5ETCA

Structure of inactive mapk14 with ordered activation loop
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
355
structure length
355
Chain Sequence
MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of inactive MAPK14 with ordered Activation Loop
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 355
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etcA01
3Q9YA 4WIHA 1JKTA 4M69B 3KCKA 3WIGA 2WQBA 4OBQA 2QLQA 3BLHA 3I79A 4ACHA 4EH4A 4EHZA 4V0GA 1B6CB 3G6HA 4K33A 4EK5A 1FOTA 3DB6A 4FSRA 2HZIA 4RG0A 2W96B 4D4SA 4IZAA 3PFQA 5AV4A 4ITJA 1GIJA 4QPAA 4JG7A 3HRBA 3EKKA 5ETFA 4MBJA 3E3PA 4XCUA 4X2KA 4GT5A 1GOLA 3GC8A 2JKOA 5CXZA 2IW6A 2WELA 4PMPA 5JFSA 1XKKA 5GZ9A 3FKLA 3QCSA 2PZ5A 3HECA 4ID7A 4D1SA 2XNEA 4I6BA 5J7HA 2HXLA 3MSSA 3UTOA 3FQHA 3MY1A 3P0MA 4D2TA 5LCKA 3N51A 4Y5QA 4JDKA 5IQEA 3FMLA 4XRLA 4R1VA 4IM2A 3IGGA 3UO6A 1UU9A 3CS9A 4N4SA 4BY9E 4NL0A 3FC1X 4YBJA 3VS2A 3JY9A 3OFMA 4UBAA 4CYIA 4I41A 4MXXA 3VHKA 1Z9XA 4FODA 1Z57A 3IDPA 4WRSA 2VAGA 5A6OA 4FI1A 4CLJA 2PVYA 3PPZA 4MD7E 4YZBA 2OZOA 3S95A 2J7TA 4X2JA 3VQUA 2ZDUA 2X2MA 5JQ8A 5M4CA 2OLCA 1NY3A 3QUDA 1VYWA 3NW7A 4V0GB 5EDQA 4UMUA 4C38A 5AP3A 4FZAB 2BTRA 3GQIA 3R8MA 1GAGA 1GZOA 3VF9A 1T46A 4F7NA 1MQ4A 5DGZA 1SNUA 4QMXA 5BPYA 5CAPA 5EM5A 3O0GA 4AQCA 4ZZOA 5L8KA 5M08A 2YM7A 2P0CA 3S4QA 3KN5A 1OIRA 2BHEA 4E6QA 5I9WA 4I21A 4F4PA 3F3UA 4PRJA 1F0QA 4UV0A 4IACA 5D1JA 3WIKA 4FTOA 2YIYA 4KAOA 3JR1A 3QRKA 5FTQA 4TN6A 4U97A 3QZIA 2PZIA 4FIGA 4FSYA 2J9MA 3C0GA 2VGPA 4DGMA 1U5QA 1B39A 1J7IA 4HYHA 3ZFMA 1WBPA 3JYAA 3PJCA 4ZY5A 1L8TA 5AMNA 5E1SA 4YLKA 3ZONA 4AGWA 5K4JA 2Z60A 3AC5A 3FSFA 4YC6A 3QRTA 3VUHA 4ACDA 4CXAA 5L2IA 1LUFA 2I0VA 4K1BA 5J9YA 2GQRA 3TIYA 5F20A 1JKSA 2YEXA 2UV2A 3E63A 3Q6UA 5TT7A 1V0BA 4I23A 2W17A 1Q62A 5EW8A 3ULZA 4CG9A 3AT4A 2ZMCA 2BZKB 3A61A 4ZJIA 4BCNA 5C8KA 5EI8A 4F6UA 4ANNA 4RLLA 2WGJA 3ITZA 3AD4A 2C6TA 3G0EA 2WO6A 4FL2A 4A07A 2E2BA 3IDBA 3MVMA 4IAFA 1KSWA 1S9IA 1LR4A 2QO9A 5EH0A 5JEBA 2V7OA 2YM6A 4L6QA 4BFMA 3GCVA 5ANDA 5HLWA 1V0OA 3FY0A 4QMVA 4RWLA 2C3JA 3GU7A 1VR2A 5EYDA 4DH7A 5JH6A 3H9OA 3HV4A 2W1CA 4DT9A 3W8LA 4R7HA 3MPTA 4NU1A 3FI4A 4PX6A 5AP2A 2LGCA 3AC1A 3BEAA 4FV7A 2QHMA 3KMWA 4RX5A 1UWHA 1STCE 5AR3A 4ZIMA 4PQNA 4GSBA 4LRJA 3VBTA 4P7EA 5CF4A 1XJDA 4K6ZA 3SA0A 2FYSA 5BYZA 1PW2A 4G3FA 2I0HA 2ZJWA 3QXOA 4GS6A 3IKAA 4QYGA 5LVLA 4PDPA 3ZYAA 4AN3A 3TT0A 4U41A 1BKXA 4O22A 3TZ8A 3PYYA 4QD6A 1PY5A 2C69A 3EFWA 4DFLA 1MUOA 2XEYA 1KE8A 1ZOHA 1ZZLA 4XV1A 3PA3A 4YSMA 5ANIA 3UVQA 3VF8A 2IWIA 5K5XA 4DE4A 4GK3A 4BHZA 2RFDA 3BYSA 3FL4A 1XR1A 4BDHA 1XBCA 2GTNA 2UZVA 2XK3A 4IBMA 2BKKA 3ZO1A 3RBWA 