5ESXA

Crystal structure of hypoxanthine-guanine phosphoribosyltransferase complexed with gmp from legionella pneumophila
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
187
structure length
187
Chain Sequence
HMTIPDKIKAVYEKSTCLYTSNEVEAALDRMAIKIHETLQDKNPVIICVMVGGLVPLGNLLHRLDFPLEVDYVHATRYRGDLTGGDILWKVRPSSNLAGRTVLVVDDILDGGITLAAIINEIKAMGAAEVYSAVLVDKYRKRVPNGLQKADFVGLQVEDHYIFGYGMDYHEYLRNAPGIFIVHPDHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Apo and GMP bound hypoxanthine-guanine phosphoribosyltransferase from Legionella pneumophila and the implications in gouty arthritis
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila atcc 43290
molecule tags Transferase
molecule keywords Purine/pyrimidine phosphoribosyltransferase
total genus 54
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5esxA00
1TC2A 4X45A 4LZNA 5IAOA 5ESWA 1QK4A 4OHCA 1I5EA 4QYIB 3OZFA 4TWBA 1DQNA 1DKRA 1OREA 1NULA 4RHTA 3ACDA 5BQPA 4WN3A 4RACA 3EFHA 2IGBA 4RV4A 4RAOA 1GPH1 2GEBA 1I14A 4QRIA 3GGCA 1L1RA 4M0UA 2P1ZA 4LZAA 4RHXA 3N2LA 1L1QA 4LZOA 1QCDA 1BZYA 1P4AA 1FSGA 4F8EA 1G9TA 1XZNA 2DY0A 1U9ZA 1A96A 2EHJA 3S5JA 1MZVA 4P3KA 3M3HA 1AO0A 4WMLA 2PRZA 1G2PA 3DEZA 5JV5A 4PAWA 3OZGA 4IJQA 3MBIA 4P81A 4P80A 2JI4A 1PZMA 1ZN8A 1A4XA 4KN6A 1STOA 1UFRA 1ECFA 1CJBA 4RANA 3ACBA 2HCRA 4M0KA 5EUCA 1I13A 5BRNA 2YZKA 4QYIA 1BD4A 5JSQA 3G6WA 1HGXA 1WD5A 1QK5A 2FXVA 2JKYA 1QCCA 1VCHA 1G9SA 1VSTA 3HVUA 1D6NA 1I0IA 4RADA 2JBHA 1NONA 3QW4B 4S2UA 3O7MA 3KB8A 3OHPA 4P84A 1UPUA 4M0PA 5HKLA 2XBUA 1YFZA 2H06A 1A97A 1GRVA 3GGJA 1TC1A 1DBRA 4RHUA 5ESXA 5KAMA 1XTUA 5HIAA 2WNSA 4RABA 1V9SA 5KAPA 1XTTA 1P17A 2PS1A 3DMPA 1DQPA 4P82A 1A98A 1JLSA 1VDMA 5K51A 1P19A 5IPFA 3DAHA 1Z7GA 4JLSA 1ECGA 4ZFNA 4FYMA 1U9YA 3LPNA 5E38A 4LYGA 1J7JA 1BD3A 4JITA 4LYYA 2AEEA 1XTVA 2E55A 1I0LA 3H83A 4PFQA 2C4KA 1QK3A 1O5OA 1ECBA 4MB6A 1ECJA 4P86A 1QB8A 5BSKA 1Y0BA 3LRTA 4RHYA 1HMPA 1LH0A 5BQOA 2VFAA 1ECCA 1UPFA 4X44A 1XZ8A 1OROA 3MJDA 1JLRA 1A95A 1OPRA 4P83A 1P18A 1IBSA 2JKZA 4RAQA 1O57A 1R3UA 1ZN9A 4Z1OA 3GEPA 2H07A 4RQBA 2PRYA 3ACCA 1QB7A 1A3CA 3NAGA 1DKUA 1ZN7A 1G2QA 2H08A 4RQAA 1W30A
chains in the Genus database with same CATH superfamily
1V4VA 2LGJA 5ALQA 2BZSA 5HS6A 3PWTA 1NLMA 3UWMA 4BN5A 2FQXA 3C16C 5HR5A 5LLDA 4JSRA 3AF5A 2QVXX 4HAYA 4XYGA 2OYRA 4AXXA 1P39A 1FNDA 2WDPA 3EWIA 3H4VA 1UT8A 5CLLA 4D9NA 2VRNA 2X7HA 3ZE1B 2NU6B 1Q95A 3HR8A 2HLDA 1Q7CA 4O4IA 3EFHA 4JI5B 1MO5A 5KVCA 3R9XA 4ALIA 4BKQA 2AC7A 2C2XA 2XWBF 4P33A 2WTAA 3P2EA 1TVKA 4ILEA 1U2RA 1Y3IA 4V1CA 3RT1A 1HH4A 4YX9A 1OH6A 1D9ZA 4IJ5A 3JATB 3RNLA 4KLCA 3M1AA 1U5CA 4S35A 2EERA 2OCYC 3BM5A 2O0MA 1XRSB 1U9JA 3D31A 4J0HA 4EGAA 1V3UA 3OQHA 3WA7A 1PJRA 4WHMA 1YIAA 5DHPA 2O2EA 4J16C 5F78A 1DCKA 1ZM7A 2EHJA 5M3BA 2GK6A 5CFRA 1B74A 3AUSA 4UCXA 4IGFA 2PO5A 2BFDB 2BRUA 5KNDD 4NI5A 3IP3A 1S6YA 3CMCO 2YWFA 3LKBA 4M9CA 4X93A 3HBAA 5J2TB 1M1YA 4MS3B 3QKWA 2HHAA 4BN4A 1O03A 3ORFA 2W2QA 3IA2A 3L05A 1IBMB 4P08A 3H5NA 3KQUA 5CLJA 1VSQA 2UUOA 2YVAA 2PAAA 4Y0AA 3QLVA 4F4CA 2WAAA 5JC8A 1KVUA 1PK8A 3WV4A 2QUAA 3ONNA 1MX1A 1ZFNA 4ER0A 4ZI7A 1LRLA 1TTPB 1C9KA 2VJBA 4LJ8A 3I2HA 4MWGA 5IWCA 4PZYA 1ZVJA 1PSZA 1QQ7A 5JAZA 1BX3A 4U2CA 5LQKA 1BVYF 4CKEA 4IIHA 1AN9A 2YL2A 4RADA 3IR5A 1C0LA 3NVKI 4RHCA 1IN7A 3A9VA 5IN4A 1L7DA 1USGA 2IW1A 1JEAA 4ARUA 3FFBA 1L3BA 2NM0A 2O2IA 3K35A 1KJZA 2WJAA 4ZO4A 5CUQA 2OECA 3VPCA 2QQ0A 3R0ZA 1FMLA 2BMJA 1GAEO 1UZAA 4GOND 3UA3A 3TX2A 3WI7A 4WJZA 1ICEA 3HUDA 3JQAA 1I4WA 3G0IA 2IXFA 2GJ9A 3FX2A 4K9RA 2OQIA 3FH0A 3BWVA 3MINB 4FMBB 4N1AA 4HNVA 2I1WA 4RA6B 3WLEA 2ZOSA 3WLRA 4L3WA 2F48A 3PVCA 4DR1B 3TEJA 4DLPA 1V3QE 2VDWA 5CVUA 3KRTA 1JRLA 4GYWA 1CJUC 4PU0A 1SOMA 2RCYA 2GZHA 3GX1A 2C61A 1WB6A 2PZMA 1CYDA 3WK8A 1G6OA 4FFRA 1EFKA 2UYYA 1YCHA 1MAVA 3PYLA 4Y1EA 4Y6QA 1DAEA 1T13A 4WSOA 2BF7A 1VBMA 4JUDX 4YAKA 1PTKA 1CEEA 4R2LA 3L0IB 4J91A 4XSHA 3IDAA 5CDFA 4IJVA 3S8EA 4AUMA 1KY2A 3CNEA 1A7KA 1RFLA 1HMPA 1C81A 1FSFA 1CQIB 2AFVA 2G9RA 2XT0A 3GRPA 3L1VA 3CONA 4OQLA 4PX5A 3PC4A 3GJ3A 2OFOA 5FQOA 1R3DA 1LPBB 1XROA 1ZX1A 3WTCA 1Y89A 4C0LA 4YV7A 1IIRA 1CNFA 4NOMA 5CK5A 5CVVA 1PSDA 1YR9A 4KDFA 5JALA 4TT8A 5L7TA 2CK3A 5K09A 3ND9A 2EW2A 2MYPA 3G9XA 1E18A 2VP5A 1R7RA 4HP8A 4MVJH 5K0BA 1DQZA 1G20E 3QEJA 3RHFA 3SHFA 5FOVA 3SZGA 1KOJA 4NCXA 4EZIA 2F67A 4EENA 5BV1A 4ZIRB 4JN6B 1FJ2A 1RRMA 3R8FA 3UB3A 5E6UA 3SBOA 1HQKA 4MUNA 4F93B 1H23A 5JDCA 5L3ZA 4PAQA 3OAAD 4G2NA 4R1PA 4ZRNA 4NV1A 1ML3A 4MPDA 3TZKA 1EFPB 5K05A 4V39A 3OVMA 4QVGA 3GHHA 1NP7A 4ISCA 4QRIA 1BOOA 1UOEA 4IO1A 5TR9A 3W05A 4KXVA 5CXXA 1WTCA 2YV5A 5EPEA 5SY4A 3TQRA 4HQLA 3IO3A 4LI3X 2VCEA 1AHPA 2OC4A 1TLLA 1AUOA 3CZ4A 5IKPA 2ZS9A 4XR9A 1MVLA 1QHGA 1ZM3A 4UKDA 4YJ2F 3X43A 4B34A 3D2CA 1WCXA 2V6GA 1XKXA 4P7FA 4L4RA 5EZ5A 3UV6A 4AJ9A 4PYRA 4OK3A 1X9HA 4HDNA 2RKBA 5J2UB 3U2QA 4AP6A 5LKAA 5LFAA 1H0KA 4W5OA 4DJDC 1OASA 5AO9A 4RTLA 5A04A 3EY4A 1WXWA 2Q1YA 2XUGA 2TMKA 1T25A 3I5UA 1R27A 3OUZA 1ZN2A 2J0VA 4IYRA 4JBXA 1R0SA 2RHJA 2RGWA 1JLKA 1R4ZA 2FMXA 3DHYA 3H1BA 3KE8A 4FYWA 4FKZA 1EFPA 4KQ9A 3PDHA 2ZJ5A 2B25A 2VK8A 1W2HA 3GYBA 3D8HA 1NA5A 