5A 3R7DA 2C57A 1GCUA 1US8B 3HYCA 4IH9A 4Y9DA 1RLUA 1X7WB 4C06A 1JP7A 2WAXA 4C5AA 1JHRA 1KVSA 1QC5A 1W0KD 3E0QA 1DLJA 3GZJA 2A1TR 4D4IA 4C4AA 2PG3A 4CI9A 4F11A 2O4UX 2PL5A 4EM6A 5EPOA 3BGSA 3M0EA 4ZT3A 4M87A 3ER9A 2QG9A 2EJBA 3M3PA 4DLVA 1F4LA 2PSSA 4BVGA 2QTWB 1Y1QA 2XBMA 1PYOA 1FPMA 4F12A 1ZK1A 1C3OB 4EECA 1A9PA 2P69A 4PZ0A 2P9TA 5AJTA 3AVUA 3GVIA 3GAMA 1J1UA 3WHKA 3L5OA 4RXUA 5T4HA 3ZZ0A 2VDLB 3MFQA 4ZOQI 4H27A 4Q7MB 4DGQA 3CXRA 4PYKA 1DNPA 3OQOA 1YOVA 4EYQA 1KETA 2R6FA 3QGMA 1NZFA 3E5HA 4HF7A 1D1TA 2HNBA 4HMQA 2D5BA 4NJEB 4UEOA 1VFNA 4TMZA 3TFOA 3QF4B 3I62A 4TTQA 4YMVA 5KHLB 4RSMA 4IVRA 4U02A 2VSFA 4OYRA 1LJLA 1DHTA 1JR2A 2DSNA 3OX1A 4AMBA 2GAOA 1YBVA 4AMUA 5F35A 2FGJA 3AHJA 3CW9A 3EEBA 4UNQA 3X1ZA 2FOXA 3EYAA 1PT6A 1V5EA 4WBSA 4OBXA 1W5SA 5KJFA 1ESEA 4ZVOA 2RKBA 3C41J 2PL1A 4H0NA 1PD1A 3PNQA 1HLGA 3GJ3A 2PX3A 3JX9A 2K6GA 3N28A 3GJZA 1V25A 1P5HA 1EJ0A 1ZOPA 3B20A 3G0BA 4M7RA 4FMBB 2QD5A 3TD9A 3AVXA 3U48A 1UQRA 3QELB 2WBLC 3I01A 4LDRA 2W6CX 3DHYA 4UM7A 5K3FB 3H4IA 3TZLA 3GP3A 2VQEB 3GEPA 5KTRA 3WZMA 3PVSA 4YJ2F 1KDRA 1CUWA 3ZDYB 4DHEA 4ABTA 1LDGA 4WVFA 4PPGA 4JJ6A 3VJRA 2QNBA 3NHFA 1DC3A 1HA3A 4WLFA 5GOTA 3TOXA 4ALLA 2BP7B 3OMLA 3Q3CA 3RHZA 4HNGA 4EFMA 1UZNA 1WZNA 5AVTA 1KTVA 4UQPA 4X85A 4ZAVA 2G9QA 2XAUA 4KO3S 2P2ZA 2X0FA 3LX6A 1CQJA 1HYBA 3OT1B 3NQ41 4DR7B 1QONA 5BWLA 1Y5IA 4N6OA 4Z8XA 1WZIA 3MUNA 4Y6SA 4ANFA 4WCFB 3QVMA 3QXSA 1Z2DA 1XMQB 1Y1KE 1F8GA 3UEOA 2YWFA 1CULC 2I4TA 3JRNA 4G97A 5DGTA 2IVFA 3UVEA 3CWCA 4EUSA 3MTJA 1DUVG 7MHTA 2O48X 3U09A 3KXLA 2XZTA 1JXQA 3I04A 5EFOA 3R7WA 4OLHA 4BNDA 1UXIA 3DBIA 3V7UA 4MW0A 1FFHA 1YULA 3B6JA 4X1YA 5HZKA 2FXVA 4Q7KA 2NXJA 4U00A 3T99A 1J49A 1LNQA 3M81A 4JUAA 1V5FA 2VHEA 4NY1A 4B8WA 3D64A 4KX3A 2IVZA 4DIOA 3OESA 3TR6A 3MINB 4GGOA 3ZBPA 1C9NA 1XVTA 1ZZGA 3RAGA 5JAOA 2AEEA 4BKRA 3LCMA 2OV4A 1K66A 5LQMA 4UVDA 3IP8A 1FE8A 3RUPA 5B7PA 3RABA 1VQ1A 2RCNA 2OG2A 2V7EA 2XRYA 3FFWA 4KR0A 1O4WA 1ZUNA 2AXPA 2R7AA 1THZA 4IL5A 4IYJA 2VQSA 2RH4A 4DT1A 4PYMA 4MWCA 2FPXA 4PLYA 4TWRA 1A97A 5HKAA 4GI2A 2B6HA 3LVRE 1USGA 4LWZA 1P73A 3SWWA 1JIXA 1L8AA 2ZI7A 1Y3BE 1YDWA 2M2IA 2MIIA 4Y1RA 3IAM6 4Y2SA 4DRYA 1I3NA 3ZXSA 2C8JA 4Y6QA 2ACKA 4EGCB 1WZ2A 3MF4A 5DTMA 1LRJA 5JH7F 1AN0A 3KD3A 3UB2A 1CUGA 1XV5A 2WNIA 1RPZA 2ZDHA 1OLUB 5F51A 4LGCA 2DBRA 1CEYA 4OJNA 3ZHSA 4PQFA 1XZCA 2BMDA 2G0NA 4FQ5A 2DC1A 3Q1KA 2DPMA 2DY1A 2CZGA 2ZQZA 3EG9A 1ZVMA 3WBBA 3SHOA 4Y2UA 2FRDC 5HR5A 1VGRA 1DGQA 3ZD6A 2XXJA 1C41A 1NUTA 1I3MA 4KQHA 1RYNA 4E0BA 1C50A 1K8ZB 1RR6A 1S96A 2BUCA 3IAEA 4YAKA 1JEEA 3G49A 4OOEA 4PSKA 3DEIA 1HNZB 2YX1A 3I32A 3EEFA 2A0UA 4UEJA 3TAHA 4HLQB 1ZJ6A 1SB8A 3MCWA 3FPSA 1UCFA 5TGTA 7REQA 1OXBB 1Z0SA 1VMDA 3V4LA 3F6EX 4H3SA 2QM8A 2ZOSA 4U2EA 4G09A 1GN9A 3WYBA 4GXRA 3TI9A 2XEDA 1SN7A 1VCNA 3EVFA 4IXWA 1YIDA 4REOA 1YQEA 2Q62A 5K0NA 3RIMA 1S3SA 3AHIA 3S27A 3LBAA 3LYAA 3ZQ4A 5EP1A 4L72A 3GLKA 1NRWA 1NUSA 1XQXA 2WUGA 1RAIA 4D97A 3HGTA 1UMCB 4FBLA 2HM7A 2HWXA 5DBFA 4C04A 5JWOA 4RTJA 1V71A 4ER0A 9ATCA 4G0VA 3C3CA 4F9EA 3BXXA 1EK5A 3RT7A 4OHMA 5KOHB 2A57A 2XNCA 1OB2A 1TQ8A 2IEZA 4YRDA 4N7MA 4AN4A 4NBSA 5DHUA 8LDHA 2KM1A 5EWJA 5J9FA 5TQ0B 5LZ9A 1NM5C 1V37A 2CXPA 1K75A 4QQFA 4WOBA 4E5UA 2ETXA 4INJA 4P4UA 3SBXA 2ZBFA 1CDZA 2Q6VA 2ZAOA 3CR3C 3UV6A 3PF9A 3X1DA 4C20A 1L6IA 2GN8A 2W6MA 4GBED 1Z3CA 3U3JA 1JHOA 3UWMA 3IQIX 4OI1A 3EXIB 3PS9A 1UPXA 1W76A 5FL3A 3LBNA 3CLUD 3TUZC 2JB9A 3OHSX 2GCEA 2XDQA 3RVLA 1QGOA 4AO6A 4HHEA 3AUAA 3PLRA 2WHRA 2WM2A 1T2FA 1GM5A 3CF4A 1ZCAA 1E6LA 2VPYA 3C3JA 1IZ9A 4UJ3A 2JFBA 4ZA2A 4AI6A 2YYZA 4YRPA 2GT1A 4ZGGA 1MR3F 4X93A 3BXEA 9GPBA 1O97D 1RJFA 2I62A 1E8DA 2E4VA 3IPCA 5HMLA 1AF4A 