2JIIA 5IMEA 4G6NA 4FTMA 4YPSA 2WMUA 2P2HA 4RWIA 5KZ0A 1HCLA 4OR5A 1H1RA 1EH4A 5H2UA 4IZYA 4H05A 5EOBA 3U51A 2JFMA 3ZSGA 4O86A 3S2PA 3CJGA 4C62A 5IUGA 3OUNB 5J87A 1PYEA 4OTQA 2RFNA 3NUAA 2GHLA 1YW2A 4U80A 2F7EE 4JIAA 4GKHA 1OIQA 4EC9A 3L8XA 3PRIA 2W4KA 3ZS5A 4WUNA 2O3PA 4Y73A 3UDBA 1KE9A 4EK6A 4OAUC 1KOBA 3KKVA 4TY1A 4C4EA 4QMYA 2Y8OA 2WEVA 2QR7A 3FMDA 3HLLA 2UW5A 2OFVA 3PVGA 4O0RA 4HYIA 4TYIA 1CDKA 2HENA 4D2VA 3MFTA 3GT8A 1QPCA 3ODZX 4JAJA 1NT2A 4FZDB 4XG3A 3SAYA 4PL4A 3EJ1A 3ZUVA 1M2PA 1W98A 5BVNA 4RGJA 3ZU7A 4O1PA 3D7TA 1K2PA 3D5VA 4DEEA 3COIA 3VVHA 4FEVA 5DE2A 3IDCA 4C4FA 3IW5A 1M7NA 2IZSA 3EHAA 3E7VA 4JDJA 3W55A 2JIUA 3QRJA 3SLSA 2HWOA 4LOPA 2R3FA 4DAWA 4A9YA 1LP4A 1YXXA 4OTFA 3EQHA 4FL3A 4CT2A 3P86A 3EN6A 4IX5A 3R9OA 4FGBA 5IQIA 4GIHA 5H9BA 2YACA 4UXLA 2C0IA 4FK3A 4RJ5A 4ZZMA 2O63A 2R3JA 3FMMA 2GDOA 4BTMA 3IK3A 3DJ6A 3Q32A 4XLIA 4X2GA 3GENA 5J9ZA 3QZHA 3ROCA 3BU5A 3U4WA 4I93A 1OUKA 5L4QA 2QO7A 3DQWA 3NUYA 1BMKA 3QC9A 4O7WA 4PDYA 2UUEA 3EQPA 5GZ8A 2RL5A 5JFWA 2G01A 3RPVA 2HIWA 3K3JA 4HVSA 2YN8A 3F3TA 3TN8A 1OPJA 4FG9A 2VO6A 3KY2A 4DITA 4NJ3A 3BGQA 4XG9A 4D1ZA 2JITA 2Y9QA 2OJJA 2OXXA 2BUJA 1P4FA 5AR4A 4E4LA 4CT1A 2GTMA 5JGBA 3FV8A 1ZYDA 5KZIA 4FTQA 5DT3A 4H36A 3FQEA 3WILA 3MB6A 4AOJA 3PTGA 3SRVA 1OKYA 4Y72A 5B2LA 3DKCA 4EWQA 5EKNA 3G6GA 3E88A 4FUXA 4L45A 1ZOEA 5KO1A 3C5UA 4NWMA 5E8ZA 4JAIA 5M09A 3MJ2A 4J7BA 3CTHA 4UZDA 4QP1A 2W0JA 3R7VA 3PXZA 3V8WA 3MIYA 4B7TA 5IMXA 3ZLYA 2VWYA 4QYYA 1UNHA 3BCEA 5L6WL 4CMOA 3JY0A 3WYYA 2GQGA 5M55A 4P5QA 4UXQA 2W5HA 2B4SB 2JKMA 3EWHA 5D11A 2PVHA 3VUKA 1U59A 3ENMA 4OT6A 3DKFA 4J71A 5JRSA 1E1XA 5TR6A 3BU3A 4RIYA 3FZSA 4W4XA 3ORLA 2PVJA 4X2NA 2QHNA 1G8SA 3GBZA 5CF5A 3LQ8A 5IA5A 3OY3A 4M66A 4K2RA 5LARA 1YOLA 4OTDA 3RKBA 5D9HA 5M07A 4I0RA 2PE1A 3ZSHA 1BI7A 1J7UA 2XCHA 5CNNA 5IQGA 5JKGA 1X8BA 4K18A 1MP8A 3G5DA 3Q4UA 4FKSA 1XH5A 1V0PA 2BRMA 2H96A 3HUBA 3QQJA 4U45A 3W2SA 4O7NA 4O1OA 3VUIA 3E92A 2W99B 5AWMA 3ZH8A 5HX6A 2Y4PA 4CKJA 5I9VA 2YWPA 3R7GA 1W0XC 3BHTA 3HA6A 3SRVB 3V8SA 4EH6A 4CZUA 4KIKA 4EHGA 2WKMA 5AM7A 2UVZA 4FMQA 3LQ3A 4E4MA 3NUPA 2VTHA 4DTAA 5CU3A 4BCMA 5L8LA 4DH3A 3FLQA 3IW6A 1YHSA 5AUXA 1CKIA 3P08A 1OMWA 5IU2A 5DRDA 2QG5A 1UU3A 3EN9A 4JXFA 5BVWA 4YBKA 3QHWA 2R4BA 2W1GA 3PUPA 1JVPP 2A27A 2X81A 3FZRA 3LJ0A 1FBNA 2BR1A 2XYNA 3VUGA 3VS6A 4RIYB 3BQCA 3OTUA 4F99A 4FEUA 4BIBA 3MS9A 2JDOA 4YO6A 4PMSA 3L9LA 3NUUA 4L68A 5FDXA 2X8IA 4ZK5A 3RPSA 3SVVA 4Y8DA 3UP2A 4H39A 2VTSA 1DAYA 5EW3A 4RIOA 4AACA 3KC3A 4QTEA 5E8TA 1PJKA 4C8BA 3BPRA 4L44A 5BYYA 2CMWA 3KXXA 4HPUE 3HV5A 5KBRA 2UVYA 4FKPA 4GYGA 3V5JA 1BYGA 4EQCA 4CKRA 1VEBA 3NX8A 5A6NA 