1I13A 1PJTA 3LUBA 3N9IA 5TB5A 1G4HA 3VR6H 5A2GA 3L6DA 3WWYA 5CD9A 3ZWYA 5CYFA 2FWAA 1SVNA 4R2XA 1Z36A 4B4WA 2BP7B 1UM9A 4RWEA 2DF8A 2J46A 4K46A 2H4XA 4LZPA 5GV8A 3SZOA 5A3RA 2PUCA 5JXHA 2H31A 5E7MA 4HADA 2JHAA 3R24A 4N7MA 1RXVA 3K71B 4PO9A 1ZLXA 4NZ9A 4PZ0A 1NV8A 2DUJA 2Q2WA 2R5FA 2WUEA 4U7JA 1L5RA 4WINA 4CT0A 4YV1A 2BGNA 5AJXA 2Z8XA 1NN1A 2J0QA 1QHSA 3FMFA 3DQPA 1J8FA 2HWWA 1OH5A 2FHPA 3FMGA 4MUFA 1ZUD1 2Z8ZA 4G36A 4QU0A 4WCFC 2GBGA 2O0KA 4MKRA 3VPFA 3C3MA 2JVJA 1WVMA 1WD7A 2WF7A 4CR7A 2D4HA 4BECA 2BKXA 2CXNA 3MIZA 3WKAA 2CHVA 2H2GA 4KLNA 4MRNA 2VPPA 2XBMA 4PIPA 3DOHA 2KBFA 3K70D 3LUPA 3ZQ6A 1C14A 4K6KA 3C5WP 1FCJA 1C1HA 3HXTA 4UVDA 3CSDA 5K2MA 3PNPA 4HAZA 3GPBA 4RQTA 2QX4A 1KJIA 1KMMA 1MEEA 1F0YA 1SEVA 4IJUA 1LSOA 2EWWA 2GAFA 3O1HB 4OHXA 4R2KA 1CRPA 1HPLA 1E5QA 3R9IA 2AMVA 1UBKS 3ENNA 4E1AA 4G0ZA 3GQBA 3VSDA 3IKMB 1YZQA 3AI3A 1R3UA 2LPMA 1RI4A 3UJAA 1N0VC 4W1PA 4OL0A 2VUIB 3M2PA 2GZAA 2H0QA 1EGVB 3HO8A 2I4MA 4YJDA 4F2HA 3VR0A 3LUDA 1XKQA 1PYOA 4TWBA 2D7DA 3UJ8A 1J2TA 3NT4A 4JFRA 5LZ7A 4MYTA 1JG6A 3V8NA 2CB0A 3Q3JB 3U4IA 3U1TA 2CLLB 3FETA 3R0XA 3L49A 4LMAA 2XX3A 4C2AA 4B0OA 2FPKA 1S8AA 1T5TA 3DV2A 1U9IA 3DM5A 2VHTA 4AJOA 1KSHA 2J3MA 4DA9A 1WRBA 2JJYA 3B13B 5G0UA 2QS9A 3KSZO 4JVMA 4O1HA 2YJNA 1OLXA 5GWXA 2JRLA 4MS3A 2J0SA 5DT9A 5FOXA 2OCAA 4JK3A 5AD1A 3FCAA 5IBQA 2H65A 5B2ZA 3S28A 2Z6VA 3Q98A 4KR9A 4QEDA 4WD3A 1W2WB 5EINA 4HDSA 2I4NA 2M1XA 2Y6VA 2NW6A 4F71A 4FWTA 4DANA 1KMCA 3CUTA 2P2ZA 1EBUA 1PZFA 1AH2A 1X8KA 4LHSA 3IRVA 1GQYA 2AYZA 5JO0A 4O25A 2ETXA 1SZJG 3ZHZA 5FTMA 2Q6LA 2JLUA 4MVWA 4TTVA 1KJJA 2SICE 3NP7A 1NHWA 1SOWA 2ZYRA 4L72A 2AQIA 5HX7A 2FE1A 3WLHA 4O4HB 1OWNA 4Y8VA 3EQ6A 4Q5IA 2ZUSA 3U37A 2A0YA 5B6PA 4BOYA 1Q84A 4PWYA 3BE4A 2E4AA 1VCHA 1P4JA 4N4AA 4TMTA 4P6VF 3UK1A 1KZ9A 1GPWB 1ZOLA 2FUCA 1XL0A 1NVFA 3PRHA 4AMZA 1WQ3A 1A0OA 2V8OA 1RXYA 2JFXA 4BFZA 1KARA 4LHYA 1ZICA 3NBUA 1DT3A 4LGVA 3N86A 3L8GA 4NMLA 4A2QA 3RFXA 4GQBA 4D79A 5HVNA 4OLAA 1M34A 2YOHA 3DFFA 1MW9X 4M8KA 4EAAA 2EKPA 4GBJA 4ENVA 1NDUA 4IJKA 4L9AA 1Q1QA 3G5TA 3BCHA 3MAAC 3BCUA 3WK9A 2UZ1B 3CRNA 1UP4A 3K0FA 5GVSA 2V1XA 3IFSA 4IDEA 3TLYA 3OCYA 1CDOA 3Q5DA 4G8CA 4MPTA 3LKVA 3UAXA 3TRFA 3UXYA 2F1OA 1FX0B 4F2PA 5C5EA 1AV7A 1W29A 4EUHA 5JD4A 2ZJ8A 4C0XA 2DU8A 5F77A 3AR6A 4FFNA 2INGX 2BELA 1SVMA 4JR2A 2OR3A 5A1TA 1T8YA 4DLKA 2A86A 2IVZA 4W6QA 2M32A 4CEJB 1Z3CA 3ND5A 3UMSA 4WZBA 2LCIA 4Y7CA 1GZ4A 4W7IA 2V54A 4G8DA 3WGQA 4RAQA 4Z53A 5KSPA 5I9MA 1RXEA 4ZTZB 1QDLB 2OBYA 1YK1A 4DV5B 1HDRA 3KU4A 3L7JA 5J4KA 5CK4A 1EWQA 4DG5A 1IHDA 2VAMA 4XOIA 5D3QA 1WV1A 1M73E 4R5HA 4DG9A 1EWKA 3L41A 3L4KA 1TW2A 2ZVQX 3QP9A 2WFLB 4YWJA 5G2OA 4QG3A 2NP6A 3EJWA 4QGGA 1AF4A 3F6BX 4IIBA 4C5BA 3QMPA 4W9NC 1HY3A 1NULA 1ZOOA 4EB0A 4Q3BA 1N3IA 2C98A 5DHAA 2V8BA 3F3YA 3PR2B 2UVPA 4AQ7A 2CYCA 1F17A 2CXRA 4Q9HA 3ER8A 1XA4A 3N0XA 3IJPA 4LYHA 5F2KA 3GEGA 3UAZA 1R0CA 3HJFA 1EBFA 3L4BC 2PT9A 4KO3S 4TRJA 2WVGA 3DEHA 4OJTA 4D8YA 3B70A 2J33A 4B6GA 2B8TA 4JWTA 3N0TA 4OHRA 1Y9JA 3ZWQA 1G7SA 1MH9A 1QZXA 4M76B 4TKVB 4NV0A 5G41A 1T5HX 4KKVA 2VPYA 3LCUA 4Z3OA 3QOXA 4D42A 3EGEA 4HQFA 3EXEA 4C4OA 3GARA 3GPCA 5DBHX 1B16A 2OHOA 4OQZA 1AHIA 1P6UA 1KY5A 2IEDA 1WDLA 2QAGB 3BKWA 3BXOA 4XGIA 4LJYA 4MMZB 4EEZA 1W4BA 4FE4A 4DNFA 1N2GA 1X7YB 1JDZA 4MW5A 4NATA 1A04A 4B75A 4YJ3B 5BN4A 2JD0A 1KQNA 1TKCA 3W04A 3MZ0A 5H80A 4L3VA 4XJXA 4U0JA 2QQ5A 1CX9B 4YRFA 1EZZA 2FWIA 2XNDD 3RSGA 1BE8A 3O8QB 3IKLA 4OGGA 1ID8A 3KWJA 5BRNA 2X6TA 4RTMA 2C58A 4JQOA 4UDXX 1G9XA 4LY3A 3Q15C 5CFZA 1NI5A 2JRCA 3VPHA 3FFTA 1KC1A 2CNWA 5AI9A 3NVAA 4WGFA 3UK2A 2HM7A 4XAQA 4CLRA 4IIGA 3VVLA 2WU0A 1F51E 1SQSA 3GR6A 5BP7A 1Y1LA 4H6PA 2AOTA 2WE7A 3LY9A 2RI6A 3FDZB 4KFSA 4PZAA 4RU1A 2DHRA 5K3CA 3ZH2A 1VLJA 1ORTA 1RP1A 2JLQA 3Q5GA 2OP1A 4M6WA 3U4QB 1DAHA 4KIWA 2W6NA 1ZH4A 3TQHA 3ZY3A 2AKAB 3BIOA 3K1YA 1TUBB 3LP5A 1G66A 4J3JA 3WISA 1AGNA 4UOQA 1U3TA 4GP7A 3D7LA 1HNXB 2EJTA 5AI6A 4EATA 5ENZA 1A71A 4JXJA 3RBVA 4AICA 1NKSA 4DWOA 4CL3A 1R0WA 5TJHA 4ENQA 1QXSA 1SKYE 1XR3A 2BD0A 3DBLB 3HJUA 5BN1A 2JI8A 5GPBA 1CUVA 1KXZA 1Z17A 1DFIA 2NO7A 3FFAA 2O4CA 9LDTA 4ZO8A 1CZUA 2B9VA 2PLRA 1RJ9A 4QYSA 3K70C 1GTZA 4M6WB 4OLJA 1OFGA 4FM9A 1S0UA 5LBIA 3OI7A 2ZUFA 2QAGC 2XD9A 4OA5A 1GPJA 1XRLA 4XASA 3GFTA 2Q4EA 4MDHA 5ESDA 3V2IA 2I8LA 3PLNA 5KWVA 3AJ8A 1R50A 3HB1A 3DOCA 4G5OA 1J5EB 2P62A 1K3UB 2EYQA 1GVHA 1HFEL 2RSLA 4NTZA 2CDRA 3D7SA 3DMDA 3ITNA 3QWAA 4TYWA 2O59A 4B3GA 3L6CA 3MWYW 3OCJA 5ESRA 1QVRA 2JBAA 3BZUA 3DJYA 3JD0A 3LY7A 2PSEA 4LWQA 1GFSA 3CIOA 1SVKA 4RA9B 5IXSA 2NZ2A 2OWEA 4TLAA 1W1IA 1UBSB 2XKBA 5T4EA 4X65B 2GPAA 3NRBA 4KWHA 2C1XA 4WV3A 2GZMA 3VTKA 4E21A 1HQYE 3TZ6A 4E5DA 1YZGA 1MX3A 2H5LA 3R5KA 2YNMA 5K20A 1BQ4A 3HVKA 2WAMA 3CLKA 3RYIB 1R8YA 1UAAA 3QWBA 3G8YA 4IV0A 4I9UA 5KZMB 5HNKA 1QDUA 3ZE0B 1H42A 1QGDA 3F8WA 2O48X 3PS9A 2F1KA 3R4CA 3WV5A 5I9LA 4ZDJA 1MFPA 5JS8A 3CZPA 1Y7IA 2VJOA 4CE6A 4DZZA 4Q9IA 4Q00A 4M9XA 2NUPB 3ZU4A 1NOIA 3EXHC 1N0HA 1C4WA 5TPWB 1L8XA 2FPXA 4I36A 1YS4A 2GKOA 2WLTA 3LHFA 4Y2SA 2WSSD 3ETHA 3AT1A 3WMGA 2FPOA 4JIMA 4EVSA 2BM9A 4NBKA 1VE7A 4FS3A 3EFBA 1G9TA 3QQPA 4E6PA 3PC8C 3L1HA 3O4HA 