2YIJA 3ZBTA 1L7NA 3KEMA 4H6XA 2YN2A 2QVXX 1R0ZA 4KQGA 4KQKA 4CG0A 1NBOA 1LKZA 3EDYA 3TK1A 1FXWF 2OVFA 1F2VA 2DCUA 5JJIA 1ZMOA 3GVXA 1U9IC 1E1RA 3PE3A 2LZ0A 3A2NA 3NZEA 4Q4LA 4QOJA 2G88A 2IODA 3LPLA 5IJ0B 3OCXA 3R5HA 4F3YA 4CLRB 4H7HA 2VPTA 2WHQA 4X45A 1AMOA 2E37A 3EOAI 4MO2A 1OLOA 5LBTA 5JO0A 3I73A 4BUCA 1MRZA 5ALFA 4KWTA 1AQJA 2IOFA 1UXJA 3RC7A 4QJ5A 2HCBA 5A3RA 1EVLA 1P0PA 5IZ4A 1RYZA 3EAGA 2GAIA 1D0VA 1GUDA 1C1DA 3JZMA 3R6DA 4GOJA 1NNUA 4ZO4A 4Y2TA 3ZWMA 4BCDA 1FP4A 4MUYA 4C6HA 4EH1A 5IF3A 3EMBA 3S2UA 2ECOA 3A0RB 3PVZA 4RELA 3AUUA 4FT4A 2P77A 1ZISA 4RQAA 1NXWA 4WPGA 3M6VA 5KOJA 3R9XA 4G3XA 3BIWA 5AOAA 4D9MA 1E4YA 1GYPA 5SV2A 2YY7A 4FHFA 4O02B 4X1KA 3EPKA 3WLNA 2V5AA 4HGYA 2IS4A 4AROA 1ZMTA 3OOHA 4HLUA 4A16A 4K9RA 2R84A 4LCBA 5CFMA 4WLVA 1OWOA 1RPJA 3NHPA 1A8QA 3Q5EA 4KQ1A 5TJ9A 1XVVA 4R69A 4XPIA 1YS1X 3R74A 2DLDA 1MD9A 1OE0A 3ZWKA 3C6ZA 5E3IA 4AUKA 3TYXA 2AMVA 3C1UA 1XA0A 2ZXUA 1JFSA 2D2EA 1SZDA 4MQFA 3T1NA 3FROA 2JW5A 4KREA 1DIOB 4PZ9A 4LTNA 2ERYA 1H5QA 1TQ2A 1XL1A 4KO1S 2O8BB 3M4ZA 4TV9A 1SCNE 4RM2A 1RCTE 2OAEA 4GZ3A 4C9BA 2OXFA 3HZRA 1RLIA 3QUBA 3IS3A 1SVIA 2BHTA 2R8EA 3KALA 1N6RA 3E18A 3LQKA 1WDTA 5EHNA 1IB6A 5AI8A 4P58A 3UXMA 4AZ3B 3T35A 4GYWA 3MB8A 2VHYA 1QFSA 4M9ZA 4RMJA 2FHPA 2VL7A 4E4TA 3K0AB 3IQHX 4WD3A 2GJSA 3H2ZA 2HRBA 3LT2A 3QELA 1LSSA 5ALQA 5HMMA 3LUCA 5L3RA 1EP2B 3NC0C 3OICA 1UQUA 5T8KC 3HTXA 2ZI9A 3O9MA 4TRMA 4OXKA 4M8SA 4JI6B 3RU3A 5HKKD 2DQYA 2H8GA 1GOTA 3M89A 4QAJA 1RYDA 2A9PA 2ZP1A 1AQNA 1FDOA 3ZI0A 1C1XB 4OJMX 4Q4DA 2I71A 4MYTA 1XPUA 1K88A 2DE0X 1TD9A 2JI7A 3G2IA 1P1HA 1PF7E 3CRZA 4KNYA 1M1ZA 3W6OA 4OHZA 2JLAA 4JIMA 3WGNA 2AFHA 3NBZC 4ZT4A 5JE8A 3SX0A 4V0LA 3SDBA 2IKSA 2C5AA 2ZSHA 4BLVA 1ZRHA 4G1FA 4RPCA 1ANKA 1M1XB 5ERGB 5F3DA 3ZTYA 1EHIA 4CFZA 4YLYA 5M2QA 2PUFA 3KUXA 2NU8B 3BWYA 3V3KA 2FUG1 4HJRA 3KOUA 5ALOA 3JYHA 4NU8X 1OH7A 5CDTA 3TEJA 2C5GA 3CURA 3FVRA 3K72B 1Z6QA 1G8KA 4FCVA 4FFPA 1N2IA 2CBXA 3H0KA 1V7QA 4DIFA 2XSZA 2VZ9A 1A4XA 1T5IA 4YY3B 4FC6A 4FJ0A 4KIWA 3V2IA 4J4TA 5DGDA 3ZN2A 2E87A 3CLRC 2O06A 4NS4A 5H70A 2CFCA 3K1YA 3GJTA 1AQYA 5EUCA 5J2TF 4ARUA 3L7MA 4MRNA 2I2AA 4B81A 4DG8A 4AP9A 3S6JA 1IN1A 1OXVA 2H29A 1X7DA 2IU3A 2HHJA 4OQDA 1GNVA 1ZHHA 2XMCA 3LE8A 3NBFA 3EXFA 2H5IA 3A3KA 5H8WA 2GEJA 2PUDA 2DCMA 3O1LA 2I3BA 2NTNA 3WRXC 4EB6B 4GHWA 4QECA 2XB6A 4EG3A 1QORA 2GWHA 4E15A 1QDLB 1ZXBA 3KFVA 3NBYC 3OF2A 2WJIA 3PXCX 3U7EB 3WLAA 1G2QA 3RLFA 4YRBA 3CZ4A 4TZ6A 2EQBA 4GMGA 3JYOA 4WY8A 5GVSA 3WK9A 1LUAA 1AZTA 1IY2A 2HXYA 1GKKA 1GPAA 4HZGA 2CE7A 3LUAA 4KI7A 1T8SA 2V7WA 2WLSA 2ODPA 4ZAXA 1G55A 3OPNA 4JVNA 5ERYA 2V0CA 3QSYA 1QYDA 1VYTA 4DC0A 4BTLA 5FUBA 3COZA 5FLEX 4DZTA 3B9RA 1WTCA 1OBVA 2QVGA 2QX9A 3CZAA 4BVJA 2Y0PA 4DV6B 1CY6A 3RJZA 3IX7A 2DU8A 3GLTA 5FBQB 2BKVA 1L7DA 3E7XA 3ENZA 2ZQYA 2HRQA 4OHCA 2IBTA 4GQAA 2HLNA 3WGVA 3MAJA 3COWA 2YXEA 5C4IA 3Q8XB 5GM1A 4OJTA 4CIBA 1XTJA 2I4LA 4JUBA 2HA7A 4R3UC 4W5RA 1K7FB 1OC2A 4C7VA 1OX5A 1Y7PA 2A2ZA 2IV3A 4FYYA 5AQEA 2WF9A 2J0QA 1ZXXA 4F3KA 1P9LA 2ID4A 2XUJA 3EISA 3KJNA 5EJIA 4HFJA 3EPHA 5EP3A 3WMXA 3EX7C 3UAZA 2GJ8A 3MJTA 2B20A 2UZAA 3Q15C 2BKAA 4G0NA 4YP5A 5BO5A 3TAUA 5AM3A 4RTQA 3RC8A 3LP8A 4BX8A 2ZVPX 3AI7A 4KRGA 1E6MA 2VP5A 2WYWA 3EWSA 2RHJA 3PLNA 5AESA 5AW4A 3CRMA 2B4RO 1R0YA 2QM3A 5EJMA 2GRAA 5K6RA 2A5YB 3HWRA 3HM9A 1XO1A 2BTQB 1XKTA 4G0MA 4JR2A 3P2EA 3AJ9A 1EDZA 3HJNA 3ETGA 3G6KA 4R81A 1M7HA 2M1XA 2QTAA 1Q84A 4RVGA 5BW6B 2XYGA 3WBFA 2HQ1A 2V98A 4H60A 4BFLA 5I7WA 1GGVA 3EA5A 5TNXA 3YASA 5KYVA 3A6HA 1MCZA 2CD9A 3CUSA 3I61A 3NDJA 4UDYX 3JZIA 1Q74A 1M72A 4R1NA 1UPTA 1IJBA 4CIXA 3ORFA 1ZAKA 1CLEA 1CEXA 1GGNA 3N0VA 4PC7A 1QJ4A 2X9VA 2GCIA 2J5QA 