4S2ZA 2OJIA 3LPBA 4KIKB 4LGHA 2W4JA 3QQHA 4EYJA 3TJCA 5DN3A 3SGCA 3MTLA 5JRQA 5B7VA 2ITXA 5EM6A 4GU9A 4D9TA 5IUIA 3OBGA 3MVJA 2QOFA 4BCGA 1H1WA 1YI3A 2CCIA 2BRHA 4AP7A 4KKEA 4G9RA 4J53A 4QYEA 4XJ0A 3DQXA 3ZEPA 4IDVA 5AAFA 4C57A 5DOSA 2DUVA 4KSQA 4FSQA 3AC3A 3UGCA 2QNJA 4FOBA 1J1BA 2W9FB 3TKIA 3H9FA 4L7FA 2WTKB 3AC4A 3PA5A 1H07A 4MD8E 4O83A 3ORMA 4JG6A 3SXFA 3GC9A 4HGSA 2XK7A 3MA3A 3ERKA 4FIJA 4XG6A 3KK9A 4RT7A 4U43A 4YZ9A 1ZYLA 5L2WA 5TF9A 2EXMA 4FEQA 1Y57A 3QQKA 2WTKC 2VTAA 2W1ZA 3FSKA 3BYOA 3WF7A 1YOMA 2O64A 4M12A 3V04A 4APCA 2OKRA 3F88A 3A7FA 2BRNA 4RQKA 5CEKA 5HU9A 4ZTSA 5GHVA 5AUTA 2QKWB 1WBSA 3CP9A 3Q9WA 1Q61A 1JQHA 2ZB0A 4BB4A 5CYIA 3GCUA 4EOMA 4S30A 3S0OA 4B6LA 4BDGA 3KXZA 3LXKA 1BLXA 5AA8A 3CPBA 4G34A 3SG8A 4YTFA 3AMBA 3LQ5A 1WBTA 3E64A 2ETMA 3SC1A 4RIWA 3MFUA 5M06A 5IQAA 4P90A 1QL6A 4XBRA 3WBLA 5CT0A 4RIXA 4M3QA 3R1YA 4IX6A 2HW7A 1G5SA 5ACBC 3RI1A 4CQEA 1GNGA 2WU6A 1ZARA 3BLRA 4H1MA 5E8UA 4LG4A 2PUPA 3C50A 3GU5A 3VBVA 2EU9A 3H0YA 3MVHA 3OC1A 4GVJA 3A2CA 3QTZA 2CNUA 2XJ1A 4EI4A 4QPMA 4C3FA 3UIXA 4Q5HA 2IZUA 3PVWA 4YJQA 2WTDA 3I0OA 3DBDA 2WTVA 4J52A 3RAIA 3GVUA 5DWRA 4HVHA 3HEGA 2I0EA 2ERKA 2GNFA 3NUSA 2BKZA 5AAEA 4FZ7A 4HYUA 4G17A 3RVGA 2X7OA 2WTJA 3MYGA 4KRDA 3UO4A 4C36A 4BZNA 4PWNA 2HOGA 5J5SA 5CU2A 1YWRA 3RCDA 2G15A 3S00A 2IVUA 3BYMA 5HKMA 4DLJA 3P78A 4FC0A 5EQEA 3EN4A 5KX8A 3D4QA 1WVYA 2QOIA 4OGRA 4BF2A 4IHPA 2PZPA 3TNWA 3E8DA 4LV8A 3DLZA 3OHTA 3FLWA 5AUYA 3TNIA 4GK4A 2HWPA 3FYJX 5EFQA 5AP6A 2WD1A 4F9WA 3UNKA 4FV9A 1U54B 5GJFA 4RQVA 4RIXB 1CKPA 1RE8A 4TWNA 4EH5A 3OEFX 4QMQA 3VULA 3D14A 2YCQA 4F9CA 2OGVA 2R0UA 4OT5A 5HO6A 4AGUA 4JDHA 3NYVA 2W05A 5DH3A 5ANGA 3TNPC 2WNTA 1ZXEA 4FKGA 5BUIA 3EFKA 5HICA 3SW4A 4BVUA 4EWHA 2C5VA 2XIXA 2Z7QA 2B54A 3RCJA 2IW9A 5ANOA 4AZTA 4IJPA 5E8SA 1UU8A 3OMVA 4J97A 3H10A 3IPHA 3OBJA 5KUPA 3R21A 4H3PA 4ASXA 4O7VA 3LFDA 2ITWA 1JKLA 3F7ZA 3I7CA 4NM5A 3FZ1A 4GYIA 2ZM3A 3ZM9A 1AGWA 5EDPA 4IAKA 5BVDA 2V55A 4UYAA 5KNJA 4O7SA 3CR0A 3HYHA 2XYUA 4EOSA 1Q8TA 5M56A 4V04A 1YWVA 4P4CA 2EVAA 3LCSA 2YERA 4IWDA 4WD5A 4IB5A 1R3CA 1TQIA 2XA4A 4I4EA 4R3PA 3II5A 1T45A 5CZIA 3KXNA 3O8TA 2BFYA 4NFMA 1MRVA 1Q8ZA 3ENHA 3ACJA 4FSWA 5D10A 2YM3A 1ZY4A 4ANLA 2HY0A 5C4LA 4NIFA 4OTIA 4KIQA 3UQGA 4XP0A 2I0YA 3NRMA 3CTQA 1Y8YA 3RNIA 3HZTA 3VC4A 3TNQB 3QD3A 5LWNA 5CF6A 3QQUA 2C1AA 4KABA 4FV0A 4A06A 1UNGA 4JIKA 4BDBA 4NW6A 1WBOA 4MK0A 2XIKA 3DTWA 4U3ZA 1PMVA 2H9VA 1CTPE 4YTIA 4WT6A 4ZTRA 3OW4A 2OG8A 3ZCLA 4GL9A 4O6LA 4C35A 4BBFA 3BX5A 2YZLA 3FI8A 1DAWA 4YJTA 4IB3A 4BR3A 2RFSA 1J7LA 4ZSAA 2CGXA 2ITQA 4L01A 1H4LA 1H00A 1IG1A 4MQ1A 4LMNA 3WI6A 5LMKC 2JAMA 4TNBA 