4LTNA 4DMKA 1K7CA 1SKMA 2C8LA 2VK4A 2NZVG 1GN8A 4H08A 4H1UA 1VGQA 1LW6E 2UVPB 1J33A 2YY7A 4YAFA 1M2HA 4CIXA 4XQ9A 2UUAB 5BXYA 1NSFA 4O4IB 1T9HA 2HRBA 1QIEA 2QY9A 4CM4B 4FCCA 5TGTA 1SZCA 4W63A 2D4AA 1RYMA 1EI9A 2OZVA 3BIJA 1Q7EA 1G5QA 2ZUBA 2DPLA 2Q27A 1L5LA 1I3NA 4LN1A 3WNQA 4M0DA 5AVQA 5L95A 1RLOA 4X62B 2FPIA 4HB4A 2DKFA 4IEFB 4KN9S 2C7QA 3EYAA 4B7AA 4X1KB 4LYEA 3J80A 1M6VB 4YJ3F 3AYXB 3U4AA 3SX4A 3B2EA 4LYDA 1RZRD 1RSZA 2P0AA 1ORWA 3ID6C 3KELA 2FPPB 2QYHA 4OI4A 1U8UA 3LTNC 4IXDA 1PJZA 1J97A 1Z4MA 4QG7A 4U2BA 1XZLA 5U4QA 3AM1A 1AKQA 5CT4A 5ALWA 3R9WA 4O2AB 4P3YA 1BG6A 4HBZA 5E0KB 4KN8A 4F72A 4XPZA 4JEUA 1S9HA 3LVBA 3Q87B 2ZR9A 4P2BA 2DFDA 3P8ZA 1X7HA 1QH0A 2NNLD 1TKRA 4ER5A 2XLCA 1DKQA 1FX0A 1GGEA 2F59A 2B1IA 3ETNA 4MAMA 4MS4B 4LRUA 4DVJA 2QLJA 1XOIA 4AO7A 5DK6A 4D74A 2X1VA 3K0FB 1JLSA 2BGMA 4K28A 1OOEA 1RQ2A 1XALA 1I7LA 2VL7A 2LWIA 2JCGA 3ECCA 2XNHA 3OMLA 3DE4X 1VSVA 1U0GA 1XDDA 3VH2A 3MBKA 4JSTA 4U9IS 1R6UA 1QF6A 2F1HA 4ITRC 1ND6A 5EE5B 1L4UA 5CA0B 4I1PA 4AKEA 2EXXA 5DU2A 5JCXA 1V5EA 2GXUA 2QUBA 4YRPA 3VR5A 1G8GA 3M6LA 3EVNA 4ME6A 3FNBA 1JEQA 1F8YA 3QPCA 4WTOA 5CH5A 1Y82A 1Z6QA 2VNAA 4G67A 3RVPA 3UUWA 3EGWA 3WWOA 2FK8A 2I4LA 3RAFC 2VKTA 2IL1A 4JOCA 2Q0SA 1MIOB 1JG3A 3B8EA 2GTIA 2CUKA 3FGZA 2OOSA 2ZJAA 3FDXA 3MOIA 4KUHA 1W4RA 5B58T 3AL2A 2GDZA 1HDOA 1R8SA 4XRGA 3PR1A 2V98A 5LQNA 1XLVA 1RFGE 4MGIR 1PL7A 2EZ8A 3NHLA 2FE4A 2XUJA 5K3BA 1OE0A 3NIGB 1VMKA 4WZBE 4XTRA 3IEUA 5GVRA 1E7WA 3EQ8A 5DHTA 3PWZA 4MPPA 3ZV6A 2ZI3A 4DZRA 1TJPB 3QX7A 5L8VA 1YB5A 4HKTA 2CXQA 1J70A 2H5IA 1XDWA 3GJQA 2BFFA 4LF7B 1SR8A 4GMDA 1PFWA 1DB3A 2DPGA 2PXXA 3TSAA 3WQRA 2FOIA 1LF0A 2ZT5A 3I58A 2MDTA 2FG6C 2O3QA 3VH1A 5JYDA 1CY4A 1QCDA 2VJQA 3R3UA 4G0UA 3FB1A 5KSZA 5BRAA 3ESXA 3MNFA 1G5PA 4MNTA 4WN9B 4FDVA 3A6GA 3MYYA 2AE2A 1QFYA 3QEOA 1FDOA 2V6BA 3K0HA 3IQZA 2Q2OA 3ET4A 3CX3A 1NJ2A 1GRCA 4WMLA 2ZLBA 2XNJA 3ZY2A 2C2OA 2PUFA 1VJCA 1C9NA 3DCJA 3ETJA 3N3BC 4I5DA 1ULBA 3MBIA 4ZVQA 3X1KA 3O4GA 3LPLA 1NUAA 3ELWA 1RAGA 4H27A 4YRLA 1U02A 5TV2A 2ZJ7A 4QUHA 4AB1A 1KJ8A 1BKDR 3K16A 5TPZA 3ZTTA 4YCLA 3DCNA 3CLRD 1G5TA 3C1TA 4B47A 3PXDA 1B3BA 4FLMA 1EAMA 2A0FA 2Q46A 4FIDA 1UEJA 4KE9A 4JZYA 3T5CA 2I0FA 1QIGA 1YDEA 1AK1A 4LECA 1QK5A 3U3XA 1EZ1A 1TZ2A 1VJ1A 3DVSX 5KHOC 1J49A 1QS0B 3CG4A 3ZDQA 4J7UA 2DHEA 2ZUDA 2MWMA 4JXXA 2IEAA 1NVMB 1T5LA 1Z62A 3D6NB 1GNTA 2XH8A 1WCWA 3A3KA 2C5GA 4Q34A 4HLNA 2NSYA 5GZ3A 5HQJA 5BSGA 4XWTA 1WDKA 4H17A 1DZIA 4CPDA 5K8UA 1GAWA 1P2BA 5JISA 3C7TA 4XFDA 3A28A 1GQQA 1KP3A 1ZK2A 1MT3A 2OGZA 3MRXA 4PV7A 4ZO6A 2VPZA 4Q66C 3PIDA 3WLAA 5KWEA 3ORQA 2QMZA 1HEIA 3ST7A 3MUFA 3CNHA 1MQSA 1YHYA 1PW5A 1DP4A 1AURA 1NYLA 2GD6A 1M1ZA 3S2SA 5FDFA 4QPCA 4B87A 2YJ6A 4JDPA 1RRPA 1NI4B 3K1AA 3LE8A 4P0TA 4ZVOA 2DCUA 3TRJA 3VR3D 3A6FA 2ASVA 3B53X 3IPCA 1ISJA 2DSNA 1G8FA 2Y68A 4E22A 3T5BA 1BQ3A 4X7PA 3QVKA 3TL2A 5I5EA 3WGGA 4JOSA 2YV1A 4QGSA 3EZXA 2XHEA 3ZGOA 4C4SA 2AEFA 2N9UA 2AFIA 3QMWA 4QOHA 5JG7A 1O5OA 2QOEA 2QX7A 5HIIA 1ID1A 4OJQA 5K3OA 3H8JA 1RC0A 1J6UA 3HB4X 3IEKA 5K3FA 4D02A 3B6IA 2IUFA 3DKVA 5JCPA 3JU3A 4JODA 3SQLA 1U2GC 2M98A 4GVLA 4PE5B 5K0GA 4BKPA 1PS0A 1ZCBA 4YT4A 1NR1A 4PYJA 1E1CB 3GPDG 3GZJA 1K5GA 2PKRA 4IGAA 1KK2A 3PP8A 4JKYA 2ORYA 4AY6A 2W8BA 3P2OA 4EY5A 2ERYA 4W9MC 1YKSA 2VF7A 4JP1A 4B8YA 2QA5A 4ZHQF 4LV8B 2AUMA 5BV7A 5DCUA 3IAAA 5IANA 1MC8A 3N75A 2B8JA 1JR2A 1MBZA 2C3MA 2KLBA 1SBHA 2P1DA 4GR4A 4ZC8A 5SICE 4QKQA 5KOIA 2D5CA 1L0BA 3MWDA 5JANA 4G0QA 3TOSA 2A0WA 1H5UA 1U2DC 1E2LA 5JAHA 2ZCJA 2UXBB 1UXOA 3V7FA 1XDGA 1QC5A 2XZOA 4MULA 5KYYA 5IJ9A 4CM1A 1OAOA 2G80A 4YASA 4DUGD 3PFHA 1KZ1A 2RH4A 3V1MA 4F7DA 4HDRA 3SZMA 3A7DA 4ZMBA 5F2OA 2JZCA 2WKRA 4RYLA 1QZZA 2OVBA 3IP1A 1W4LA 3BH7A 3E3OA 3BKXA 3C5VA 1GXSA 2PHZA 2B92A 3F9RA 3PQ4A 2HMAA 4JMLA 5J9FA 3T1HB 1UC8A 1XZJA 2FMTA 4J94A 4GBGA 4PZDA 3SICE 4PPGA 1N8SA 5LP6C 4QHYA 4BASA 3E35A 4LF5B 2LV8A 1XVTA 5LLTA 3Q4GA 4YR7A 1GDTA 6ABPA 3U4MA 3K8OE 4L15A 2FQWA 1WW2A 2FQYA 1E6CA 1WX1A 2XADA 5FWAA 3WL8A 2XUAA 5C1DA 5JZ9A 3LC2O 2R6ZA 2EP5A 1GL9B 1JJVA 1XJ5A 2BI7A 2IPOA 2JI4A 2JVKA 3NW9A 1NLFA 1WXQA 4QGFA 1W5TA 4ZEXA 4QXPA 1JS1X 3ZCXA 1M83A 4QT4A 3HXOA 4XI9A 5HPYB 1U6IA 5BWBA 1EPUA 1INLA 1T5BA 4Q16A 1YJQA 3ETEA 2QRNA 4J3FA 4PG6A 1E6WA 2WQ6A 1JLMA 1XVLA 3EN0A 4DABA 1KI9A 5KNBH 4AULA 3Q5EA 3VVCA 1X3LA 4F6LA 1RYEA 2WQZA 3I9V6 4F91B 1P1RA 2GO1A 2P2DA 1NY6A 4KZKA 1H2AS 4S1PA 1QE3A 4C3OB 4D2IA 1TK9A 3EPRA 4CQLB 1AKYA 5J4LA 1OBVA 3NAMA 4DLRA 2RHMA 5CFLA 1E1DA 2I3AA 3ABRB 3BHIA 4ZCIA 5B2EA 1TC1A 4OHPA 4YIKA 2B34A 3EWAA 4MX8A 4C6RA 5KREA 4LF8B 3M33A 5FI5A 1Q1EA 1NC1A 3SS7X 1R5BA 3RJZA 3NBFA 2ZI5A 1XXLA 2WHPB 1NATA 3HR7A 2CMGA 3HWX1 3PHBE 3FIUA 3UV7A 3A6PC 2PXHA 1N2OA 2CL0X 4ARCA 1S3SA 3JQEA 3P2JA 5KUTA 1OFUX 3C8HA 3AB7A 5EIEA 2GAJA 4FKMA 1A7AA 3LT1A 3SU8A 5ED4A 2AT1A 1Z63A 4CR6A 3AEZA 1I9GA 4IAOA 4TLEA 1AN0A 2B3DA 2EZ4A 3OPXA 4AMGA 2HADA 3D8RA 5JQGB 3OKFA 4ISBA 4HHEA 4O59O 5HJ2A 2WMNB 4LF6B 2E55A 2XTNA 1JT2A 5CJPA 4WPGA 1F20A 5TDHA 1NVBA 1BDBA 2Y4NA 4QLBA 3H4MA 4U8HA 2NU8B 4K0KB 1QWOA 4FOPA 4MRRA 1DZ3A 4I4LA 3O93A 2OWDA 2C5EA 4GW3A 3O94A 4F86A 4W5WA 3ABQB 1RKXA 4IUYA 4UHFA 