2O2JA 4MW5A 3H2YA 2Q5LA 2XUGA 4LJ7A 2ZUCA 4JGBA 2BGIA 4L57A 5LLDA 1YRYE 4LK3A 4UPEA 2D13A 3IE2A 4C4RA 3W1VA 4CKBB 4F8JA 6PFKA 4QT4A 1CYDA 3SOZA 4N3NA 1HNXB 4PLFA 5C1IA 1TRKA 3T5TA 2G1UA 5EJ6A 1XT6A 4JS0A 2PX2A 2PLNA 4JJ4A 3S55A 4FFVA 3JWPA 3GNTA 3BWXA 2XODA 3FIUA 2CD7A 4X3CA 3UYKA 3QHPA 4BX2A 1Q0PA 1WXXA 1N2ZA 2EARA 1WUIS 4L9WA 4ZOEA 2X41A 3BJZA 1YMUA 1B8NA 4NE2A 1T6ZA 1PBNA 5EXPA 5FIUA 4ZZ3A 2FPIB 1JLLB 2DPYA 2YQ5A 3BXZA 3DW1X 4UOQA 1ZITA 1KU0A 1RKUA 3WIEA 4TVBA 3U44B 3U4IA 1KP9A 3P9SA 4KUGA 4MKIA 1K2VN 1WR8A 3OCZA 3TTTA 3FBWA 4EOGA 1D4ZA 1OPRA 1VPVA 4E3ZA 4IG4A 2OXEA 1CR1A 2OFFA 3EPJA 4UC0A 1NZJA 1SPXA 1Y98A 4FM9A 4IXNA 1KFJB 2OFXA 1AY0A 3EFHA 3ABQB 4OBEA 2HWKA 4NBRA 4EW6A 4QXQA 5T64A 2P41A 3AETB 4DBLC 5CYFA 3TM4A 5GONF 2RHRA 9LDBA 3N58A 3H13A 5EJ4A 2QSJA 1H8EA 2Y1EA 4CF3A 4CL8A 3D43A 2YYAA 3EGOA 1QHHA 4RVUA 2F1OA 1G59A 1EUQA 5HFAA 1Y48E 4UOEA 1VBMA 1FQKA 2CV2A 3C0KA 1U28C 3PPYA 3L41A 2WF8A 5JO9A 3BS4A 4LDAA 5TS3A 1E3JA 3DDZX 1SCKA 1Z4OA 4HGQA 4QTYA 1IMJA 1SO8A 3KJQA 4M1SA 3RFUA 1L4NA 1XQ6A 3O4JA 2F3UA 2FLKA 3WNZA 1XWIA 1QZUA 4WZAB 4UULA 1ZWKA 4HWTA 4AF6A 3R7FA 4KAFA 3PPWA 5B3LA 2P7HA 1WWKA 2XDQB 3EXFB 3R9IA 1WF3A 5L3QB 5KNCH 1GEEA 4JLOA 5FNVB 3HZZA 3I4LA 2YIDA 3MYRA 4PG6A 5IJZA 1ESCA 2BM8A 2FR1A 4N5MA 1B8PA 1P9OA 3GJ7A 4XQ9A 1ZG3A 4UD2A 3UUGA 2JBHA 3O2JA 4RGQA 4IEIA 1YR8A 3S8MA 1SOMA 3ZHQA 1NSFA 4J6FA 1XXHB 2A5LA 1E5TA 3ZKWB 3LC1O 1V9LA 2F6RA 2REQA 3H2JA 4PWZA 2P2SA 4YI5A 5A0VA 3ERCA 4QFBA 4LE0A 3ZWBA 3GRUA 2I67A 2W6JA 5FTWA 3FE2A 3HR8A 3TSYA 4YCLA 3M5CA 5DGXA 2PZEA 5A6SB 5FEUA 5AK4A 2CVFA 2WWIA 3LUHA 3EZ6A 1TEVA 4OQYA 3SHVA 4EP1A 1OAKA 1B41A 4P98A 5HK8A 3WLTA 3ADBA 4S24A 4GO1A 1KI4A 4WESA 3BH0A 3P2KA 4RMGA 4YJFA 4QOHA 3LT0A 3T3EA 3WYCA 2VPPA 3U26A 3AM4A 2VUHB 4PY2A 1WCIB 2GARA 1JDBC 2QU8A 2RMKA 4QQ8A 7ADHA 1CZOA 3RUFA 4CM5A 4GU5A 1II9A 1T1RA 3V46A 4R54A 3W6PA 1MDFA 4W5QA 3HQ4O 2JGJA 4L8WB 3HG7A 4KOEC 5EWLB 3T3IA 1U0RA 3OM8A 2P27A 2AR7A 2WA1A 3ANXA 3D2AA 2AOUA 4ZOLB 5JR3A 4DLBA 3G2HA 4C0AC 3H1TA 1UBLS 2CSUA 4ON9A 3RPEA 4B46A 4U8GA 4LXUA 1R5NA 1I1OA 1SOUA 1EAYA 2A5DA 2H4JA 5G4LA 3T9BA 3WNQA 2FEMA 4LDQA 2IYYA 5C0OE 4DQVA 4EHKA 4LZAA 3I9KA 3CN7A 2IPAB 1CQXA 1OSNA 1AURA 2O6HA 4CLHA 3TG2A 1NW7A 1A1SA 1Q3KA 4FSHA 5FI3A 3HDGA 4B6QA 2IU4A 2CCJA 5I5GA 4RWZA 1O9HA 3D4BA 4JA2A 1YC2A 1E3IA 4BAUA 1F2TA 4PZCA 2O5VA 4ZGBA 5HG0A 3L0PA 1RKQA 4K9NA 2H2AA 3PGKA 4BZZA 3WADA 5IDXA 1UJ2A 3CLUC 3E9EA 2YS7A 2B5OA 4MDFA 2XOEA 2AFVA 4L74A 5EI5A 1YF3A 3MWJA 4GVPA 1MKYA 4TUYA 1KYWA 4MLZA 1L5FA 1QCCA 1ZOLA 4Y1GA 2M6KA 2DRIA 3W6ZA 1KVTA 2VBIA 5DNEA 5A7FA 1NI3A 3AR4A 5IBCA 1F12A 2C97A 3E9YA 3P45A 4PTZA 2OXIA 4IR7A 4WGGA 1E1DA 2P6UA 5EC8A 5LA6F 5KNDD 3GQBB 3QMVA 1LLCA 4J2HA 5BSKA 1Q0RA 3NALA 4RKWA 3Q41A 2C54A 2VTEA 4E5MA 2HR1A 1QFXA 2P6MA 5EXSA 5BQ3A 3EXEA 4XA8A 3JQFC 3OZ7A 1LH0A 2BBTA 3F71A 5I4CA 3OUUA 4YJDA 7GPBA 3C6BA 5DM4A 4UE6A 4Z7QB 2VP9A 3ITNA 2XNDD 2AEJA 5C35A 2BY4A 2C2KA 4P93A 3KUCA 1A95A 1CY4A 3O8OB 3OJFA 5AVKA 5FA8A 3OE7D 4BATA 1HSZA 3BWVA 5JNWA 2EKDA 4B9EA 2UUAB 1Q1NA 1ICIA 4YMWA 2FZGA 5U1PA 2R6ZA 5KZMB 2QAGA 2Y0BA 3Q10A 4KXQA 4AIIA 4UDNA 4UHJA 2C2YA 4L7QA 1MA3A 4QTXA 4EKGA 3H7IA 1T8PA 3T5BA 2EX0A 2XX3A 1CUJA 3A6ZA 5DSZA 1C0EA 4AG5A 1T0HB 1ZGCA 2PO7A 3RSCA 3RTCA 3V1LA 5JEEA 4F4DA 4GNKA 2BI4A 1UDCA 2XBLA 3PWTA 4EY5A 2A0WA 3AINA 3BJEA 1M8PA 3UATA 5JNLA 5IX8A 1A4UA 1PT7A 3D6MA 4BQNA 2PUGA 2C95A 3PXEA 3ANSA 4D8TA 3KJGA 1C3VA 1I36A 3PZRA 1YU9A 4JYZA 3CR8A 3JQBC 1SOVA 4FFMA 4BRWA 5NLLA 1CRQA 3NVMB 1G16A 2VF4X 3JYQA 3I0NA 4M37A 2IYRA 3ELUA 1JXOA 5J59A 1VHWA 4BNMA 4C7BA 3PEYA 2HF7A 5JS6A 3AI2A 4WKBA 1SQFA 3Q87B 1CY8A 4IOLA 1XRQA 1DBQA 