4LOOA 5LOHA 4DTBA 3AT2A 2V7AA 4NTSA 1PXOA 2I1MA 3E3BX 3NVMB 2VTTA 4L3LA 1IRKA 2UW6A 4BKZA 3BRBA 1O6KA 5K0XA 2R3GA 1U5RA 4QRCA 2HCKA 3DFAA 4GV1A 4J99A 2HW6A 3UYSA 2R3QA 3HVCA 5CU6A 2CDZA 4O0VA 5CEMA 3SW7A 1W7HA 3KVWA 1RDQE 4LGDA 4XV9A 4FNWA 4BCFA 3ORKA 4AGDA 4IIRA 2CJMA 4XBUA 2ONLA 4HGEA 3A8XA 4NIFB 4ORKA 5HO7A 3U6JA 1OL2A 3F5XA 4KNBA 4UALA 3W2RA 3V5LA 1HOWA 3C0HA 4MCVA 4DFZE 3DNDA 2F2UA 3O8PA 3FXWA 1MQBA 2JBPA 3UE4A 3Q2MA 3QUEA 5EQYA 3HDMA 3F6XA 2CLXA 3R1NA 2R9SA 3CQWA 3ZDUA 5HNBA 4Y5HA 3KVXA 4KS8A 3TIZA 2XF0A 5I4NA 4M84A 4YC3A 2QURA 4XOYA 3QRUA 2ZDTA 3QGWA 4TW9A 3RWQA 4A7CA 3D5UA 4NTTA 5B2MA 4CQGA 4Q9ZA 1Q4LA 4FX3A 4LOQA 3RK7A 2Q0BA 2F7XE 2RGPA 3OUKA 4QP6A 4AA5A 3O7LB 4AZFA 4QP3A 2C6OA 3NAXA 4G6LA 3TJDA 4AXAA 4H3QA 2X7FA 4GJ2A 4ASDA 4JX3A 3GFEA 4FIHA 5AV3A 2ZV7A 3LOKA 3IW4A 5HIBA 4UB7A 4USDA 4YLLA 5EI6A 3VO3A 3PXQA 1IEPA 3BLQA 4QT1A 3KXMA 1Z5MA 3MTFA 4EL9A 3FDNA 4IAIA 2GFSA 2C4GA 4E7WA 4AS0A 1ZWSA 3TZ7A 1F3MC 4IADA 5AUZA 5ANKA 5F4NA 4RLKA 3FI2A 5CAQA 5LMAA 2W5BA 3PSDA 1P4OA 3MVLA 5FTGA 3V6RA 4M13A 3ZDIA 4JLCA 4D4VA 3MW1A 2PTKA 3CD8A 3TL8A 4OUCA 3WF9A 2B1PA 1A06A 4M14A 4DGLC 4YURA 2H34A 4BGQA 4HVIA 4E6DA 2F57A 4WNPA 4O7YA 4C2WA 2X2LA 2YM5A 1W84A 2ONLC 2WTIA 4QMNA 3OWJA 4FT5A 4QMSA 5DA3A 2YDIA 5EHYA 1YOJA 3RAHA 5IEXA 3ACKA 3FLYA 4XV2A 4DG0E 2OWBA 3QX4A 3CE3A 3LJ1A 1YWNA 4GT3A 4HPTE 3OWKA 2R64A 4PTEA 5E92A 4EQMA 4ZP5A 5J79A 4PMTA 2C3KA 2QOHA 2RKUA 2YCSA 1YVJA 3UBDA 4U42A 4U81A 3ZEWA 2WMBA 4IWQA 4I6FA 4KRCA 3KULB 2X4FA 4BDEA 1QMZA 4KUJA 3DKGA 4I0TA 2G2FA 4Q9SA 4TPTA 4FIEA 3HMMA 5A4QA 2ETKA 3CGOA 1URCA 2YDKA 1OVEA 3BI6A 3K2LA 3NZ0A 3R7EA 4EH9A 3C5IA 4W4WA 4BGGA 4YLJA 5CSXA 5H8GA 4RC3A 4LRKA 4OW8A 5CY3A 3U8WA 5EHOA 5CQUA 1CKJA 1SM2A 4IE9A 4LI5A 4HCTA 3BHHA 3VBXA 1PMUA 3BWJA 1W82A 3TTIA 1UNLA 3OCGA 4BIDA 2BRGA 4FKQA 5M57A 3E8EA 3HMNA 4FVQA 3MY0A 3FMHA 5AM6A 3JXWA 3KQ7A 3F82A 4JQ8A 4NKAA 5IEYA 3QUPA 4F9AA 3NEWA 3LM0A 4YUQA 4WUAA 4EZ7A 3NSZA 4TWOA 4TNDA 5DR2A 3LIJA 3RPRA 3O2MA 3Q6WA 3VW6A 1H27A 2OJ9A 3BE2A 3D94A 2OFUA 1O6LA 4KKGA 4ACMA 4N57A 3QAME 4ZLZA 4QMOA 3B2WA 4IFCA 3FEGA 5IQBA 3DZQA 3L9PA 3QA0A 3ZC6A 4AW0A 3E5AA 3FC2A 3VBQA 3CSVA 3VS0A 3ZHPC 2ITZA 3Q9ZA 3SV0A 4YHFA 3C1XA 4L8MA 4AAAA 3R7OA 4C58A 3FLSA 4PP9A 2PE2A 4QTDA 4A9RA 4A9SA 4NKSA 4HZSA 3RINA 2RG6A 3R04A 3MI9A 4TWPA 3PLAE 2FSMX 4IJ9A 4I24A 2VV9A 4I3ZA 4MX9A 2OXYA 3FLZA 3MDYA 3F66A 1OZ1A 4RFMA 4RVLA 5CI7A 3U6IA 4EK4A 2YZAA 1KV1A 4FNZA 4QQCA 4E5BA 4HW7A 2UZOA 2ZYBA 3DS6A 2X9EA 3I7BA 1FGKA 4ONAA 4XH6A 2PMNX 2R3KA 4ZS0A 4BDJA 3QTUA 3CQEA 3WF6A 3HUCA 3VS7A 4L46A 4BICA 4ZS4A 1Y91A 2ERZE 4QYFA 5L2QA 3TKUA 1W83A 4JVGA 