3K1TA 3Q85A 4PRZA 5DX0A 4B80A 4BX2A 1V6AA 2YV3A 4DA8A 5ALIA 2XMPA 2QZPA 4ZEWA 4LXUA 1D6MA 4AWXA 1NLUA 3KKPA 5ALUA 4DY4A 5D3MA 4ZI7B 1KRXA 4KPUA 3AR8A 2DR2A 2V6MA 5SZJA 2PGOA 2GPJA 3BXEA 5AKXA 4AVYA 5TGZA 2PKCA 4RQAA 4QIHA 3OT5A 4G5QA 3PPIA 1E9BA 2BFNA 5ALPA 1ODFA 2I22A 4AO6A 1G18A 5FUXA 3SXUB 2VJCA 5DMHA 2F8SA 2DTEA 4D8XA 2VP3A 2GHRA 5IAEA 3TSZA 4GE0A 3CIFA 3ZXXA 1SXQA 2BSQA 2P9GA 1OQAA 1A50B 1TLFA 4NZZA 2BFDA 3HA2A 4EABA 3P2IA 2BR4A 5AVWA 2PG3A 1WF6A 2WILA 2IHUA 2ZRLA 3TN7A 2J32A 1YBVA 2EX1A 4K8RB 4WK6A 3T3MB 1NJFA 2WW8A 3JARA 4GWGA 1JZQA 2IXTA 4O3MA 1C3LA 1SA0A 4YBZA 1RTKA 1LWOA 2P9YA 1L7OA 4IL5A 3S7TA 3ZLTA 1BMFD 1NTRA 3UAVA 2E87A 3GROA 4Y2RA 4OSPA 3M34A 2P6NA 3K0CA 4FEAA 1T8WA 4EG7A 1YRWA 5EJMA 3JD3A 4B3HA 3Q0TA 1HWYA 4HZUB 4UQLA 3GJ6A 1D4FA 2H16A 1U6JA 3DUWA 1L4MA 1T4CA 3KTDA 3P2KA 3SM3A 3KQVA 4ZT6A 1Y3CE 2YZMA 5IK2A 3R9XB 4WK0B 1P1HA 3UOWA 3AI2A 1I7SB 4XPIA 1TA9A 1ZCAA 2QRQA 4LNUB 1L5WA 2V4MA 2GPWA 2IDJA 4NCNA 1Z28A 3E23A 3HGMA 3OE1A 5FI3A 4YCBA 4Q15A 1Z9BA 3GN1A 3MGKA 3ZCVA 1OX4A 1VIAA 1R0XA 4IDFA 3UGKA 1XTIA 3SHWA 4EK9A 4OQNA 2XZDA 4DIUA 4M36A 2Q3HA 5CFQA 1FPMA 3CXRA 1DRWA 3ZBQA 1JQ3A 2WG0A 3NDBB 4BO8A 1P45A 4CUJA 2CWWA 1AUPA 3HU5A 3F9IA 4CTJA 1P8AA 3ZE9A 1WKCA 1G2OA 1S4MA 3L01A 1JGTA 2EKDA 2QZ9A 1B00A 3B48A 1NAHA 3W2TA 3IUMA 2IX3A 1WZIA 4P4LA 3NOQA 3T7CA 5AQ1A 1QHIA 3WAGA 2XEDA 4A4DA 2H52A 3BXPA 1L6RA 4C07A 1BWRA 2QTBA 4U6NA 2JZOA 2UZIR 5ADUS 4RVCA 4UU1A 4UHCA 4KWCA 4XIYA 4EGSA 4QEKA 5DM1A 3KDPA 1COWA 2FZCA 4CM3A 3TD9A 4FINA 1ZNZA 2MSLA 5FLYA 3SS8A 5JJCA 1GQFA 3I1IA 2R6GA 4QAJA 5I9NA 1QYWA 1K86A 5BORA 2BONA 3BWBA 1WPQA 1JBQA 1YIDA 2BFPA 2PJZA 5T3UA 3WG9A 3O21A 4COOA 4LJ6A 2GASA 5YASA 2Z30A 1RCTE 1RC8A 1YTLA 1DHRA 2FN8A 3JRXA 3KALA 4BMXA 4MUIA 4LHVA 4DJEC 3Q8XB 1TM1E 3K0CC 4M21A 4WEQA 1PL0A 2I3DA 2Q1TA 3P0HA 3HFJA 2EJCA 5I9IA 3ICPA 1VMIA 3SQMA 4LTDA 2ZVDA 4LHEA 1ZWKA 1FTSA 2H2WA 3HQ4O 3QVXA 4N54A 4NNJA 4NS4A 2QX6A 3NTVA 5ALFA 5EKXA 4MB6A 3TG8A 1MJHA 4OOFA 2GXQA 5KOHB 4YXWD 2QTGA 2VXOA 3FVTA 1QC5B 1W85A 1XK7A 3LX5A 5EXEA 4YAGA 4I5GA 4B44A 1NW3A 4R1LA 2GFIA 1AC5A 1X86B 2FDRA 2ZI7A 4KP7A 4DTCA 3RUCA 2XXAB 2XB8A 1GLGA 4E13A 4Z1OA 1R88A 1PLLA 3GEPA 3DTVA 2R8EA 4GYKA 5A9TA 4OAQA 2CLKB 5FBZA 5ALNA 1JTVA 3FTQA 3GJ7A 4OCZA 4FEYA 4TXJA 2FW1A 1XQVA 3PGXA 3V9AA 5AKIA 1VKHA 2AD1A 1DKRA 1NM5A 1WPXA 2QRLA 2YWEA 1QOQB 2CVQA 1FLNA 2NTJA 2XYVA 3DT6A 3GRAA 3T7IA 4D9CA 3TZCA 3RS3A 1LB1B 1K89A 2P4UA 2C3YA 3V7UA 3R7BA 3MMPA 1NFRA 3QKRA 5C1OA 5LVAA 5M2QA 2PZKA 4E2FA 1ADBA 2J9XB 5EWMB 1S89A 3KOMA 4ZCLA 1V47A 5ALJA 4H1HA 2I4TA 5IULC 1ZSNA 1UXHA 3A0RB 3PFKA 3S68A 4DSAA 4M53A 2OFWA 4RD4A 1L8QA 2VP9A 1JHYA 4H4EA 3NPAA 5NLLA 2AJBA 3SDSA 1IQPA 2OLJA 1YB4A 1FW6A 1VPDA 1LWNA 1P4SA 1PV1A 1S1MA 1Z6TA 2EV9A 2BISA 1IXZA 3HVRA 1G98A 4ZGWA 2IS6A 4IG9A 3M4XA 2KW5A 3EIUA 3FCYA 3ZS8A 4JNKA 3DEZA 4F5YA 1JG2A 5KYUB 1DO8A 2R47A 2WD7B 3KFXA 3DFKA 4KRYA 1PZMA 1GL6A 1VB5A 4EGCB 5A02A 4IFBA 1H0SA 5TGDA 1PGPA 5TT1A 2I99A 4A91A 3E4CA 3AY7A 5DI3A 2G25A 3ZLVA 5ADVA 4IMPA 4TQAA 4ZZIA 3HACA 4KQWA 4I3GA 1HGXA 1HRDA 5F3RA 3GVCA 5HCUA 2Q8PA 2W42A 1B0ZA 4HRAA 2WOJA 1PDOA 2HLPA 3MTAA 1QFXA 4YI5A 1VSTA 3TCXB 1FW8A 3GRYA 3PGA1 2WSYB 3ANMA 3QFTA 2I66A 4OJMX 3QF4B 1SCUB 1Z15A 3K0EA 1JN0A 1XL1A 3V1LA 2JFZA 4QM6A 3CZQA 5KPDA 1SB9A 2O1SA 2XUZA 5I8WA 1N7GA 3ETCA 5A7HA 1YZ3A 2H0AA 2X0KA 4CMIB 3MJFA 5FL7A 1QCYA 3UMRA 1DVRA 3Q9SA 3DMTC 2PS1A 4J6EA 5FBLB 5A6SB 5CPBA 4ENUA 3VHXA 5K0JA 1KI6B 3FVWA 5LQSA 3MT0A 1G6Q1 3AW8A 3HZZA 1KPGA 2EDAA 3W5VA 1RQNA 1RE1A 3PGJA 2XOKD 2ZREA 1CY6A 3QLJA 1LPNA 3W6ZA 4ADSG 4KO4S 4I99A 3ZHSA 2BEKA 3D6HA 3WQBA 5LXTB 2Z95A 1NRXA 4C3UA 8GPBA 5BRJA 2GPYA 1FXWF 2IUYA 2JGMA 3RUIA 1Q74A 5E7QA 4M8SA 4ZT4A 4GSLA 1SCNE 1IZ9A 2ACKA 4R5MA 3VPSA 3D1LA 4IW3B 1NC3A 3DE2X 4L4YA 3BK2A 4FFLA 3AM3A 1VE3A 4XVQA 2XRYA 4MUXA 3U5TA 4W5NA 3UQZA 2LXNA 3WQSB 3IOEA 3LV8A 4FBLA 4DB2A 1HDYA 4IX1A 5AOCA 2BFFB 4K7JA 3FWPA 2QYSA 1OFHA 1OIVA 3HSYA 2DQSA 4OD0A 3T9FA 2I7XA 1RM0A 2VVTA 2WM2A 4BRWA 4C1BA 4C0JA 3P9CA 2JAWA 2RHCA 3P0EA 4HUQB 5B3AA 1RRKA 5EJAA 3H5AA 2PT5A 4BRUA 1Q50A 3HNOA 3Q3CA 1DKUA 4LDNA 3CUSA 2H08A 2RGDA 3ILYA 1IM5A 5FNZA 3W2HA 3E8MA 4C04A 1W36B 3UWOA 4XGKA 5BUZA 4KHZA 1FXWA 2GAIA 2XBLA 4CEHA 3EDRA 1NF3A 3VR4D 1F38A 2PBZA 3GELA 5ALHA 1OREA 3WWPA 3I5AA 3WICA 4FP9A 2GHTA 4PICA 1C3EA 3RSLA 1C7QA 2WWXA 3LP8A 4BU1A 1DL5A 2IF2A 2RKOA 4GX5A 4IH1A 5DHRA 4JGBA 2HMYB 4CKYA 3NX4A 5TF4A 4MRVA 4WFJA 1UDCA 4DIDA 2C7RA 1KQPA 2CSXA 4M0FA 3JASB 4GICA 5REQB 4X8LA 1G3QA 2PN1A 1U2TA 1DARA 2VNKA 3H0CA 4FBMA 4ENRA 3IKTA 2OM2A 4PNEA 4GMFA 2AC2A 3LWDA 1UDBA 5EKUA 4RPHA 3H42B 4DWWA 2I3BA 1TEVA 1ZK4A 2QD1A 3BAFA 4MP6A 1AS0A 2NXCA 2H1CA 2ZRAA 3PFIA 2C4WA 4E07A 9ABPA 4L08A 3GDFA 5E2BA 1J5PA 4QQ8A 4EG6A 1B6TA 4P80A 3SFVA 5C31A 4EI7A 3T9DA 2ECPA 3R4VA 4YP9A 4BO6A 1CQJA 3B60A 1ODJA 4NBRA 1E5TA 3I4FA 1AG9A 2HCTA 4I1RA 3R7LA 5AUOB 3C5EA 3H7IA 1JX6A 4UATA 4HQKA 1TEHA 2F43B 3GDHA 4LJKA 1SWVA 3I9LA 1RWMA 1P5FA 2DUWA 1L7AA 2NWQA 3G6WA 2Q5JA 3VR4H 5JSQA 4TMVA 4QBKA 1M2NA 2YZGA 1MOZA 4JI2B 4HCJA 2P4EA 2I1LA 2J5KA 4XX0A 5CNJA 3HP7A 2FFAA 2FP4A 2JHCA 5JXWA 