2QVYX 2ZB8A 2ZE8A 1QG4A 3FTNA 1JDZA 3DBRB 2EGUA 4MO9A 4OBWA 3WKBA 1U3DA 4ZXPA 2OYCA 5A4AA 5KQRA 1OAAA 4V0ME 4XQ0A 1K06A 4EGAA 1YE3A 5TQ2A 3EVBA 3UGTA 2ODTX 2YQ4A 2RGUA 5ILGA 2HBZA 4WERA 4DPMA 1NTOA 1QGZA 4BQEA 3ZW7A 3FDZB 1DAPA 1VE1A 3M2TA 2JIZD 2O8DA 2H4XA 2XJ9A 2AFIE 3WWOA 3ICEA 1GPKA 1C8BA 1VI6A 2PSJA 2JEZA 3H19A 4GMDA 2Q99A 3N8HA 4R2XA 4RYLA 5EWLA 1RCUA 3EF0A 2ZJBA 3PWZA 5E7IA 4YEDA 1JR3D 1TVKA 1JDJA 3LX4A 3FUTA 5A9SA 2H7YA 3GD5A 1ZFNA 2P4HX 2NUAB 1OPXA 3L18A 1ORWA 4A26A 4K9MA 2QMQA 4Q1AA 4AJPA 2TYSB 3T4EA 4PQEA 1U0BB 1E1NA 3VX3A 3VJMA 4CKZA 4QZVA 1EX1A 3FSEA 4DCPA 3DZCA 3GEGA 3O38A 4TXMA 3GJSA 1ZN2A 9LDTA 1G41A 1KKLA 3ABSB 3QXXA 4EY6A 5GZ1A 4R2KA 1NE2A 3OLWA 4PX3A 3F73A 1IHYA 2BE9A 2GPWA 2RI1A 4N8EA 1TD1A 1ECFA 2HHCA 4DMUB 1QHYA 1ODKA 4XOIA 1SC9A 2R4TA 3LO5A 2P9JA 4MWTA 4GUDA 1Y6ZA 1VA4A 3I9V1 1E9CA 2IXFA 4OXRA 4TTVA 3WKEA 2WPDD 4NTZA 1QC5B 3OQBA 5E1DA 4ZANA 4ZEXA 2CYCA 4KITB 2FG5A 3A4YA 4D4HA 2A86A 2EP7A 4J7CA 4WFQA 4K9DA 1VMAA 2PD3A 4IHQA 1N3BA 5FNVA 1COWD 1TB4A 2A5JA 3I2KA 3HSYA 1KAOA 4J0CA 2HSZA 1OYVA 3VJKA 4F0JA 4OI2A 4TOIA 3Q2KA 2Q6KA 4AUMA 1WHSA 2JLXA 4C7XA 5KC8A 2IY7A 1K8RA 2DAPA 4H1VA 4K8RB 1EZ1A 1MXHA 4B47A 1ISSA 5DHFA 4P0QB 2SCUB 3CH4B 4NMMA 5AKEA 1KQFA 1U2PA 2YUIA 1VRCA 1B16A 1QLHA 3FYUA 3ZZUA 4XYBA 3QRWA 1G17A 3QNWA 1CQPA 3A28A 1L4KA 4NC9A 4QXPA 5KNBA 3OZAA 1Y8ZA 3AFOA 1DJPA 3RYIA 1AXGA 2B37A 4HDCA 5DTIA 2QAJA 3HR7A 3KQYA 3V8QA 3CVJA 4FFOA 1GNTA 3VC3A 2FW1A 4QGHA 4EI2A 3E9ZA 4PFSA 3JQ6A 1Y7IA 3HA3A 4WOCA 5GJCA 3TUJC 4PLCA 5BN3A 2O8EA 3L7JA 2JFWA 1ZINA 2P2LA 3AEQB 3WR5A 2QWXA 5DWDA 2FDXA 1THGA 1YK0A 4RJKA 3B1WA 1SEVA 2QD2A 4HQKA 4MV8A 5KNCD 5L45A 2QSYA 4P31A 3KKLA 2JIRA 1E5DA 2H7VA 3LOUA 1EDDA 5EE1A 1I14A 2GM3A 5K8CA 2RH8A 3WNVA 1L4FA 2X0KA 1YDMA 4ZOCA 1U31A 4GPD1 3FYSA 3ZYCA 3MOIA 3PGVA 2IOQA 3OM0A 1QH8B 5LQCA 5JG7A 4DTCA 3L04A 2LW7A 4OQMA 1IY1A 3KU1A 1QZ3A 1CQIB 4MW9A 1RADA 1HDEA 5COQA 5TJHA 3R5FA 2YV5A 4NFHA 2MTBA 2W9XA 1M83A 1V8DA 4J75A 4I1UA 2DWPA 4J76A 4W7IA 5DULA 4CF5A 2AMLA 2TECE 3OIGA 5DLPA 2QLLA 3RSOA 5HJ5A 4BRZA 1M6NA 5C5EA 5LZ7A 3DDNA 3KXDA 2QVLA 3P96A 3ANNA 3W7AA 4LHWA 4OYYA 4ZI5A 1L5VA 1H1TA 4I1VA 3ND8A 1VL1A 4R9UC 4DNFA 2ZBDA 2P9GA 4LV5B 4YP1A 4OYHA 3VAZA 1YNOA 4GIBA 1DC6A 3ZWPA 4D43A 1I1NA 1NXXA 2IUEA 1JB9A 2IZ5A 2QX6A 4PHFA 4C7MA 4KLZA 5AKXA 1UMKA 2V97A 3KXIA 1AU9A 3DBOB 1T6XA 2X1HA 3PNPA 1CUXA 4N5NA 3QI7A 4DCGA 3E05A 3DOIA 5HIIA 1JTEA 3B13B 4H16A 3BTVA 1FX0A 2H4YA 4GQIA 1E7QA 3I45A 2UU9B 4YREA 1AQUA 1E89A 1NF2A 2XVYA 2ZM6B 4G25A 3VKHA 1U28A 1PN3A 2XNJA 3ANTA 4RPHA 4V0SA 1TAQA 1WA5A 2BMWA 1R9JA 5C34B 4HTFB 2C2GA 3GGSA 1Q1EA 3ZH2A 2XUFA 4QYWA 1RYBA 4KE6A 2NPFA 4ETWA 2RG7A 4ZK2A 3FX2A 3U9TA 4JC4A 4K1LA 3UN1A 4FLEA 1JHVA 3H2KA 3NT4A 4QLAA 1RSZA 4B48A 1P1RA 3IAAA 1IEWA 1XD2B 1J2RA 2XUAA 4G4GA 4QXOA 5AW6A 1IQRA 2WIJA 5JJKA 3BF7A 3IP6A 1OYOA 3H9QA 4TTSA 1KORA 4KJXA 4RD3A 3IALA 4HFRA 2J87A 4AKIA 4EZIA 1NKVA 4WE3A 4E07A 2G70A 3K35A 2DJIA 2D1SA 2QUZA 3CZRA 3OPYA 4C3VA 4Q4CA 1YA6A 3LY5A 1JFFB 2ZBRA 4HQNA 1P1FA 2ZBUA 4ZICA 1U2QA 13PKA 4ND4A 4E33A 3LYHA 4EEXA 3WKDA 2EFCB 2XUIA 2CEAA 4EPTA 2H1IA 4D82A 3FSJX 1K7XB 1X7WA 1UH5A 1AQIA 1B6RA 1U8EA 5JXGA 2EJVA 3FWPA 4TWJA 4CV1A 2CV1A 3VPFA 2W2XA 5JJLA 1PDVA 4YAFA 3VNVA 3MTEA 1LQTA 2OBYA 3R76A 4MVJM 2RAPA 4U6QA 4F3TA 5TEVA 4E08A 4WXRA 4XIGS 1VOTA 1XYYA 2UUOA 2JGDB 2WMOB 2ODNA 2W2LA 3BRSA 3ESQA 3OFJA 1HC7A 3QK7A 3REFA 3WJ1A 1X1DA 2PWZA 4Q1EA 2WSYB 3HLTA 4RPGA 2FZCA 4Q7EA 3Q0EA 1CWUA 1FUEA 3WBJA 2OFOA 4MKRA 2PL3A 5HQ3B 3N2IA 4NZMA 1XMSA 4X8LA 3MMSA 2D74A 5E7MA 3V7FA 4UU7A 4F9GA 1C7EA 1CDOA 4NXMB 4N8SA 3SS8A 1QFYA 3HDJA 4LMAA 3WLSA 1PYGA 1Y1PA 1L4BA 