2JLDA 3NW6A 5AV0A 5E1EA 4EORA 2BMCA 5L6PA 3OVVA 1RQQA 3K5UA 4MF1A 3F69A 2XK9A 4FG8A 4EJNA 2XNNA 3FAAA 1R1WA 2OJFE 5AA9A 5AUUA 5IQDA 4MYGA 3DXPA 1XH7A 5HCYA 2UZBA 3JS2A 4H58A 4GU6A 4YJRA 1UKIA 2J90A 4IAAA 1ZAOA 4FYOA 5ICPA 4EONA 3VRZA 2XS0A 4TRLA 3ZUTA 4R3CA 3WARA 1HCKA 3RHXA 4O0SA 5EDRA 4IC7A 5L2SA 3G51A 5JGAA 3KXGA 4WRGA 1XHAA 5FBNC 1OUYA 2W4OA 2XKEA 3EQBA 4AN2A 4GEOA 1G8AA 4LQMA 4OTHA 3A4OX 3IOPA 3LFFA 5FG8A 2GNGA 3DJ5A 3IOKA 3IQ7A 3TV7A 1TVOA 4TT7A 3ALNA 4ZTLA 5GZAA 5I0BA 4L42A 3PIXA 2RFEA 2PY3A 3H0ZA 4H3BA 5A46A 4FSNA 4Y85A 4DGNA 2GQSA 2C6IA 2VTNA 2ITYA 3HRCA 5D7VA 2C5NA 1PXJA 4XG7A 5AR8A 4EUUA 3COMA 4BI1A 3OY1A 1YRPA 4N0SA 3UP7A 3POOA 3LMHA 2XM9A 3GC0A 4FV4A 3AG9A 4BDFA 2BALA 2JGZA 4F09A 2Z7LA 3CC6A 4O0TA 3T9IA 1M14A 4FIFA 5HE1A 3VWAA 4D4YA 4DFXE 4F63A 2R3HA 4DFUA 2BZJA 5D12A 2R7IA 3DZOA 3DBFA 1XH9A 3F3WA 1Q97A 5DYJA 2XK8A 3NIZA 1AQ1A 5FEDA 4UMRA 5EM7A 3S1HA 3FBVA 3UG1A 5HD4A 2C6KA 4CSVA 3ID6C 5I3RA 5I9ZA 5FGKA 5FTOA 5DT4A 2PE0A 3LXPA 3RHKA 1OM1A 1WBNA 4FK6A 1ZMUA 4ANQA 3C51A 3PWDA 3TXOA 3ZMMA 3NWWA 3KL8A 1SMHA 2HYYA 1P5EA 3RP9A 4YJVA 3PJ8A 4FF8A 5ETAA 2EXEA 1OKZA 2YLFA 2WMVA 3ALOA 1M2QA 3LCOA 5HTCA 3E62A 4U44A 4FTCA 5F94A 2VNWA 4TTHB 1IA9A 3E7OA 5J9LA 4Z16A 1NXKA 4DTKA 4PPCA 4CV9A 2VN9A 5CSWA 3KFAA 4GK2A 3W16A 2GHMA 3P4KA 4I4FA 3VAPA 3O23A 5C4KA 4DEIA 4ZEGA 4YC8A 2ACXA 1KE7A 3A7HA 4IFGA 4IC8A 4ZMFA 3NPCA 3T9TA 5AADA 5AIKA 4UX9A 1IA8A 5JSMA 2PUNA 4IEBA 4S31A 3GUBA 2PPQA 5J7BA 2WU7A 2EUFB 3DOGA 3LCDA 3E8CA 4MTAA 2JDRA 4O6EA 4AE6A 3NNUA 4QP8A 2QCSA 4HNFA 3BU6A 3H3CA 3R7UA 4E4NA 2GS7A 1NVRA 3ET7A 2PMOX 3P23A 3PA4A 1ZYSA 2I40A 1ZMVA 2PSQA 4Q5EA 3I60A 4XS2A 5HESA 4EOLA 4APPA 2C6LA 4MH7A 3I0QA 1UWJA 3ZTXA 4BCIA 2XIZA 1GZ8A 1JKKA 3UVPA 3UOJA 5KMIA 2NRYA 4OTPA 4E26A 4MNFA 4X6QC 3V3VA 3GXLA 3UVRA 3OOGA 3QCYA 2R0IA 4KIOA 5IUHA 4C0TA 1FVTA 4QMMA 2ITTA 2BDWA 3Q52A 2W1EA 5G6VA 4WNOA 3PXYA 4CFVA 1XH8A 2OSCA 4G16A 2JD5A 4MVFA 4QTCA 4R3RA 3D7TB 2OICA 4RRVA 5HNIX 3NW5A 4F6SA 1J91A 4ANMA 2CNQA 2QO2A 3MA6A 3P7AA 2E9NA 2QODA 3QQGA 2CCHA 4I0SA 4LUEA 3W1FA 3SXRA 3WZJA 4ANSA 4C02A 4E8AA 3OS3A 3R9DA 4F1TA 3TCPA 3NYNA 4IB1A 1WCCA 3D2KA 5K9IA 4DEBA 3WZDA 4CZTA 4R77A 4PL5A 4FKWA 4YGAA 3DXQA 1BUHA 2O65A 5CAVA 4YHJA 4I92A 4C4HA 3KN6A 2KULA 4RWJA 2QU5A 3DT1A 3HX4A 2VWIA 1VZOA 3OXZA 4X7QA 5EYMA 1JWHA 2C6DA 4E20A 1H26A 4JS8A 4D2SA 3CY3A 1JOWB 1YKRA 2QR8A 3LW0A 3VUDA 4CLIA 3F3VA 4JG8A 5LWMA 4BCPA 3BV3A 4L52A 2R5TA 2JBOA 4XHKB 4OTRA 2XBJA 1XBAA 4DA5A 2X0GA 2BDFA 4BCHA 2V22A 4E1ZA 2B9HA 2EXCX 4CFFA 3ORNA 3LZBA 4RC4A 4DBXA 5CAOA 1WVXA 3LLTA 2B7AA 4AGCA 4B4LA 3B8QA 4MWIA 3R01A 3ATTA 2CKQA 1PKGA 3VRYA 