1QP7A 1W4CA 5AJUA 2FJUA 5TJ9A 4BMYA 5JROA 1JXMA 2R7LA 2PS3A 4DCGA 2QEQA 3K9BA 3AI7A 4K9OA 3H65A 3O6VA 2V7GA 3T94A 3GP8A 2V96A 2NLOA 1NPDA 2G77B 4U7GA 1ENPA 5IVIA 2FSUA 2C4UA 3KTFA 1ACJA 1JE1A 3CW9A 3ZZTA 4YCMA 1G8KA 3D0RA 3O26A 2QBYA 1Z5UA 4JWKA 2ATCA 2IHTA 4NJEB 4DSNA 1Y9AA 3WAKA 2ZPUA 1XI2A 1TK3A 1JAIA 3PE6A 4LX8A 4QQRA 2IDKA 3L1UA 5IEJA 3E9EA 1J39A 4PFSA 2BBWA 4RSHA 1AKRA 5H5JA 4EJSC 1Z7BA 3DE6X 3HDVA 3RKRA 2QR5A 3A6KA 4BQSA 2ADFA 5AVXA 1V5FA 4XEHA 3IAM1 4F4UA 4YIHA 2ZQZA 5AHXA 1DG3A 1GCOA 1S7CA 1ZUNB 1DRUA 1XYGA 2Q5EA 3LQYA 4QTUB 2ZWPA 3R41A 3ZJ5A 1CY1A 4A0HA 5SZKB 5CM9C 1X13A 4XYLA 2YYSA 3L6RA 1FDVA 3PC8A 4UBMA 2G09A 2WJZB 3PUZA 3STTA 1SBIA 3AIMA 2J59A 4P3XA 1DE0A 1RS0A 3T1VA 4OQ4A 2Z2YA 3ADPA 2AZDA 1J23A 2J4CA 2YOGA 4GMHA 2GN9A 4HXGA 2GDJA 4NCIA 1NNSA 5FFMA 3T3GA 4NYIQ 4YV0A 1TA0A 2V9CA 3KSMA 3T54A 2IV7A 3P9ZA 1ZK3A 4X45A 2WTEA 3OPQA 3FY4A 3N70A 4GP6A 3AR9A 4I4TA 2OGSA 2QN3A 2WTBA 1E2MA 1JBKA 1GGJA 4YP1A 4QWWA 2R1ZA 3LY8A 1ZGGA 1U7XA 4PYIA 2VP6A 3HDTA 1FTQA 2EFEB 2GO7A 1QGED 2WKWA 4I2NA 3U61B 1M1YE 3D6UA 3DO6A 4HB0A 1NY5A 1XNHA 2HQSA 4U3JB 5IAAA 1X80A 1Y6QA 4LZOA 2J3QA 1YVEI 2HSGA 1UFKA 2IEBA 1Z5WA 1HZJA 2JAOA 3IAFA 3K0AB 3KEFA 1BA2A 1A7UA 1FUEA 1L3CA 1RJ9B 3EIOA 4YQEA 3ZNNA 3NM4A 1O87A 1QRAA 2IQIA 2QTMA 4BUCA 3MRTA 3OE7A 4AJLA 4C6TB 1WY7A 2PZEA 3NM5A 1PSWA 2ONJA 3JQPA 4Z8YA 1SU7A 1JLLB 1EM6A 2AZTA 3RM3A 4JHLA 3EARA 4BO0A 1XZFA 2GM3A 3FKQA 1ZA2A 5JS7A 4ZDKA 4ESOA 4GF5A 1Z6YA 2WJ6A 1SQ6A 3U4QA 4RMIA 1NXWA 4J7CA 4CEIA 1ZIOA 2AWOA 2HCRA 3JWGA 3KTAA 3P97A 4YRRA 5FL3A 5KVVA 3VNVA 2QSUA 4ASUD 1KQOA 1GRQA 3TUZC 2O8EB 1KE2A 5DHSA 1F9EA 2Q5QA 3AILA 5DHQA 3NAQA 1C7EA 2JIRA 3BA1A 5FBQB 1FDIA 1EFCA 3UAYA 3W79A 3DOFA 4CCYB 5HWSA 2ZZMA 4B3RB 4B73A 1FS4A 2OXIA 3PKZA 2V7BA 4OHOA 3EFOA 2DR3A 4KIFA 3QLTA 4MYDA 5BSHA 3KETA 3K70B 3WOHA 5DK4A 4OI0A 2R6JA 4F9EA 3EDOA 1NE7A 1C8VB 4X84A 2WJHA 4EL0A 5FR1A 3THYB 4XZ3A 3GRKA 4UMVA 4HNQA 1IPHA 3Q7SA 3G89A 2NSJA 4ZU3A 5AXDA 2G70A 4HVAA 3T12A 3BVPA 4DHWA 1OKKD 3UGTA 4AKTA 3PNBA 2IY7A 4DBZA 1XMQB 1B6SA 1SUFA 2R97A 1RXCA 2Q4BA 5AVOA 5CXUA 3OC0A 3RC7A 2MJLA 3R5SA 3OCUA 1O0CA 4A0SA 3DAHA 1IG0A 3N2YA 1KDZA 1QRUA 3UJ7A 3JZMA 1I2ZA 4RPKA 2D2FA 4WFIA 4XFKA 1PKEA 1QVVA 4D9GA 1GSAA 3TLXA 2PX4A 1WV0A 1CZLA 1SXJD 3MMNA 3I28A 2R48A 4HEJA 2I5PO 4YRDA 1PU2A 1Z0FA 2G3YA 3IV9A 5AJVB 2AYXA 1JNYA 1C9DB 1B76A 1NR5A 3CN9A 4GLBA 2X4IA 3HKDA 5K8CA 2XCSB 1ZHHA 3SDBA 4LRXA 4X44A 2CLFB 4KFUA 2K6GA 3AFGA 3OJWA 3H8VA 4KIUA 2QAJA 1V71A 3DULA 1HSZA 1OVMA 4A7PA 2PLWA 4RETA 3OJOA 3DOEA 1GITA 1MO6A 2ZJ4A 1AGXA 1VLMA 1YJCA 4I55B 4LY9A 4URVR 1P0FA 3VR2A 3NCHA 3WLTA 4E33A 3IXLA 2I3GA 1KAMA 2WFLA 4FFMA 4NL4H 4BZWA 3RQIA 8LDHA 2E48A 2DHQA 2XXAA 1FZQA 2PS9A 5DYIA 4NEQA 1E2UA 2G17A 4DREA 4C4PA 2YWHA 3D8SA 4KQKA 3NANA 1KDOA 4XGQA 2NO0A 2OILA 4H7FA 1YNOA 1ZUIA 2WMYA 3JAWB 4IICA 1P9RA 1PHRA 4LC0A 1SFRA 3U60B 1GN9A 1BHO1 4NECA 2G9VA 2KYRA 2R6DA 4JBIA 4WZBB 3BJZA 3SYLA 1TA4A 4J1TA 1P2SA 1NVGA 4NOJA 1YL5A 3JX9A 3EBLA 1N5MA 3YASA 5KBYA 4MTLA 5GV7A 2I55A 1F8UA 1N5RA 2AFIB 2QL7A 3AP3A 1PUJA 1MAWA 4MPRA 5K0CA 1SHTX 3KKEA 2I8CA 1IUOA 4YFYA 1C7ZA 1IDOA 4MVJD 2QRUA 4W1QA 1C1DB 3PNKA 3AEYA 4B85A 2FF7A 4MAAA 4EB6A 4KR0A 1NI4A 1MTOA 1SC3A 2OCKA 1D3AA 3AEXA 3GFGA 3K1AB 5F64A 2H29A 3T7KA 4CMGA 4EHLA 1H93A 1TQ6A 2GN0A 1PNQA 7MHTA 2BC9A 3THYA 1J8MF 3NTUA 3DCIA 2RIRA 4UNQA 5EE0A 2Y0DA 1CJBA 3TNLA 3WNDA 2IK8A 4UZSA 3ZVMA 3VSEA 2VNJA 4A0GA 1XZQA 1OI3A 2AWNA 2WIJA 5DB4A 3SSNA 1A1VA 3AEKB 4Y9DA 1S3GA 3QE0A 4LVUA 3FTCA 2AR0A 5JFOA 2YN2A 2B0JA 4EMTA 5EMMA 1K08A 1HR0B 1KA9H 2XCLA 5KDLA 3ZU2A 2QIPA 3GG9A 2WHXA 2XSZA 2FQQA 2FUG1 2DWUA 1PFGA 1BGXT 4KWEA 3IHWA 3Q7EA 2HXSA 1QS0A 4QTXA 4K40A 1H85A 3OICA 4KXLA 4R1NA 1P1FA 4G6ZA 1XEFA 2O0LA 3FGOA 1U8YA 3KV1A 2UYOA 1H0HA 1GRVA 4WOKA 3SZ3A 2I6TA 4H16A 4JR0A 4C89A 3HWSA 1XEWX 2EFGA 2J3EA 2FW6A 2W6ID 5LYJA 4EYQA 4TMWA 4IIUA 4C6TA 4OKNA 4N3BA 2ZDQA 4EJ0A 1V8OA 3OBIA 2TS1A 2JJMA 2M6SA 1ZR4A 2RB5A 1I33A 2EBHX 4JEMA 4MEBA 4RZSA 5BR4A 2XYPA 4MINA 1SZPA 2O6LA 4RFSB 1FNCA 3LU1A 5DTEA 3STHA 2RC6A 5HKAA 2QJOA 3QSYA 1RZUA 3P0FA 1GARA 3JARB 4KO1S 2ACVA 4U3JA 3HADA 5DBOA 4F85A 3ZQ4A 4GR9A 2ZYHA 3ZXIA 2R4UA 4LE0A 1GG5A 2WP8J 3SYNA 3AOGA 2NVOA 1EE9A 5AR1A 1HKHA 3SE0A 5EE9A 4PAOA 3VOAA 5CM2Z 1UOOA 4KBGA 5BT9A 2C97A 2NV2B 4FFOA 3SXUA 1DAIA 2AFHA 4KNWA 4KREA 2YDXA 1B2RA 2VUHB 3A4VA 3DZDA 3LF1A 4LW8A 2IHZA 3DA8A 3DDOA 1U1DA 3G5UA 2BLLA 2W90A 3KHKA 4IXNA 2N75A 2YZNA 4DJTA 3O38A 4U1RA 1X8XA 4NWIA 4BEJA 3ML1A 3R7WA 4Q12A 1KK3A 4PLWA 5DEIA 4N3GA 5THQA 3BJIC 2IHVA 2PD6A 3ENVA 3WHKA 1G3UA 2HEGA 3C3WA 3OIYA 4KE6A 2UUPA 3AU9A 1AY0A 3K6RA 1VIYA 1RQXA 2ZVJA 3A1FA 4G97A 4YRSA 1GNLA 4LRYA 3ICQB 1L4GA 4P58A 2CLEB 4LFBB 4YXFA 1P9NA 5FOWA 1L9KA 4TLDA 3T99A 4TT3D 2X4GA 4GC5A 1AGPA 4WVLA 2EWMA 2P5YA 1TAQA 4DMCA 4YCSA 1CUSA 1F0PA 4QARA 1JBEA 1DAMA 1P7YA 2E1RA 4WRRA 1D9XA 2AKYA 1ISHA 4FTWA 3DSRA 3FDJA 2J3HA 4GBED 4PPYA 1LK5A 4FE3A 5HTKA 2CNWD 4FX5A 1K9SA 2CJWA 1Q5PA 1L4FA 2FUEA 3ENQA 4JU8A 2QP4A 2GGSA 5BQFA 4L57A 2ANBA 4IQFA 2CXTA 4HNSA 2WU3A 3B3QA 2CBGA 3CH5A 3EA0A 2I6QA 4KXFB 5C8ZA 2I91A 4CIDA 5AOBA 