3CIOA 4RGYA 3N2KB 1URPA 5L95A 4IFBA 1M2FA 3EXG2 1MT0A 4PGMA 1ZVJA 2RK6A 4OHUA 4JITA 4BJ3A 4AXBA 1LJ8A 5BN5A 1UP6A 5EQDA 2HK6A 4UZEA 5M5BA 3CWQA 3OJOA 2Z9BA 1VHJA 3RU7A 3NV7A 1B1AA 2FPGB 3Q3VA 2W2NA 1QGUA 2OOSA 1GFIA 1DTWB 4Z3OA 1SU7A 2Q9UA 2E4AA 1P2UA 1PJQA 2F55A 3O3MB 3QKSA 1XNJA 5CG1A 1ZJZA 1IJKA 1GTG1 2PLWA 1DEXA 4ALMA 4ESVA 3PITA 3OT5A 4DXDA 2WHEA 3KTAA 1IUKA 4HFMA 3KYCB 1R3DA 3FMIA 4G4SP 4YC7A 5B1SA 2QLNA 3T15A 4XB1A 1FU8A 3RVPA 1AJEA 5K9ZA 3MLAA 3P20A 2BMJA 4Z0PA 1T5DX 1Z2PX 3NWEA 4URVR 2VTKA 1RC8A 1KI2A 2I9PA 3CFYA 5IAEA 2AFHB 3UMBA 1QH1A 1GZ6A 1LPAB 5HFJA 3BIFA 3TVTA 5BUQA 1GGEA 5HRAA 2AA3A 2HI0A 1EX9A 1YL6A 5JFTA 4PSCA 3UA4A 5HA5A 5HUHA 5LXTF 2DFNA 5J2TA 5D5HA 3OKAA 3U7JA 4A0RA 5BN3B 2OM2A 3EK2A 1TFRA 2YCLA 4HQ0A 4AM8A 5BUCA 3TECE 2JLVA 3N0XA 1WMBA 2WTAA 3SF0A 1UUFA 4ZK6A 2HRZA 3AMVA 4HBGA 4NAHA 2ATCA 3DAFA 1KARA 4AYWA 3R9KA 1XZNA 3TD2A 4CMGA 3BMCA 4NV1A 4QNRA 1MO5A 2XF2A 2QMUA 4LNAA 2PH5A 4IICA 2M1ZA 2WG1A 3E7WA 4TWIA 1T0BA 3ICOA 3W3AA 3UOGA 2EIHA 2RGNA 3LZCA 5FWYB 1DIRA 3CKYA 3ZNPA 4DZRA 3AZOA 2VA9A 1M0TA 3IMFA 2G3YA 4RY8A 1IB0A 2AKYA 1T43A 3HI4A 4IIDA 4QBIA 5AVRA 1SC1A 2BGRA 3LTEA 3DBLB 2P90A 4JUCA 3KZXA 2I4MA 3ROEA 1LNSA 4G0YA 4R1TA 3ENWA 4RZXA 1ZBDA 1DZ3A 4ZVQA 4KTTE 3WWPA 3QW4B 1ENYA 1HOTA 3FWHA 4D56A 2Z2KA 4YRJA 5H1YA 1IULA 1OASA 3HVIA 4MYUA 4X7PA 4R2IA 4W9MC 1N6KA 2FVXA 4Q3EA 1T9DA 3WWZA 3PE6A 1E99A 4F4CA 4D96A 4QVGA 4Q00A 3JAMA 2YCBA 4M1TA 2BIFA 3UT6A 1WPQA 2LCIA 4ZWNA 1XA3A 2A9VA 1CYEA 2BFAA 4LDPA 4I36A 3FOCA 2IP4A 3LNTA 2JAQA 4IPTA 3ZV7A 3RS0A 2HHHB 2CLIB 3TWOA 1ZC3A 5JWHA 5CH5A 5A0FA 3LY7A 1G5FA 2WJVA 3LI2A 1PW5A 3D7SA 3FTPA 2PUJA 4IJKA 5I7SA 3RM3A 5JTUA 2GN6A 5CLJA 2OMEA 4CG2A 1SG6A 1GSAA 3W5IA 3WIVA 4DSTA 2C8LA 5L53A 1LDMA 3NUZA 1U8TA 2ZE7A 2XB2A 3K96A 1W4AA 2J9GA 3ZHZA 2KJQA 1OZ0A 3DVAA 3UQYS 4WK0B 4BB0A 2J4CA 3PD7A 4JC5A 2WFAA 1NW4A 1R6AA 1SBCA 1MPTA 4DR4B 1L0BA 1BHO1 3GUHA 1E2QA 4GH5A 5I7AA 1PNTA 2FX5A 5CXQA 3ZY4A 2MR6A 5HDBB 3KM0A 3UJ9A 4K9QA 3ZGZA 2PT9A 3OPXA 4CEIB 2ZJZA 5J3JA 2QY9A 4YCAA 1JAIA 2ZIZA 2IXTA 3P4YA 4ZAWA 1P5JA 2ZWAA 4LJ6A 2QSZA 2XUPA 5HUQA 3COSA 4TQ9A 2VJLA 5F4BA 2RG1A 2P3QA 2VNHA 2P1DA 4GPIB 4KEAA 2C2HA 4L78A 3HBNA 3MZ0A 3ZWNA 2PMEA 4WMLA 2WUVA 5K0EA 4OX9B 3B3JA 5EKDA 4LFCB 4KOAA 1NVFA 5BQXA 3GMDA 4Q3KA 2YNMA 4HJXA 4Q3LA 1KMMA 3PEUA 1U8UA 4XR4A 4G0XA 4YLEA 3SLKA 4BO6A 1KBOA 1R0SA 1IM8A 4MRVA 4PS0A 3HCPA 1YI0A 5GP1A 1YR7A 1DX6A 3N8NA 3F74A 1OB5A 4GKVA 4YRLA 3EXG1 1K5DA 3S5JA 1KOJA 2XMDA 3DBRA 1XAJA 1XZGA 3TZQA 3HLYA 1VG9B 2NZVG 1P6QA 1IG3A 4O5AA 1U9CA 4DWJA 2FMXA 4L73A 3AX6A 1J06A 2A7QA 2PBLA 1T34A 2Z8YM 4DMRA 2IW1A 2CJYA 2C77A 2RHLA 1GQOA 3HKDB 2XKJE 2RB5A 4X65B 3U7FB 2J3HA 2W8BB 1KP2A 1SQSA 2EZ9A 3VZSA 5CFOA 3FHCB 4LBVA 4B83A 1MQSA 2Y76A 2F00A 4KAJA 1SOWA 1FB5A 2ZRDA 3CCFA 3N3AC 1H93A 5TF0A 5KHOC 4AS2A 5B7GA 2PVPA 1XMIA 4NMWA 2CMGA 1YS7A 3N8KA 4X6LA 3GT3A 3PNVA 4F06A 3DNMA 1CRWG 4ZQFA 1P62B 1GG8A 2AI2A 1AHHA 4CDNA 5JBQA 3U56A 3GGGA 4P0TA 1JJAA 5DI3B 1GCGA 2DHQA 2EBHX 2RH9B 5FR2A 3I0MA 3GUUA 1G8SA 4FCCA 2FZVA 2P4QA 4EY3A 5JC8A 1ZYUA 3WLMA 5KYGA 3RK0A 2PH1A 3PDIA 4HRXA 4FXPA 4HDSB 3KPYA 2Y1CA 4JT2A 4JX9A 1Q16A 1RAFA 3IUJA 3THXB 5JBNA 3VOTA 1FTQA 4BFUA 1PGOA 1ZCZA 1NC3A 4P7KA 1RRCA 1DKNA 1HNNA 3E2IA 5K8UA 4LZNA 1B7GO 1ONSA 4UVIA 1N6NA 5EMMA 3V8BA 1ICEA 5EIBD 1QBGA 4DN6A 2LXNA 2QQ5A 3GFFA 3S2GA 2GPNA 3U4QB 5EIOA 3PRJA 3I53A 5G40A 1SVWA 1WZUA 1J90A 3PNMA 2MWMA 3OTGA 3U9LA 1IDN1 2WD9A 1HQKA 2BVNA 3ROQA 5HIAA 4R40A 3W90A 2YUTA 3N6RA 2FP4B 4KDRA 4D9KA 4DM4A 3PHIA 1WNFA 4II7A 5IKXA 4P7FA 4RACA 5DN9A 3RQSA 3AEKA 1ZVKA 2M98A 1GSOA 4O1HA 2J3JA 2YHAA 4GRDA 3S2IA 1U02A 3MGCA 4XVHA 