2CNVA 3F5GA 3EQRA 5KHWA 4YJPA 5JN2A 2BTSA 4CV8A 2WQMA 2YIRA 2X2KA 3FHIA 5J1VA 5TO8A 3DXNA 3PPJA 3WYXA 1CMKE 4AZEA 4UY9A 2VX0A 2PUIA 4FKUA 5ACKA 4JBOA 4CNHA 2A19B 3C13A 2VO0A 5J8IA 4F64A 2CHLA 3EFJA 4YSJA 2Y4IC 4R1YA 4D0WA 5BVKA 2UZEA 3GCSA 5AP0A 3HAMA 2R3OA 4MNEA 2BDJA 3FMNA 2VWZA 3NCGA 4WNMA 3FZOA 4Q2AA 5ANEA 3N4TA 3Q53A 2ZB1A 5JQ5A 3DAJA 2OW3A 5FXRA 3R6XA 4EHVA 4CCUA 2QKRA 3COKA 4JL9A 4YZMA 3ZO3A 3EMGA 5GINE 2XJ2A 4OBOA 4DBNA 5E8VA 4CMUA 4PUZA 4E4XA 4I94A 2ZV2A 4CFWA 5AFVA 3R28A 3Q4TA 4XG4A 2PVKA 3I4BA 3NNXA 5FM2A 4F7LA 4UMTA 4JRVA 2PU8A 3ZOSA 1WMKA 4FV5A 4EJ7A 1R78A 3F2AA 2R3RA 3PY1A 5I9XA 1REJA 3MESA 1O6YA 3LXNA 4FR4A 3DLSA 3LAUA 4IZ7A 3PIZA 4DH5A 4WKQA 4HNIA 4X21A 3I5NA 5K5NA 3TM0A 4R8QA 4HGTA 2C5XA 3FZPA 3JVSA 3C9WA 4YZCA 5EG3A 5FXSA 3R22A 3N4VA 2OXDA 2ZMDA 3SD0A 4PY1A 4CFNA 4JBVA 5LCJA 1I09A 4BWKA 3MPAA 4RJ6A 1H01A 4QOXA 4P2KA 5DPVA 4DHFA 3RPOA 5C26A 2ESMA 5EYCA 4RJ4A 5K3YA 4E5WA 5AIRA 4BRXA 1OL6A 4DFYA 5CTPA 4BKJA 4C37A 3PRFA 4AT5A 2HY81 2ZAZA 2WEIA 2VTLA 1MRUA 5HG9A 4DH1A 5M4UA 1SVHA 3R73A 2CLQA 3RJCA 4IVDA 4IB0A 4AW2A 4JNWA 4BIEA 2GS2A 4ZSLA 3AGLA 4O7TA 4IX3A 2QVSE 4D2RA 1OPLA 1RW8A 2XM8A 3CXWA 3D5XA 3FYKX 4PTCA 5DFPA 3AC8A 2O0UA 4X3JA 4QPSA 4RSSA 3I5ZA 3HP5A 4I20A 5AUVA 4IANA 1FMKA 1FVRA 5L2TA 4CMTA 4I5PA 4ITHA 3SHEA 1U4DA 3OWPA 3FJQE 3HP2A 3O96A 2XRWA 4HCVA 3WE4A 4HOKA 4F0FA 5HI2A 1FINA 2XH5A 3MV5A 5C8MA 1K9AA 3A7JA 3GU6A 5DR6A 5HBHA 5C9CA 3PG1A 3QFVA 3PJ3A 4NEUA 4DCEA 2C6MA 2PMIA 3HA8A 3DBEA 3MH2A 3PXFA 1SNXA 2YFXA 4FVRA 5AX3A 5J5TA 4XOZA 3FE3A 4YP8A 3PZHA 2VTMA 3VS1A 3LVPA 1VYZA 1WBVA 4ZJJA 4D5KA 2Q83A 4TYJA 4ERWA 2WMTA 5B2KA 3C7QA 5I3OA 4RVMA 3ATSA 5AX9A 4RFYA 4D9UA 1OITA 2V0DA 1JAMA 1KE5A 3Q4ZA 4PNIA 3W8QA 2FUMA 4D0XA 1JSVA 2VNYA 3R02A 3CGFA 3F5PA 2J0KA 1WZYA 5J1WA 3Q5IA 5FBOA 3VHEA 1YHWA 3R7YA 3WF8A 3C4EA 3DAEA 2Y6MA 3U4UA 3V5PA 4BCJA 4GFGA 4FTTA 4CKIA 4MKCA 5DT0A 3HAVA 2BAKA 1JLUE 3FI3A 3C4XA 3R2BA 4W4VA 3KRRA 3ZZEA 1APME 3DDPA 3GGFA 3RK5A 2VGOA 3FMEA 4JR3A 3P7CA 5JGDA 4J8NA 5CEPA 2HELA 4YNEA 3EKNA 4XX9A 5DI1A 2Z02A 4I5CA 3IO7A 4RMZA 3ZFXA 4AT3A 5IG1A 5CASA 4BCOA 2R3LA 4XNEA 4QP7A 2E9VA 5AAGA 4EOQA 4AE9A 2RSVA 3EZVA 2W7XA 4R6VA 5AJQA 5HEZA 4EH7A 4UMPA 3DNEA 4BZOA 2BIKB 2IZTA 2WTWA 3EH9A 4FV1A 5EW9A 5CAUA 4M15A 4B0GA 3NYOA 2YCRA 4FTIA 3UOKA 4QMPA 4BI2A 4MQ2A 4J8MA 1GY3A 3VBYA 4C3PA 4JDIA 2YWVA 2X1NA 2X9FA 3GFWA 5IQFA 2W5AA 2W1IA 2J0MB 5T3QA 4K77A 2A1AB 4M97A 2NO3A 4MXCA 4AN9A 4FEXA 4O7LA 4RIWB 4MF0A 3BHUA 3IG7A 4FVPA 2ZV9A 1OKWA 2ITUA 3V51A 2P3GX 4ZOGA 4BHNA 5LMKA 3EL7A 4YTCA 3L9NA 3R9NA 3RWPA 3WE8A 5FDPA 4DG2E 4KS7A 4IDTA 3KRXA 4IXPA 1H1QA 2P4IA 