2VYVA 5LDGA 1CK4A 5SZHB 2G06A 6LDHA 1N2JA 4KL8S 2GEUA 2HY7A 1J5XA 3JZFA 4QBHA 5B7GA 2HIGA 3L7OA 3CF0A 1E66A 3QBDA 4YO8A 4RD1A 4XYBA 3GD5A 4QU8A 2PYZA 1RI2A 3PQDA 1SOVA 4HLUC 1C41A 3SOZA 3H17A 3O8DA 1J21A 2ZYSA 1YI0A 3W5CA 2GPTA 3AM4A 4TZ0A 4C4RA 3MTQA 3A10A 2WJ3A 2XOEA 3TR6A 2OHXA 1JEEA 1GPUA 4UFPA 1PJAA 5BSVA 2OV2A 2EZUA 3HKCB 2NYVA 4RH1A 5CYOA 4DNOA 1PJ3A 5HM6A 5LWQA 2B4KA 5KPJA 1VP3A 1XTQA 2O07A 2QJFA 3TLKA 2F43A 4PLGA 2UU9B 3B52X 3O03A 3WS7A 5EE1A 2YHIA 4YUWA 2O14A 4A1FA 4I2VA 2CHUA 3DGFC 3IEPA 3TSCA 3T4XA 3SF8A 3B6ZA 3L7KA 5EN4A 4Y2UA 1TMKA 1L5VA 4I9GA 4KIGA 4ZCMA 4INZA 4KXNA 1Z18A 5CNKA 4YUVA 3JXEA 3GI1A 1VLLA 2ATEA 2RGRA 1CY7A 3HSKA 4GNKA 2ECKA 2YVQA 4GX2A 3GCWA 3H18A 4PLHA 4XUDA 5HIMA 2FPIB 5T5QA 5KC9A 1MC5A 4EFDA 5TIIA 2YKGA 1KIMA 1HRKA 3LDUA 1Y3DE 2RK4A 3KJQA 3WYEA 2GEDA 1L5YA 3L1JA 4JBGA 3FLBA 4GI3A 1RDFA 4L0DA 1BCRB 3E58A 4CWAA 4ENPA 2NUBA 2M9MA 5CNIA 3S2EA 1NVDA 3VZSA 2NZWA 5H9WA 2RJOA 2WWHA 5IVKA 4G4GA 4AP5A 2AF4C 1P81A 3BXFA 1Z7EA 3QTBA 4TL8A 4XB6B 3ICEA 4G0XA 3DFZA 3C45A 4MYHA 2BT4A 2NACA 2WU4A 1E3QA 4RHEA 5AVUA 1LVUA 3TWOA 4C0HA 2IDZA 4TMXA 5FJJA 3H9GA 3KZXA 1XZBA 3QBVA 1J0CA 3HP1A 3IPAA 3CJRA 1P6QA 1RJDA 4P3PA 4NF2A 1VL8A 1QTQA 1DXYA 3I39X 4LWZA 3V34A 4ARSA 4BLWA 2XDWA 1I4EB 4TKZA 2G04A 3TZQA 3UJ3X 3OOSA 1PR3A 4ZU1X 1YC5A 4RCYA 3ZZMA 4J0KA 4DDWA 5CA1A 5L3VA 2B99A 4TL9A 5J5CA 4KDEA 4ID3A 4TZKA 3VR5D 3W5HA 1VG8A 2QN2A 3F5SA 4UZFA 1DX9A 4BTEA 4CI0B 1Z2EA 4PYOA 4X91A 2X6RA 1FIUA 1VKZA 4EFMA 4MRSA 3BG5A 5FFFA 4A8JA 2Y77A 1RMTA 1JJIA 3C24A 4OXYA 4UVHA 4WADA 2YYAA 4Z6KA 1LI5A 3MG9A 1N4DA 3TRKA 2IIBA 1O1YA 9GPBA 2WK1A 2HA5A 3DWGA 3HC7A 1CZHA 5ALGA 4Y18A 5EQJB 4E14A 2CFTA 2E4ZA 2O2YA 4Y1FA 2OCLA 2HYDA 1EP2B 3IXMA 3QEMA 4QAQA 4W5HA 5LOVA 2VSYA 2QVLA 4G65A 1WMDA 3TGPA 2ORWA 2QTNA 1DC3A 4V0MA 1CQIA 3L8HA 5CJ2A 2YMPA 1CQPA 5BSWA 2VHVA 4MJLA 3VKHA 3GLHA 4F8EA 4PHTA 2B4TO 1OTHA 3NWBA 4HAOA 4XJVA 4JP8A 4FYKA 1FNNA 1PBTA 2JEYA 2Y05A 1R0LA 2E3JA 3JAMA 3W7AA 2ZM6B 1UOQA 2ZRIA 1KI6A 2XMZA 1CR6A 1YGYA 5A6SA 1SQ0A 5HIJA 4DOMA 3DZIA 1DLJA 5FNVF 3FNIA 1GRNA 2P67A 3VTZA 3THWB 2YHUA 4WCFA 2C8JA 1WVGA 4XARA 2H59A 5DASA 2WV9A 1DTWB 2E49A 4X8MA 4Q9JA 3GEEA 2H1WA 1RT9A 2CLCX 2VBCA 4EY6A 5EQDA 4V2IA 5E9JA 4BNKA 4G1BA 4TT3A 3TAUA 3ANSA 4FSDA 4XWOA 5LQDA 4QDJA 1JHAA 5JOQA 2JLVA 2IX9A 3BB3A 4DDTA 3WOVA 4EARA 721PA 4GL2A 5HF6A 4DCUA 3GJXC 2IC5A 1P31A 3DFUA 3DPIA 2VS1A 4KC0A 1SCDA 5EHNA 5LBTA 2C29D 4M0MA 3BN3A 3ZH9B 5IP5A 1W8DA 4BUZA 4XDHA 1EDBA 2IS4A 3PGKA 4S2UA 3O3MB 4IF6A 1UBEA 5AKGA 4AYXA 1PG0A 3H99A 1MVOA 1YI1A 1EXVA 4QOSA 2IFTA 4QNMA 4HY3A 1NBME 1EWYA 3AVPA 1AZTA 1U5AA 2PKQP 1CJMA 3E3AA 3HU2A 4HVTA 4NMWA 1Q0UA 5ESXA 2OB1A 3S40A 2ZANA 3ZHQA 4GIBA 1XRRA 4J76A 1RWWA 1EGHA 3X1JA 3IMEA 1JFSA 1JTEA 4IIDA 1X14A 4J1TC 3P5SA 3M9XA 4O33A 3VDRA 1X7YA 5JYBA 1LLUA 3I3SR 3E3NA 4I5IA 3RVQA 2JFOA 2J7PD 2XNKA 3K6SB 1TJ5A 3G88A 2ZB4A 4URHA 2CDBA 1ZSVA 2GEVA 2LRHA 3OZCA 5JNRA 1YHNA 3OLWA 2QE7A 1YA6A 5KI6A 2J45A 4HVLA 1O96A 1XU9A 1HG1A 1DRVA 2VYFA 3PX3A 2AA3A 1TEXA 1G7CA 5KTMA 1DKMA 2XTAA 3ICVA 5CXSA 4PNHA 3KT8A 1NF8A 2QAIA 1NQUA 5ARDA 5AVSA 4D5EA 3NGXA 4MW4A 5LDDC 3JALA 1Z8HA 2Q4TA 1RM5A 3BORA 2DCMA 1TVCA 2AOXA 3PDCA 4GPBA 2IOYA 3VC7A 4MVJA 4JVLA 4B83A 1APBA 621PA 1KOFA 4K6MA 2HZBA 1EG2A 1MAAA 5G0TA 1U1FA 1L5GB 2HPAA 1FK8A 4YCAA 5TMDA 3WK5A 2XXJA 3DTVB 1XRQA 2YXPX 3UF0A 2OKCA 3AY6A 2AUNA 3D4LA 1C0KA 1CB0A 1Z82A 2I78A 4QTTB 4YA6A 3ZW9A 4BJ3A 2X0FA 3QVLA 1C29B 2F3SA 2WM3A 1SD1A 1ORIA 4C4XA 1KMQA 1ODCA 2G63A 2PQ2A 4F6CA 1Z5PA 5BPHA 1WAMA 1BNCA 2YIMA 2OZKA 1DIBA 2FCAA 4QXMA 3QTTA 5F7XA 3N0VA 5IHXA 4MW0A 3FCEA 1CJTC 1DC5A 3KLMX 3W6PA 3VOTA 6AT1A 3F74A 1VGVA 1V9LA 2B9EA 2ZSAA 4P7GA 2QENA 4G26A 2JCBA 2NOAA 3L06A 4XB1A 2Q0QA 2WHEA 4ACBA 1Y42X 2R8BA 3A8TA 4DKJA 2RGXA 3E7WA 4IDAA 1KKLA 3A4YA 2NMVA 2P7IA 1OB5A 3SGLA 5KU1A 3MFQA 4X8HA 2I33A 2Q2NA 1H2XA 2W83A 3MERA 4Q7KA 4U7FA 2HYIC 1PVOA 2EL9A 1L5FA 1BS9A 2C00A 5H82A 3PNYA 1XZNA 2IYOA 4B3CA 2YS6A 5CB4F 5JXJA 1QPZA 4TXHA 1PBNA 1IY2A 5TX7A 2QTVB 2PGXA 2DQKA 1QE0A 1NAIA 1S2NA 2MSEB 1EFRD 2HLHA 2MINB 2PZLA 3LSYA 4E46A 4RKWA 3M9WA 4UNSA 6CHYA 2PWZA 2PFGA 5IT9A 4FQ7A 4EEXA 3HB7A 2XD4A 4XVUA 1H1DA 1D09A 1X8JA 2WSLA 3NKLA 4HS9A 4QD3A 1KSGA 3IELA 3W7VA 1NVAA 2VWHA 2WAOA 2AG0A 4CKXA 5FWNA 3F0TA 3HYSA 5JU6A 4GMXA 3TK1A 1I4TD 3GD7A 5FPYA 4GVXA 4XCQA 2XQVA 4OI1A 4HRXA 2IYEA 3DYBA 2A9FA 3LY5A 3W9UA 2D3WA 3U4GA 3U4CA 1T3LA 2C7GA 1WF3A 2ZW9A 3FI9A 2VRCD 3M5DA 3R3YA 2B1RA 3QYAA 4OB8A 4WZAB 1DPGA 5CB0A 3OWOA 1A5BB 2QPLA 1NN5A 1B43A 4RKYA 4U9UA 2ASEA 3TVDA 1ORRA 1DADA 3WNCA 4B76A 1PIWA 3KYCB 1XMXA 2H5JA 1ZDMA 4XTCS 4EF5A 1KEWA 3FYDA 4KV7A 4YJKA 5LU8A 1QU2A 1ENOA 5CDTA 1NZJA 3TNFA 3D4PA 3VXKA 1E69A 4HDCA 3L82B 3RF6A 4F5EA 2RAVA 1K1EA 1V9SA 2F9MA 3KJGA 2B30A 4RPGA 4X1IB 4KTTE 1T8RA 3DMPA 3TS1A 4KJZA 5IMSA 4AQDA 2A0XA 3LX6A 4HWGA 1AQJA 2QNRA 3A9CA 3DMNA 3GBVA 4CMBA 4MO9A 4RORA 3DXZA 3KSAC 2CYAA 2ZS8A 5JCOC 3SJCA 1S2DA 3OCCA 1P0CA 4JC4A 5M29A 4Y9UA 2NUPA 4KCGA 4ASUA 1V1MA 2RBGA 2ZYAA 1LDYA 1QHYA 3TQIA 1IEWA 3HYNA 1N0IA 4P32A 3AC0A 3HUUA 4BQRA 4M7OA 1DQRA 3D7MA 3FUUA 3ZVNA 4WASA 