3SG0A 3MERA 3RTAA 1JPJA 4C3UA 4F92B 1TL7C 1Q21A 1FFGA 2VXYA 3ZE0B 1YZKA 3BTSA 4JQYA 4YRMA 2CCGA 4KQ9A 2Z5VA 2Q4OA 3V4RA 4RKYA 1XLVA 2JK1A 3GJQA 1WULS 3H83A 3KVOA 2AC4A 3SIWA 3ROKA 3P9NA 3V8PA 3G85A 1GPUA 1MTZA 1SBTA 2Y3IA 2IIQA 2IEDA 2Q3HA 2ROQA 3ILYA 5KI6A 2ZG6A 4XIFA 4DVJA 2F9FA 4MARA 5DK4A 3RK1A 3ZUGA 1IBSA 1T4BA 3VSCA 4KR6A 3C8ZA 1QAMA 4IWYA 4UUPA 1EBFA 4JASB 1EWQA 1L4GA 4P5EA 4I9GA 2H11A 2OB1A 4IJMA 4LUCA 5FLYA 3SZOA 5KCZA 2ZQ5A 1OKKA 1G2OA 1PNQA 2WV9A 3W78A 1ETUA 4QYSA 1M7GA 3JVDA 3WXBA 3GLHB 3RKRA 5IJWA 4YT2A 5LB2A 3W6NA 4N39A 2IE8A 2VDMB 3B8HA 3KP1A 2C9YA 4IQFA 3VZDA 2YXBA 4C4OA 1R10A 3ESBA 3FN4A 3K5IA 5KHAA 5IJ0A 2WM3A 2BZ1A 4AMYA 5GOZA 4AVYA 1BQ4A 4DCUA 1ODIA 1HNWB 5T8KA 1J8DA 4IIEA 3DE1X 3EFOA 3FLMA 2NSHA 3CRQA 3OWOA 1Z2CA 2GF0A 3DO5A 4WLUA 5CX1A 1XZJA 1Y37A 3BFKA 4UNNA 2IOYA 3DV0A 4ZCIA 4M88A 2C96A 1QX3A 1JYSA 2C58A 2H3HA 1GL3A 4KXYA 2OM6A 1O9GA 3IOYA 4DF3A 3TTUA 3OAAA 3BFXA 1O6ZA 2EQ5A 1EK0A 1HE2A 4H59A 3ME5A 4OU4A 4B80A 4EHBA 4PYNA 4ZPXA 2HA6A 5CNMA 5L4SA 3IP5A 8ABPA 3EGWA 1QCDA 4TZKA 1CE8B 5JCOA 5KKCA 1HRKA 1FRFS 1VE7A 5DM1A 1FFCA 2FPOA 2BHSA 2QLFA 3KG2A 5CW1A 5F5NA 4L9SA 4X92A 2RHMA 4AMZA 3MEQA 3MXTA 4J91A 4YB8A 3ZBQA 1QCYA 1CUFA 1HV8A 1GL7A 3O90A 4G1BA 1KKMA 2FW7A 2O8VA 2WTXA 4H7IA 2VQFB 1FMCA 2FSIA 3TQIA 3GCXA 1SIUA 3S81A 4FCTA 3RRBA 3OY7A 1I9GA 1V5GA 3GRPA 3PT9A 3ZTWA 2Z08A 3BGDA 3JD1A 2OHOA 5EWJB 1J00A 1IPEA 1E0AA 2QRGA 3A9WA 4J0QA 4L76A 1KQOA 1IL0A 2FP3A 1DKPA 4NYIR 2E3JA 2IDJA 4MVJD 5FTLA 4IS3A 4Y2XA 3PDWA 3BE5A 3P9QA 4FUTA 3O73A 1Z9BA 3SHFA 1VE3A 1J9ZA 5FFNA 1LTKA 4NCBA 3HJFA 5G0WA 2C04A 3C3AA 3IMEA 3WKAA 5J43A 5EHIA 1VKRA 2FCRA 2BEWA 3ZXYA 1QFJA 1L3CA 2GLTA 3OQ6A 4X66B 3REQB 3RJ9A 3EVDA 4NZOA 3FWYA 3HC7A 5EMKA 3QLUC 1NW9B 1I6KA 1HDXA 1N2GA 3KK0A 4CF6A 3H05A 4ENUA 2VTBA 1JLRA 3H1FA 3NANA 1FFBA 2TMDA 3RTBA 2WG0A 1ONNA 3QHAA 4ASUA 4ZMSA 3SZGA 4KR2A 4JODA 3RRXA 5DM60 5BN1A 2PT6A 3DOUA 5ALKA 1LK7A 4Q21A 2ZJ0A 2HCTA 3HI6A 4WDQA 3IHWA 5FD8A 4ER7A 1NRXA 2JVIA 4WXEA 2Q49A 5DYWA 2PN1A 3IGFA 5LLTA 4OSOA 2D7JA 2R8PA 2AOTA 3PXUA 1QTQA 4RPLA 621PA 3KPWA 1TZBA 2RGGA 3P0HA 5ITWA 2ZYAA 3CEPB 4UCQA 3V34A 3S1SA 1BN6A 3VR2D 1JFTA 4Z2AA 4RZUA 5L3ZA 1GGMA 1N8KA 1ZL2A 2Z8XA 3AW9A 3OZWA 4KWCA 4M9SA 3X1XA 3GGPA 4JT9A 5IULC 2X8LA 3TLCA 3DMFA 2F9MA 1A69A 4HAZA 5JXWA 4G2TA 1N0WA 3EIOA 3QSGA 4L75A 4F6LA 3HHEA 2J9FB 1VHQA 4BU0A 5MFPA 3JZAA 1CUIA 1FUIA 4YLGA 5F4ZA 1XNRB 3UMSA 3CNEA 5LZ2A 1Q7TA 2JBAB 2FETA 1UZMA 2JS7A 2I99A 5KMGA 4HS4A 3NM5A 3A70A 2PKEA 1OT3A 4NYMR 4Y2GA 2F7SA 3BHJA 3KSMA 4L4SA 1AE1A 2CFRA 2OESA 1RYFA 3VR6A 2RHOA 4KAXA 3U4CA 1DIAA 2ZR9A 3FMVA 5HM6A 1C7IA 4LAFA 3RYFB 5FNZA 3S8YA 3U49A 2O19A 4MR8A 4TMFA 4CODB 4DV7B 2C9ZA 2BHLA 5ITZA 2JGNA 4LNUA 4RETA 3OD1A 4XUGB 4KRFA 4AYXA 4I4TA 1E9VA 2VR1A 3PUZA 2NXCA 4NRDA 3ZWXA 3ELBA 4CUZA 121PA 1WSWA 1GV0A 2GAJA 4G65A 3CJTA 5DHPA 2COEA 2PAFA 3QVOA 4HGPA 3DTVA 3VX4A 4DHWA 2H2WA 1R7RA 4WV3A 4Z9YA 1PFUA 1XWFA 4R1SA 2QXTA 2PD4A 2VAMA 3MRTA 4G8CA 5IJ9A 1CKEA 1JMVA 1MN6A 2C5HA 2FFAA 2JASA 2YFQA 3FVQA 3Q3JB 4FYJA 5CYOA 1MJ5A 5J2TB 1K7YA 1GPLA 3K70C 3EDCA 3LHFA 3VUEA 4Q6WA 3WA7A 1A1VA 4AKHA 2H08A 1KOGA 5FYDA 3KTDA 3O83A 4XLTA 1WABA 4BGUA 2VUSA 3ROFA 3U7QA 4GPBA 3SJZA 4MVJF 3W4KA 1M8GA 2OO5C 4OHFA 2SKCA 4RQBA 1DWQA 2J4FA 3B1FA 3VAYA 2ATEA 4KMMA 1L3IA 1M34E 1EKXA 4Z0HO 3OIFA 2OZEA 2HF8A 4JBYA 5DT9A 4H7KA 5G1OA 5B58T 4Z7NB 4PG7A 3V1MA 2Q5HA 1GNSA 3TNFA 4MWDA 3PPIA 4PHGA 1I8TA 5DF1A 1QGUB 2EEPA 2ISCA 3IEKA 1XCOA 4ZKDA 3TQSA 4JLDA 1UFQA 2GPBA 1GNQA 3BDVA 3VKVA 1ODSA 1M6HA 4Q9AA 2COKA 4NULA 3R7BA 2X8BA 3ADPA 1QK3A 1FX1A 1IOVA 1VKOA 2HEGA 4KTVE 5TPWB 1YJQA 1RM0A 4EA9A 1X2EA 2X7JA 