4KSPA 2GNLA 3U87A 5A9UA 2XUUA 2IZRA 2XKFA 4U40A 3TACA 2J5FA 2BAJA 5AV1A 2YM8A 4O21A 3EQDA 3UIBA 4D1XA 3GU4A 4TYEA 3IS5A 5J95A 3T3UA 3H30A 3I6UA 4N70A 2WXVA 1ND4A 3FZTA 4L00A 3DY7A 3Q2JA 3FXZA 3R8VA 5EKOA 4F7SA 1GIHA 2XIRA 1BL7A 2JIVA 3LFNA 5CWZA 3R9HA 4KD1A 3BGPA 3QA8A 4WSYA 5IISA 2ITPA 2OF2A 2Y0AA 5BVOA 4EBVA 4EH2A 5CZHA 4N6YA 4FBXA 3PP1A 5TE0A 3W2QA 3EB0A 3DBQA 3GI3A 3HMOA 3PSBA 4FL1A 3RALA 3RZFA 3QALE 4JRNA 4F08A 5IDNA 5E9EA 5T68A 4RJ8A 1OIYA 2YIQA 3QTSA 4CTBA 5LVMA 2YLEA 4UWBA 3MGYA 4DG3E 5HO8A 4IW0A 4D4RA 5DMZA 4ZLOA 4Y46A 2OIDA 4EKKA 3UQCA 4AWIA 4YJNA 4O81A 2PZYA 4F6WA 3IONA 1Q5KA 5A4CA 2DQ7X 5AR2A 3EFLA 1FGIA 2PL0A 2VWWA 3I6WA 4JX7A 4FKLA 1AD5A 4E6CA 5CANA 4FTJA 4CTCA 1O9UA 4AZSA 4C4GA 4PP7A 5CU0A 2VTIA 4IVAA 1YDRE 2HZ4A 4KBAA 3HV3A 4X3FA 3UPXA 4GFOA 3NDMA 3QCXA 4I5HA 4GMYA 4K0YA 3PWYA 2UZDA 5CSVA 3SG9A 5A54A 3UMXA 5T6KA 3BQRA 4ZY6A 3QD4A 3KMUA 4G5JA 5AP7A 4EK3A 3DPKA 2WAJA 4FKJA 4GT4A 1CSNA 2JKQA 4C7TA 3SXSA 3W10A 4PDSA 2PVLA 4L7SA 5CVFA 3RM6A 2YJRA 5CEQA 5KCVA 2Q0NA 3A8WA 4YU2A 3W32A 3MH3A 2X39A 4QO9A 2OIQA 5G1XA 4FUYA 3NVKI 4W8EA 3BZ3A 4FZFB 3EZRA 5BYLA 5CQWA 3DFCB 4C34A 3R9RA 1JSTA 2PVFA 2X8EA 3QKLA 5BVFA 5HG5A 3ORIA 4D55A 4TYGA 1PXPA 2J51A 3SDJA 3U9CA 3F9NA 3P79A 3VUTA 3EOCA 4EOPA 1JBPE 1GIIA 2R3IA 5HLNA 2XRUA 3WZKA 4U6RA 1Q3DA 3QZGA 5ANJA 2JFLA 2QU6A 3BYUA 3LM5A 4FTUA 4QMWA 2REIA 5AP4A 3DAKA 1JPAA 4USEA 2J0JA 3LE6A 3V5WA 3MPMA 4F9YA 4XMOA 3NUXA 2ITOA 2VUWA 2X6DA 1WVWA 4W8DA 3GQLA 5CVHA 4MHAA 4O2PA 3R00A 4ZTNA 4QTBA 2R7BA 4GKIA 2QOLA 3QBNA 3OZ6A 2CSNA 4AZVA 4WOVA 5C8NA 4GRBA 1QPEA 3OD6X 4R78A 2CKEA 4F0IA 2VTOA 2DWBA 3TG1A 2P2IA 2C0OA 4QQJA 2JEDA 4WG3A 2C3IB 1Q41A 2W1DA 3KA0A 4PPBA 4FT7A 3V01A 5GIOE 1R39A 1Q8YA 1PXIA 4RX7A 3LLAA 1M52A 4GFMA 5FEEA 2O2UA 3HMIA 2QOCA 5LVNA 2GNIA 4FTNA 4X3FC 4YJSA 4DCAA 1LPUA 4BN1A 4ZTHA 2Y6OA 4JJRA 3TNHA 3DA6A 1IAHA 4AFEA 3GCQA 3BV2A 3QTRA 3KCFA 4I5MA 4RVKA 2GNJA 2F49A 5KMMA 3U55A 2J50A 2XNMA 2C5YA 3ODYX 5KKRB 3Q96A 4RX8A 4P5ZA 1BL6A 3WZUA 3ROYA 5C03A 3NS9A 3UQFA 3QU0A 1H0WA 3O17A 4OBPA 4CGAA 3L8VA 2BZHB 2C0TA 3B8RA 4ZSEA 3F5UA 4PL3A 4D28A 2BAQA 3F2NA 1M17A 5BMMA 3V5QA 5KKRC 1PMNA 4ENYA 3R8LA 4FSTA 2XKDA 3H4JA 2C68A 2HZNA 2QOBA 4F1OA 3QL8A 4AA4A 5L6OA 2B53A 3KRJA 3Q60A 3MY5A 5A3XA 4L53A 2QONA 2G1TA 4G6OA 2WHBA 4NZWB 1Q8WA 4PTGA 1M2RA 4LV5A 4GW8A 3M11A 5HIDA 5M53A 4J98A 5HVYA 4D58A 1M7QA 4OLIA 4BWPA 2FA2A 3BHVA 5AR7A 3VW8A 3QLFA 4CVAA 2IG7A 5EOLA 3U54A 3C4WA 3DBCA 1H1PA 1YXTA 3DGKA 4XLVA 3RAKA 3GU8A 3EQFA 4EZ3A 3OXTA 2IVSA 5KMJA 4NUSA 1XWSA 4UZHA 2X7GA 3WOWA 4RZWA 3D5WA 2VO7A 4YTHA 4ENXA 3EQIA 5DR9A 4S32A 2OH4A 3HNGA 3ZXZA 