1A9TA 1RIIA 2PUGA 2A5DA 2B6NA 1CUCA 1P5JA 3FTPA 5D7NA 1XZPA 1ISMA 3DB2A 4G5GA 1B7GO 2I6SA 4K3VA 4BLUA 1CR1A 1YMUA 2FW9A 2VHWA 3B1XA 3ZD6A 4OMDA 3MJSA 2DHDA 3IKJA 1F48A 2ACWA 4C0AC 3OE7D 4ZOAA 1SCBA 3MB5A 4LCJA 3DDNA 3LNCA 1BN6A 4W8HA 3ROMA 3ZZUA 3ZUPA 5IF3A 5KQLA 2BZ0A 3K8ZA 2VLBA 1LDNA 2XNCA 2B94A 1XVAA 4AF7A 1CB7A 2P40A 2DB3A 5EIFA 2NTVA 2Z2XA 3HHEA 4J75A 2QJTA 1Q1GA 3BMCB 1PNVA 4EJSA 4UXHA 5WRFA 4AJNA 1AK2A 3L93A 4Y0VA 2Z9CA 3DBHB 1IY1A 4BZPA 1D03A 1QPGA 3HCAA 1LX6A 5D3ZA 4XWGA 2R0QC 5K8LA 2Y1CA 1PE0A 3JYNA 4RC9A 1JJFA 1G4UR 1H22A 1OH8A 5G4KA 3SYKA 4ETIA 1ZZEA 4E0BA 2PO7A 2HWKA 2VN8A 1GPH1 2WF8A 2O2SA 1ZGHA 2OXRA 3GQVA 3RVDA 1G21E 5KQGA 4LVNA 3TMKA 3A1SA 1THMA 1W75A 1FNMA 4QX6A 4JI7B 2G1AA 3DBLA 1SUDA 1XNJA 2BL4A 4PGGA 4LDRA 1TM4E 5EY5B 4RTRA 1H2WA 2G9QA 2MHCA 5AHWA 3UT5A 3WLNA 5AK0A 4F60A 3MGAA 4F2WA 1XYYA 1TYZA 3RIYA 3WC4A 1KIAA 2R2GA 2WJJA 3WRYC 1ANKA 2HD4A 2W48A 1NT2A 4RV9A 4HZIA 1LF5A 3DD1A 2XYQA 3GRVA 1SUPA 1K06A 2OE2A 3J7AC 3M6VA 4TS1A 1V7PC 5GINE 4BNTA 4C9BA 2DX7A 2J85A 3G3EA 4WERA 5GOTA 5KTRA 1LK0A 2A7XA 3OX2A 4QEZA 5PNTA 2OLEA 2B2CA 4Q1CA 2W70A 1GQOA 3ROFA 2CNLA 3KC2A 4EZBA 5IKMA 5C3UA 3CVWA 2NZXA 1Y5LA 1UPTA 2VDJA 3F6YA 3IT1A 1PD0A 4IWXA 3KYDB 2GSWA 3KD2A 3RYCB 1BXRB 2ISSD 4B4DA 3ANXA 2W71A 2J31A 1C30B 1RZ3A 1AMUA 1FB5A 1SM4A 2I80A 5C8YF 2PK3A 2XA2A 3DF7A 2QG6A 1Y37A 1QYCA 4FDAA 4O02B 3EZ6A 3KR2A 4OP1A 5K99A 1M10A 1PEDA 1DDGA 5PGMA 2V9PA 4F9GA 1VFPA 4KITB 1SPXA 2Y1FA 1EUCA 2Z1DA 5BN4B 4P93A 3K0SA 3GV0A 3R7SA 3UHJA 3CVJA 4HXYA 4CLXA 5BYJA 3GAMA 4Q9NA 2GZ2A 3HUEA 3OD5A 5KKAA 2KPOA 3A0UA 3V1TC 5CFMA 5EJ4A 1O2DA 3BRWD 4YLGA 3HMQA 1X7WB 5ITSA 1Z38A 1XO1A 4J1SA 1BA3A 1Z83A 4IS3A 1KI3A 4KEAA 4MB0A 2RDMA 3OOYA 3NUGA 1QH9A 2ATIA 4Y0NA 5AW5A 5LUBA 3R6LA 4WKGA 4X1YA 2P9TA 4C4TA 2J6HA 2II6A 2J3LA 4NK5A 2E18A 4HQRA 2BKVA 5J2UA 2QL9A 1MOQA 4MV8A 2XUPA 4S0XA 4YXWA 4IHQA 1IHOA 3L02A 4LZZA 3WDLA 3LXUX 1SKBA 821PA 1E98A 1GZ7A 5DTJA 3RAPR 2HDHA 1E9RA 4TQGA 4Q7MB 2QVYX 3LX4A 4DQKA 4QFDA 3W6OA 1GNQA 1KZ6A 1PQUA 2WYHA 4JNCA 4BCBA 1I7DA 2HA2A 2A57A 2ZE5A 3VZCA 4ZK6A 3RQSA 2JC3A 1LH0A 2WUGA 3IVAA 5KYXB 1P4GA 3EX7C 1YBAA 2CVHA 4GKVA 4HUTA 1N92A 1JR3E 3B9BA 5IZ4A 3L4SO 4MXDA 1MG0A 3IC5A 3PD0A 2K4MA 1XB2A 1XSEA 2VF8A 2NTNA 2R8XA 2ZRQA 3GJTA 1CF2O 2JLBA 1LQ2A 3D2BA 4IDNA 5EZYF 3JQGA 3DT8A 5AIAA 3DR5A 2E5FA 3KZKA 1J24A 4E32A 2V7TA 4LDAA 4ITVA 3EZNA 3PD1A 3PUWA 3NH6A 1JIVA 1W30A 4BE7B 2AKEA 3WLLA 1KRWA 1VLQA 2WM8A 1JKJB 1GKKA 3PHJA 2FSIA 4I1IA 4UTXA 1LDEA 3EVEA 1R8XA 5TMEA 1B26A 4B43A 1OF1A 4J29A 5LMZA 3DXFA 3E3LA 1PQPA 3BMQA 3O31A 3DQZA 4M8NE 2MTBA 3EF1A 3NDRA 3USES 1WB4A 3S0JA 1BW9B 4XYMA 2Q5CA 5EZQA 3R6TA 5I45A 1WXHA 2AFRA 4A5SA 3M81A 4GXTA 2QVGA 3DD5A 4KH1A 4NZNA 4PLPA 3RU3A 3TDMA 2GJAA 3PU6A 2OO7A 4PLVA 3WTBA 4CMEA 4DLNA 4WXYB 3IHKA 3GLFB 3DLBA 2GLUA 4WESB 1RABA 2FY8A 4FOTA 4AZ3A 1UWLA 4KBFA 5D7BA 2AK2A 4NU6A 2PUEA 1RCUA 1Z0KA 4JUBA 3DMFA 1UBCA 2VJPA 3EOAI 4Y9TA 8ABPA 4DLAA 1PZHA 2BR3A 4Y6PA 3CKKA 5LKRA 1JECA 1TQ2A 1T0HB 3ESDA 3OT1A 2BDEA 1ZBQA 4F3RA 5JJ5A 2KSQA 3CNLA 1ZXLA 1TTTA 2RK3A 3FOWA 3QE2A 4ZZ0A 3WO0A 1R5OA 1KGSA 2ZBEA 2XTMA 1LSJA 3AP1A 3BCRA 3JQAB 5C8YB 5ALZA 3KSBC 1Z47A 4QO8A 2Z83A 1XPJA 4MHSA 4NYMQ 3ACBA 2OHVA 3SQOA 3TZHA 5BNFA 5CDHA 2FOXA 1PTJC 3P2YA 1NNEA 7ADHA 2R2AA 2ZJ1A 3DBHA 1DC6A 3HB5X 3WGLA 4DQ0A 1P1CA 2Q0XA 3TLJA 4DV0B 1KC3A 3FPBA 1JZTA 1U3DA 2R1TB 2ZI4A 5AI5A 4L9RA 4EY4A 1KH1A 3LVRE 3OEWA 3ZLBA 1FS5A 2D0DA 3VPAA 1FFWA 4R8SA 4H60A 4CKEB 3GLGE 3A1WA 3I61A 1E2KA 1FMCA 2NV0A 2PWPA 4MGZR 4X94A 4EF6A 4MW9A 2WG1A 5FBVB 4QUEA 4DUZB 3OZAA 4FYIA 4J4HA 4EI9A 1VA4A 1WG8A 2AQKA 1R5JA 1GPYA 2GAOA 2G0NA 2GNOA 3F7TA 3F1LA 3H05A 3HDGA 5EFOA 1NYRA 1CNMA 1XTTA 3U7EB 4IIFA 5CGZA 3MD9A 1LVGA 4IUBS 5JSFA 1BJRE 2G5TA 3FHTA 1BRMA 4C2TA 2GM5A 4WN9A 2R87A 3OQPA 3PJFA 2NUTA 2IZ6A 2IWHA 4OHMA 4L07A 2C5FA 4TSRA 1ECGA 4LBYA 2C7VA 3Q3VA 3BBLA 3V2GA 3WWCA 1WZ2A 4CG0A 3L7DA 2P3QA 2D74A 4NH4A 2XGOA 4KMMA 5HJEA 2XA1A 3IIEA 4BVBA 1K8XB 1NLZA 4UM5A 1SN7A 3RRBA 3UUGA 4LHXA 1NYQA 2W2LA 2D2IA 4AN0A 5KINB 4MA0A 3HP4A 2BTQA 3ZZ0A 4KE7A 3B6MA 4MITA 1U94A 2ZJYA 1MCZA 4A2WA 1PT6A 3RROA 3QX3A 2IP2A 2VUSA 2J0UB 1PQWA 4L8WB 4LFAB 3OMWA 4YPVA 4L8GA 1IZ8A 4M49A 4ZQGA 2H3HA 1UBLS 1I4LD 4BVEA 4M83A 3RYTC 4FYVA 2PNFA 5F76A 2ZI9A 3KYCA 4BRZA 5BR1A 2C9YA 4V0ME 3C15C 1DWPA 5J5VA 2CL7X 3AF3A 2YWGA 2PUAA 3D7RA 4AJ4A 4K6FA 1TDJA 1EP9A 5DNWA 3U6BA 4JU9A 3VR3A 4XCVA 2WF9A 3GH3A 1M9NA 2O19A 2OV1A 3ITKA 4IGIA 2V3VA 2B8NA 3H0KA 4JQCA 3VJLA 1BN7A 3ZWKA 3LFHA 5FUYA 4PO3X 1MB2A 3HYCA 3SHOA 4BNUA 5FEUA 1P1KA 3JQDA 4XM0A 4XQGA 1HDZA 1MO2A 2CXHA 2HH9A 4DILA 7MDHA 2CDNA 3VR5H 1JFVA 3GNTA 2HMWA 3JTMA 4RIIA 1MRZA 2MOKA 3B89A 4HXEB 2WT4A 1KJNA 3JYOA 3BF7A 1AU9A 2QT0A 4RZXA 2UVQA 3NPMA 2QGZA 3D8TA 2QN6A 1GZVA 2QTVA 1A8QA 3OH8A 3WB2A 1VPEA 3VVBA 1DFGA 1DBSA 1ULZA 3HVJA 1N3BA 1RKQA 3BF8A 4A8PA 3CZ9A 2UVDA 3RBZA 3EMDA 1NQ5A 2F3TA 3U3OA 1FLAA 1JVSA 2G9ZA 4Q82A 4RMNA 3VV2A 5AHRA 3UOGA 3VC2A 3WIBA 3UJDA 2Y4OA 4BLPA 2GYYA 4CT5A 3LO8A 2MR5A 2VDMB 2EBFX 1B73A 3HR4A 3SC3A 1E6MA 3OC6A 2JLAA 4HAVA 2VKQA 4RJKA 2CCJA 3QPBA 4Q1AA 4IDPA 3AWIA 4U7DA 