4KYVA 3ZJ4A 5AVXA 2QQEA 4E1AA 2GZ1A 3CPSA 5EUBA 1L5YA 2FSHA 3AVOA 3HKCA 3FYHA 1V45E 3FCXA 5KTMA 3GWZA 1SQGA 4NIMA 2OBXA 2FR8A 3SJCA 3TKAA 2ZI4A 3P4XA 1VMIA 4YIKA 1MA0A 1NXSA 1M1NA 3OFND 4KG7A 1GRQA 1DMRA 2ZRIA 2YWGA 4L4RA 3IUQA 3GUZA 3JW8A 1GKYA 1TJ4A 4FMDF 4B3DA 1GDTA 1E4OA 1RMQA 3DV9A 3QBVA 4JYCA 5ALRA 2PUVA 3H5AA 5J4YA 1LJUA 4GI5A 2O2EA 4XWAA 3TE6A 1QQ5A 1SXJD 3DO6A 1AC5A 1Y8CA 4E13A 5L7WA 4MCJA 2RFLA 3WB1A 2PYZA 5CDUA 1II8A 2P5UA 3BGVA 3RI3A 2YH2A 1WSBA 1YB7A 5B1HA 5BT9A 1ZK2A 1R2QA 4UAJA 1RRPA 3L0SA 1QGAA 1ML4A 4Y9UA 3QYFA 1VE9A 3T9DA 5KYWB 3A4VA 3KVVA 1WQ1R 3DL4A 3JVEA 2AYZA 3KZOA 2WEKA 1SPBS 1GTRA 5E2AA 2XOXA 1HYQA 4YP7A 1XTQA 4FU0A 3NIBA 3DONA 2DWOA 5GADl 3SEZA 4BFVA 1L8LA 1NY6A 1IAVA 4DLTA 4J2OA 3R77A 2GGSA 3DHWC 4CV0A 4NDAA 3TF5A 1AZWA 1KNQA 2FN9A 4YFYA 3TVYA 4QASA 2JLCA 2GEDA 3AU8A 5LD2B 5KUTA 1KH2A 3H5OA 2HF9A 4BFCA 3S40A 5IAKA 1YMVA 5HVNA 1JWAB 1UFOA 1CS0A 3ZXXA 4CMCA 2E4UA 4FSXA 5CA1F 2WJJA 1N2OA 4DAOA 5AW3A 3K15A 1DO0A 1HSOA 2W2QA 4IIXA 4BP1A 1OLXB 2R6DA 5SZKB 3SFZA 4D0SA 3TINA 1E2MA 4RVDA 5BQ5A 3BXFA 2FJPA 2WP8J 1KI1A 4FR5A 2B35A 4ZQBA 5CA0F 4WACA 1TIPA 1L7EA 2C82A 4FYXA 4B3JA 3X0DA 2F43A 5B3KA 3JY6A 3QKTA 1TUGA 2R1VA 1AO3A 3BPSA 3O92A 4WECA 1X13A 4BKUA 5B58C 5LWQA 5IAGA 1XNHA 2HCRA 3AJDA 1P17A 4PQYA 3NHJA 1OGYA 2CNWD 4C2TA 4PBTA 4JP5A 1XX6A 2FEKA 3FDXA 4KRXA 4YWHA 4ACAA 1ILEA 4CGYA 3E3OA 1WXFA 1GV1A 2PBFA 1GG2A 5BT8A 1H2HA 1IVYA 5CA0B 5LOVB 2L2QA 4D41A 1M2VB 1QCZA 3ANLA 1XXLA 3O94A 4C7OB 3IKMB 5MN6A 4IM7A 2RJ3A 2YTZA 1MQ8B 1D9ZA 4NR0A 2GCPA 3AVTA 1EG2A 5CH8A 2XA1A 3TTWA 4BO8A 1NG9A 1Z6AA 1YRAA 3NTXA 4PNZA 1SUCA 1JG2A 1UKYA 3WAGA 4ZU6X 2C29D 3JWIA 4BP8A 1U3WA 3E35A 1C7JA 4ESEA 2IHZA 3LC7O 3WVNA 4OOFA 3EVZA 3FDJA 1OHHD 3OZGA 3IXMA 4YUVA 3T7SA 2AEMA 3UTCA 5JDIC 3GNQA 2YICA 1QP8A 1DO2A 1YFKA 1JEAA 2E4ZA 2I4RA 2WI8A 2Q5IA 3D8NA 3DMPA 3EG9B 2OFPA 5EIHA 1LBSA 5FI0B 4DJJA 3G3EA 1ZK0A 5LZ8A 5DYIA 4ND1A 2JFZA 1PZHA 2VJAA 1LLUA 2WYVA 5U4XA 4B85A 5BP7A 1UPFA 1K7EB 1XDUA 2OK8A 4ETNA 3SHTA 2IYVA 4JSYA 2Q4BA 2QP4A 3AM5A 3L7BA 1AN9A 5BSUA 1PWEA 2JIBA 2OGSA 1FP4B 1PRYA 1RXSA 1B4DA 1I4DD 3VSAA 5BURA 1XSEA 1ULHA 2NQ8A 3LP5A 4QXAA 4KGDA 4HEHA 4E51A 4AK9A 5A62A 2W90A 2R11A 2WWXA 4NYMQ 3SLRA 4CNBA 2CXTA 5FOQA 1P2FA 3RODA 1QV7A 4DT1B 1OWPA 3GOQA 5DGIA 1TA0A 4OGWA 3HN2A 1DQPA 3EGCA 3CJQA 3RC3A 2NO5A 3OLZA 5H3LA 2V5VA 5HJ7A 1RAGA 4DR6B 3TLYA 5DNYB 5JFOA 2NTYC 5BWOA 1XEXB 4JX8A 4ZT5A 4BVHA 2ZCJA 3NORA 1Z22A 4X71A 3RARA 3QEOA 4F84A 2EX4A 1T5BA 2Q3BA 2FPKA 3JAWB 4LX0A 3ZD9A 1LPBB 1O94A 4JJKA 3I28A 3N5KA 1BMTA 4LIPD 5AO9A 2YASA 3O8OA 1Q1AA 3QV1A 2RGYA 2D1YA 2HCJB 1C5KA 4FS3A 4IO1A 4K28A 4LJ8A 3B3GA 1CS4C 3FDIA 2CC2A 3PDIB 3B2EA 2CW5A 3FMFA 3MJCA 5BSWA 4DAEA 2P30A 3L6UA 2C99A 3IIEA 3H11B 5FOUA 3HUEA 2CMDA 2B94A 5T4FA 1BFUA 1NOKA 2DP4E 4BAZA 1XK6A 1F2DA 5JZVA 1WBBA 1OH8A 2CXRA 1FMFA 1KYZA 3TOVA 3AP2A 2X5KO 3IJPA 3CR7A 2B98A 2X2PA 3DKVA 3O8QA 4MAMA 1JTFA 2Z5FA 3QVUA 4AZVA 2IS2A 3QYPA 1NN5A 2QV0A 4Q3AA 5EPEA 1VYHA 5BMVB 3LY8A 4Q3CA 3HPRA 5F64A 1WE2A 4IIFA 4UW9A 4GSLA 1F17A 3RBAA 2CK3A 2GYVA 1ESMA 2IY8A 2D59A 4CLOB 1N33B 1NONA 3AY6A 1ZNQO 4G1MB 4XASA 3SBDA 2Y2VA 3F6SA 4QXMA 1D2CA 3H5LA 1G8HA 4MQ6A 1E2IA 3WGQA 3B6MA 1EE1A 2ZJ3A 4U63A 3TJMA 4YV1A 4BMXA 1UMDB 1M6YA 1U9YA 3OU6A 1FDIA 3G1TA 2HSEA 4KQ6A 3H1GA 3X1JA 4XJVA 2DPHA 5HIJA 4O5OA 1Z28A 1XLUA 1ZIDA 4MRAA 3ZVLA 4LVNA 5K4HA 1YA4A 5G0VA 2R44A 2YKGA 3CRNA 2V7VA 2O2HA 2YQZA 4EY4A 1ITZA 4YAIA 4A5SA 5KQMA 1EQ2A 1IK4A 4IEFB 3FHTA 1Y7HA 1GZ4A 1YKGA 4FGLA 3C7KA 4ZD6A 2HNKA 4JUIA 5BNIA 5JCXA 4KLAA 5DMHA 1CQWA 1Z4LA 2PKXA 4HWSA 5BSMA 1G7RA 5I7VA 3RK4A 2DBVO 2I2BA 2B1QA 2O8DB 5HF5A 1YB5A 5D5QA 2HLHA 3EG5A 4RZSA 2YJ4A 1N9ZA 3E9MA 4WKPA 4EARA 2WYUA 2I22A 4BQIA 3MJFA 1NASA 2C78A 1EUCA 1K7CA 2QT1A 1M8KA 4WL0A 3UC5A 5JSZB 2C3MA 3ZCTA 1O96B 1LTHR 1NSTA 4PSVA 3S2SA 5LZ5A 4EW3A 1NXQA 1Q22A 4LQDA 1SQ5A 2WP0A 1EFVA 1H3NA 4M1WA 1P29A 4YCJA 1YGPA 2X0EA 3SYLA 2GYWA 3SJBA 3C85A 4AURA 5TDHA 2FWJA 4ECEA 4FP9A 2IYQA 4RIEA 1OFGA 1WVIA 1Y6QA 3GARA 3JZFA 4DIUA 3EIWA 4DR5B 2H1RA 3QU9A 4Z4EA 3BMQB 3LP6A 5CDFA 2HNAA 4JA0A 4YQFA 3FNFA 3K05A 4B4VA 3PFGA 4TYWA 3EGDA 5A6SA 2R87A 4OL0A 5LA6B 4B3HA 3KSRA 1KNXA 4YJ2B 1D4OA 1S8FA 2H8KA 4G5QA 4R71A 2PY6A 5A3VA 3MWFA 3NBMA 2LCQA 3RIXA 3WGJA 3HXOA 2AMYA 3QP9A 3EQ8A 4HWOA 3U3RA 3TSCA 2XMBA 2OGTA 3MOSA 5K8VA 1H4SA 4TKUB 1QOPB 2V3CC 4LKRA 1ZM7A 4LYFA 4FX2A 4DGSA 3H0EA 3EIQA 2XD9A 4QYTA 1SMKA 4LGYA 4ZEOA 1Y8RA 2JCXA 1PNVA 3MINA 3BSYA 5GTDA 2VT3A 1SUEA 2C0CA 2Y1KA 1H6AA 4Z86A 1U9ZA 3JWEA 5AJWA 4NF2A 2JGRA 4X24A 4U1RA 4FIDA 1V4NA 2AYXA 3RVKA 1P4JA 3H5TA 3X1YA 3INNA 4REQA 3WWYA 4DA6A 4JI1B 4UUQA 1EWTA 2IYXA 2XXBA 4KVZA 2HADA 4O4IB 3DWFA 1XKLA 2JAHA 4G0PA 4KLCA 1Y82A 2CJPA 5DJ5A 1B6GA 3NOXA 4PSAA 1E3SA 4JIGA 4O4LB 4BBJA 4DIEA 3N59A 2JAWA 2ZUEA 1LCIA 1UPUA 2OBMA 4JT8A 4WNAA 1HDZA 1WX1A 3QPDA 2AYYA 1C81A 4OB8A 1PL0A 4E5NA 2DG2A 1KIAA 2I80A 3P9KA 4WCFA 1DTEA 4MUXA 3C74A 2OOKA 1WUHS 1UM9A 3AM3A 4HQOA 2UKDA 4QYXA 1Z75A 1JIQA 3G8BA 4HLNA 1P0MA 3AETA 4R9RA 5GWXA 2GYUA 4CM7A 4YRCA 3FCCA 3NNSA 1CB7A 2I2CA 3NBXX 5H3HA 1YVUA 1CQJB 3VHQA 1FUKA 5BSFA 4X6XA 1OLSA 1ZQ9A 3M6WA 4ATNA 1ZMXA 2R8YA 4UHDA 1ODFA 1IY0A 3I64A 4J9VA 1YQTA 1COZA 3D3KA 3FUVA 2JFNA 4WIAA 3EBPA 2V7BA 3V1KA 1XR3A 1GA4A 1O6BA 3NG1A 4RU1A 2DFPA 2AV6A 1AX9A 1XEAA 1YKSA 2PFSA 3I83A 3IT0A 3D54D 3LHDA 4HXEB 3RG8A 5ICGA 2BFFB 2G67A 2OGWA 3MJ4A 3EDRA 5AI0A 4LFAB 3VNUA 3L49A 3OCVA 4YDQA 1KA9H 4UKDA 5K4GA 1VXRA 4L9AA 3SY8A 3DP7A 4YYEA 1ISHA 1Z7WA 1HQDA 2B4YA 1DTWA 3LT5A 1D2AA 4P22A 5CNIA 5CXUA 4NZZA 3QVSA 4DLUA 3UUFA 3I9JA 4ALNA 1SK9A 1FCJA 1I0IA 1A7UA 1KMIY 2QT9A 5BSEA 1KAEA 221PA 3VNBA 3IT2A 3TW8A 1LWOA 1T26A 5C8YF 2CHUA 1FQOA 3GD7A 4MGHA 3BWDD 1PK8A 1YQWA 2O52A 4XDHA 3HBJA 1DQZA 2VPWA 3AEUA 5FHQA 1DCFA 1ZMBA 5EKUA 4EVRA 2WWWA 3WIOA 3TG8A 2JLSA 4LNUB 5IAJA 5CA0A 1BQEA 1GZ7A 5H7XA 2PWBA 4CNQA 2A3RA 6ADHA 3N2YA 3BE8A 3C7TA 5KDOA 3L4KA 1F8XA 5BUSA 5BWBA 3DQPA 3OQ1A 5AJUA 4CE6A 5JADA 3V48A 1M34B 1B3RA 5KYXA 5KMGB 1I4WA 4C0XA 3AF3A 1ND6A 3MT8A 3STUA 4E6PA 1OLXA 4BJHB 4BIMA 2E9SA 3G8YA 1RWOA 2CFSA 2GLUA 3ZKWA 3ZV6A 4C6RA 1WIWA 4FFWA 4ML3A 2PKYX 1Q0UA 4R31A 4P0PB 4BO1A 4KQCA 4XZ3A 4YUZA 2BR3A 2QF7A 1C3EA 1AKMA 4JB8A 2JD1A 4KACA 4P3OA 5DISB 2PTGA 4N0MA 4RK7A 1JSZA 2I6GA 4HXFB 4NE7A 3T38A 2BLNA 5BR1A 4WXPA 1KWGA 1D8AA 1R5BA 2OHVA 2XUKA 5DMXA 1JNYA 3REGA 3UMYA 2C2XA 1TEHA 1XDWA 2AJBA 4TV8A 3UHPA 3TLMA 5E4TA 3FLAA 3K9BA 3GEBA 4RDHA 1V43A 3GV0A 4U6NA 3DPSA 4JFRA 4JOSA 1YJAA 2VYQA 3I1YA 4XGIA 2PZAA 4Y1EA 1NLMA 4XVUA 3IEIA 4DLRA 1RI1A 3G9QA 2AOXA 2DHCA 5JS2A 3P0RA 3GLQA 5K3CA 1R00A 3DE2X 1A8SA 1U2GA 2O7QA 3HVJA 1DBSA 1ZL0A 4OLBA 3RR2A 4GYKA 1CJMA 1QP7A 5FOVA 4BEBA 3BDAA 2YHUA 3BULA 1XVUA 3AU9A 3LS2A 2ORED 4RD6A 1ZOSA 2Q7DA 3TJRA 1T36B 4MRSA 3PYXA 1WG8A 1U0SY 1UBGA 1B0AA 3G02A 4D2IA 4TWBA 1KRHA 3GU3A 3WS7A 4TKZA 1QX4A 4B7XA 3H9JA 1WCWA 1HG1A 3DB2A 4D25A 2DBYA 4KV7A 3VDQA 2OO5A 3HY4A 4EQ6A 1EE2A 1ZUD1 2K2QB 1DCKA 2IC5A 3G7NA 5DV9A 2V45A 2VPZA 1EEHA 1P75A 4HUTA 5I7RA 3PL1A 1S3GA 2VCHA 2WR8A 3ZE7A 3OECA 3BXPA 5BV8A 4PIPA 2KSQA 2XB9A 1ZLYA 2Z56A 3ABIA 5CLQA 2AX3A 1T8UA 1XQ9A 1TU0A 3DOJA 1GR0A 2EEZA 2R85A 1DV1A 3BBLA 3FFAA 3ORHA 4V2IA 4ZZ2A 1MQAA 2O2GA 4EKYA 1BDBA 5B36A 4JI0B 1G8FA 3HV0A 1ADJA 2E82A 1SIBE 2PZKA 3EVNA 4GM0A 1JQBA 1LI4A 4HN4B 4IWNA 4K1XA 4S1PA