1XMPA 1Z4LA 2PZFA 1RHJA 4KQGA 1P2TA 2IGTA 3ADKA 5KSOA 3O8OB 2ID8A 4QOGA 2D8MA 4YAOA 2VYNA 4KYVA 2OFFA 1UJMA 4E31A 1X1CA 2FZLA 4P53A 5JLAA 4I4CA 1EVKA 1OXXK 2Q4RA 5KX5F 4R54A 5FADA 3WGTA 3F5MA 4QPZA 1RLMA 1IQ0A 2HA7A 3K92A 3L40A 2W7TA 3I34X 3PUKA 1N9ZA 4JJEA 2LP4Y 1MT0A 3A1EA 3A6HA 3UMFA 1RHKA 4P8RA 3GEHA 1M2OB 4O0LA 2R85A 3F6SA 4XUEA 4PYNA 4B45A 5LQMA 1EEXB 1UJ6A 1GG8A 1XELA 1VRWA 4H1TA 3COWA 4WBXC 5DGXA 3L7NA 1KXJA 1N32B 1PX2A 2ZJ3A 3HCBA 2R44A 4M9SA 4ZVKA 4P92A 1D2MA 4O2AF 3EC7A 4IOKA 4JUIA 5E2AA 2ZYWX 3AZOA 2ZJFA 5U1PA 1JDUA 1PAUA 3FUCA 3AJAA 4O4IF 5IPFA 2FUKA 3H11B 4CGZA 4F6RA 1FFSA 1LSUA 5CVDA 3AF2A 4RTKA 1MENA 1RAAA 1IHUA 2NZYA 1KYIA 2XMGA 3DJFA 4I6JA 1Q3TA 1M1NB 1YWGO 3ELDA 3PX2A 3PITA 4KBYA 4LA4A 4UJ3A 4ABYA 2DYKA 4LDQA 4L8VA 2P8SA 4JH0A 4MOWA 1P7PA 4ECEA 4CMKA 4Z5XA 1A9YA 1M3SA 2L17A 1C1XA 1X7ZA 1VMEA 2LW7A 2PD3A 3ON5A 1Z5OA 4BMPB 4F4IA 3RU2A 3ROTA 1KQGA 4Z9YA 5B58C 3MW8A 3KZOA 3PT5A 1G8PA 3QNUA 4IDGA 3GCDA 3ER9A 2JLCA 2AOVA 2H57A 1E8DA 2VSNA 1ZXBA 4ZA2A 5A4IS 1E7SA 2G1UA 2H2DA 3DDHA 3OJ0A 1A3CA 1E4YA 3N28A 3AUFA 1USWA 2NX2A 4ZT2A 3FKSD 4V24A 2G72A 4FDMA 1RJWA 3MCWA 2FZ5A 2QT9A 4JC8A 4S1OA 3SKVA 4LHWA 1PGNA 4K86A 1VYVA 4HAIA 4PS0A 1TQ4A 4X7MA 5DN6D 3K30A 2WWVD 4YRQA 3QKSB 4LFCB 5GJBA 3VDNB 2D5AA 1PUXA 4FGLA 1SXIA 1XAHA 4RH0A 2C07A 5JMWA 3F2IA 1R12A 3GAZA 1KDTA 4B48A 3TBHA 4HZGA 5JAPA 2RGEA 3TOCA 2O8BB 2HX1A 4I81A 5AKEA 4WCFB 1CZOA 2F00A 4XLZA 2VXBA 1EK6A 2YWRA 3LQ1A 4NPAA 2O2HA 1OAAA 1U5BA 1L7NA 3JAKB 2G5PA 4KKXB 3SM9A 2Q07A 3FD8A 1GNRA 3CN7A 4YRBA 3VU3A 3TGLA 2Z2ZA 3JVDA 4L9SA 5EMNA 1E9FA 3I6ZA 4Q4HA 2QM3A 5T6MA 3F47A 4PC1A 1DI0A 3QWHA 5CHYA 1W9MA 5EJ8A 1UBGA 4GD3Q 3HCEA 2LBPA 1N2EA 1QWSA 3JQCA 4EW3A 3NRCA 2VJNA 3ITEA 3EVBA 3KVVA 4TYPA 1JV2B 2C5AA 4RF5A 3ROXA 3O8RA 1QH8A 1Q0PA 1NMZA 2GPNA 2YNMC 4P38A 4WNAB 3ZNOA 1UL1X 4NY1A 1N8TA 2UXDB 2JJ2D 1CETA 1HZZA 4XIIA 4CQMB 4E3WA 3GUYA 5CNMA 3PC2A 1RKBA 1TJNA 4FJ1A 4CKZA 2NTYC 3OQ6A 1U4NA 2GHIA 2JHPA 4ZOCA 1OX6A 1H05A 3CF4G 4FZRA 1AQYA 5G0SA 1XHFA 5B1HA 3V4LA 1KEUA 3SMVA 2DBRA 3H2ZA 3URKA 1PR6A 2Q50A 1JH9A 3DKIA 2X7XA 4MP8A 7REQA 3KDAA 1YS6A 1C4XA 2FAXA 3CW2A 1U0RA 2HI0A 3SBEA 1M1YB 1WPRA 4NX2A 3LLVA 3TJRA 2X8LA 1I3CA 2JDIA 2X0JA 2FVYA 3FXAA 3PFBA 4G4JA 1LRKA 1P77A 2Q3JA 1U0OC 2H4FA 4UXIA 1OAOC 2ZAYA 1PCXA 3DDUA 4TGLA 3T06B 3UHAA 1PL8A 4P4SB 1N1DA 2NVUA 4KI0A 1VDMA 1Q1NA 3H2SA 4OSOA 3RS0A 3G68A 5AW0A 1Z06A 3UMGA 2HNKA 3KJNA 4WZZA 1V95A 3CNQS 1T15A 3A1TA 3LPNA 1JR3D 1BDIA 1BVRA 3BRCA 1J1ZA 3C3XA 4EJ6A 2V45A 4OLHA 4XQ0A 4B71A 4UTOA 2X0DA 1ZH0A 1VXRA 1WZCA 2H8GA 4IEEA 3RABA 3S81A 4P31A 1YFJA 2R60A 4D9KA 4YS6A 4KFTA 1FUKA 4MCJA 1WHTB 3R8XA 3TNDA 2HIAA 2VPIA 1HT0A 1JEJA 2FVXA 1UBHS 1SD5A 2HV9A 3FCSB 1HZZC 1OYVA 1GZDA 1HYEA 1YAJA 5E9WA 1H5QA 3ND8A 1WO8A 4UMDA 4C3ZA 4C6SA 4Z1MD 2HB6A 1XZAA 2E37A 3BRSA 4OYLA 5KTTA 3MQ2A 5C35A 2ZWVA 3L7CA 1C4KA 2GRAA 4O2BA 3S1LA 4DYDA 3SWWA 4X5OA 2D59A 3CGGA 1RM3A 1SNYA 2EG9A 4E4YA 4IHJF 3BE6A 4YB8A 4MUYA 2YJTD 3FA2A 5LJLA 1W5SA 4QYIB 3EGDA 1XPOA 3MWEA 3CCFA 4QBIA 1JXAA 3PNVA 1VZ2A 4GDMA 4O5AA 1OLUA 1ZM9A 1ZIDA 1M7HA 1O4VA 3Q2IA 1RZRA 1HURA 1SOAA 1VXOA 4G09A 4JLOA 1YS1X 1GYPA 4K1LA 1ZL0A 4L22A 5DN9A 3DL0A 2WVJA 3FNHA 1V25A 3HFGA 4P0PB 3TTWA 4YPFA 1OYWA 4RKFA 5DN6A 4YREA 2BGUA 3CU5A 1E4EA 2B36A 4HAUA 1YDGA 1B1AA 2VWQA 2AN1A 1SD2A 1T2VA 2REXB 4Y3UA 1KO1A 1YJAA 2JIMA 4BNLA 4EPVA 4B3JA 2V5VA 5B36A 1MZVA 4Q6WA 5JNWA 2EFYA 3E5RA 5ALVA 1KEEA 4ZQFA 1YB7A 2A0KA 1ZNWA 5I47A 4BP9A 1PT9A 3W2GA 3IE2A 4KHPB 2R8ZA 3C3BA 1E3IA 1EX7A 1QIJA 2OD7A 3LPDA 3BGIA 4OH7A 1RRGA 4Y9RA 2CJWB 5IU6A 1EFAA 2CXPA 4G07A 5DM60 1M0SA 4LRQA 1A8UA 4UPDA 4Y30A 1X1BA 1LC0A 1UF9A 1ZUWA 3IE0A 4C21A 3T5DA 2H1LA 4C1NA 1LLFA 2AJCA 1K6JA 4JT4A 5CA1B 4YGXB 3DWFA 3VO9A 5JD5A 3OU7A 5HF5A 3BGOS 2OHHA 1LLDA 3GIWA 5HGXA 4ZCQA 3GFSA 5AW7A 2FN3A 3KCQA 4TUYA 1GP2A 3SJZA 3V7YA 2V0CA 3P26A 1JXQA 1I0IA 3B82A 4F1WA 2DHCA 2WPDA 3P9QA 1FU7A 1D07A 1V5GA 3DTYA 4W7HA 5KYKA 4K05A 2J9YB 3ET5A 1EVJA 1USVA 3PUJA 2VZ0A 4GKJB 3W8NA 2GJSA 1LJUA 1Q1ZA 4A92A 3GU3A 2VIIA 2CV2A 3VR2D 3KB2A 1SKYB 2QTWB 1Y9EA 3GGDA 3TUJC 1I5OA 2Z2IA 3S4YA 2JA1A 2Q2QA 1B14A 1HLFA 2V7QA 4YLYA 2RAUA 3A7EA 3BYZA 1G41A 4HDSB 1Z0SA 1W0CA 4BVGA 5FULA 2C03A 3KJFA 3GUZA 1MD9A 5JNSA 3E81A 3R3WA 1B15A 4JYBA 1PV2A 2ZTSA 1BE6A 3OUUA 5DCWA 1K7SN 2NQTA 1DAOA 4QSMA 1OWMA 5DX1A 4OJKA 3CINA 1VG9B 3L0BA 1WB9A 3EEYA 4US2R 1QMGA 3Q7RA 1YOVB 4O4HF 1KE1A 2ENWA 3U9SA 3FCXA 4YUAA 1UEIA 1PJLA 4EGFA 2DAPA 2JGNA 1YU9A 1JHDA 2Q4DA 2W5UA 4ALKA 5AVKA 1WHSB 4L5BA 2I67A 4L7VA 3P19A 2AG1A 4S1NA 4EQ6B 5FLXA 2PSDA 1FFXA 2CHQA 1SHJA 5I3CA 1LV8A 3E5NA 4NHOA 1X3SA 2PMCA 5LD2B 5BW8A 4UTZA 3PSAA 1ZM2A 3AFHA 3R5JA 4BFWA 4HFJA 2IP4A 5BNWA 5FTLA 4YJFA 1SEPA 3QFCA 4JKOA 4MYCA 2C3PA 3C70A 1CUZA 5F35A 1LCIA 4P2GA 5KNCA 3CO0S 4JBYA 4FC6A 5COQA 1KP9A 4HN4B 4BFUA 4O4JB 2EQBA 2X2FA 3AV3A 4BEVA 4HH1A 2X5JO 4YMTA 3ANLA 1D0VA 3RTGA 2CT8A 3T3OA 3KAKA 1BDMA 3NYWA 2VTEA 2YBDA 3EVGA 3OECA 4TTSA 3ZKWA 1G8MA 1J2EA 4LE2A 1PR4A 2LVBA 2VT6A 1TVEA 1JFFB 1ZC4A 1UK9A 4YT8A 5DYTA 5JNLA 3VJRA 1T26A 3K8QA 2JLXA 4BXOB 1R74A 4F3YA 1YAHA 1KYXA 3O9ZA