3FWQA 5JFVA 5B0XA 1TQMA 4ALUA 4BI0A 2A4LA 3C4ZA 4GUEA 4FSMA 5KE0A 3V5TA 2OF4A 3PLSA 3CKXA 2GNHA 3KRLA 3NAYA 5DIAA 3VJNA 3UPZA 4LUDA 3O71A 4ASZA 4E3CA 4A4LA 2OH0E 3BHYA 3MFSA 4UWCA 5DVRA 4O7ZA 4O91A 2IO6A 2PULA 2YA9A 5FP5A 1YDSE 2QQ7A 5DNRA 5HBEA 5D7AA 3NNWA 3FPQA 4DF3A 3BBTB 4V05A 3FXXA 1H8FA 4AOTA 4C61A 3QRIA 4U5JA 5HVKA 3QX2A 4RJ3A 3FMJA 4U0IA 1DI9A 3BE9A 3OWLA 2IN6A 3CLYA 3K5VA 4R5YA 4KBCA 5HCZA 5C01A 4O84A 2ITVA 4BBMA 3FY2A 3ULIA 3ELJA 4GH2A 3RPYA 3FPMA 2X8DA 3KRWA 2BILB 4AU8A 2OBJA 4BTFA 5CI6A 1ZY5A 4QP9A 3A62A 3OCTA 2C3LA 4WSQA 4BBEA 5CXHA 1UVRA 5IZFA 3QWJA 3PVBA 4PF4A 3R83A 5JFXA 4O96A 4FYNA 2PUUA 1UA2A 2VX3A 5M4IA 3LCKA 2WTCA 4W4YA 2XK6A 3UOHA 3GB2A 1UV5A 2O8YA 3UNZA 3W2OA 5IH4A 1A9UA 4E5AX 4QTAA 3HV6A 4L3JA 1Y6BA 4ZXTA 5IA1A 2XJ0A 3ZO4A 4J95A 4M8TA 4LYNA 5GJGA 3A60A 2VWXA 5E90A 5HVJA 2XMYA 4RZVA 3MIAA 4R7BA 3AMYA 4CRSA 2P55A 2UW4A 3VNTA 4EC8A 3B2TA 4MWHA 1P2AA 2WB8A 4IH8A 1ZRZA 4NW5A 3LKMA 3OTVA 2C6EA 5BMSA 1QPJA 3ZBXA 1FVVA 4I1ZA 4TZRA 3C4FA 5D41A 4L67A 2C30A 3FUPA 3HGKA 5K0KA 4A9UA 5CF8A 2CKOA 3WZEA 2YM4A 3QKMA 4FICA 1XH6A 3PXKA 2B52A 3S3IA 1IASA 2B9FA 3ANRA 1R0EA 3ZLSA 4YJUA 3RK9A 2C1BA 1DM2A 2BVAA 5FWKK 4FG7A 3D0EA 4QMZA 3MN3A 1NVSA 4DT8A 2VWUA 4U9AA 3RMFA 3E93A 3DV3A 4RBLA 3MWUA 3QGYA 2UZNA 4FT3A 2JKKA 2PZRA 4E93A 5F9EA 2CN5A 2FSTX 4IWOA 1PXMA 4NH1A 4ERKA 3P1AA 3PPKA 1PF8A 1H24A 4G3EA 5KMNA 5HGIA 3PIYA 3GOKA 2R3MA 3R71A 5CEIA 2VTQA 4ANOA 4XP3A 4ARKA 3AC2A 4RC2A 2F9GA 4D5HA 2BPMA 1WBWA 5H8EA 1P14A 5GNKA 3TI1A 4XEYA 4K8AA 2UZLA 5M51A 4BC6A 1PKDA 4ACCA 3NYXA 4JQEA 4TYHA 2CGWA 3FL5A 1TQPA 3T3VA 2CKPA 2YABA 3HL7A 2J2IB 5FEQA 5I9YA 5I9UA 4FZ6A 3JUHA 3SOAA 4FKVA 3R2YA 4IMYA 5IA3A 4NSTA 3VS3A 3LHJA 4EOKA 2SRCA 2WMSA 3G2FA 3F7WA 1OBDA 4DEDA 3QD0A 4D2WA 4PMMA 2XZSA 3A4PA 4BWXA 3AMAA 1PMEA 3KF7A 1H0VA 3PSCA 1V1KA 3F2RA 3H9RA 5KMKA 4FA2A 3G9NA 5LMBA 4ZAUA 2LAVA 5HD7A 4DEGA 5ETIA 3NNVA 3QCQA 2R3PA 1GJOA 3OEZA 4XP2A 2J0LA 3EN5A 3KF4A 3OCBA 3TKHA 3LXLA 2C47A 3SOCA 1YI4A 1WFCA 3LJ2A 4AFJA 4W9XA 3UO5A 3OT8A 1KUTA 3C0IA 5EYKA 3UG2A 4XV3A 3ZLXA 4M7IA 3P7BA 4BCKA 2WQOA 4O2ZA 5HCXA 1SYKA 4U8ZA 1UU7A 2H6DA 4CYJA 4XUFA 4II5A 5CX9A 4B9DA 3GP0A 4O7RA 4TYHB 5K4IA 1CM8A 1KWPA 3A7IA 1DI8A 4EQUA 3MBLA 1YXUA 1YXSA 2HXQA 2WQNA 3NGAA 1REKA 3O51A 4G2FA 4MXOA 1YXVA 1I44A 2ZM1A 3C4CA 4KIPA 2JDVA 4IM3A 3CIKA 4F0GA 1F5QA 3IW7A 1H08A 2Z8CA 4ITIA 5E91A 4EYMA 4U7ZA 5M44A 3TV4A 3TTJA 3TDWA 4I6HA 1XO2B 2AC5A 4QP4A 2WMWA 3LFCA 5HIEA 2B9IA 2XEZA 4O0XA 3POZA 2WMAA 5DBXA 5HNGA 4Y83A 4WNKA 1URWA 2XP2A 3UC4A 3G9LX 3UIUA 3F61A 4RA4A 3GEQA 5ITAA 4FKOA 1NW1A 4LRMA 2CPKE 4DFNA 3QXPA 4GG5A 2RF9A 3AD5A 4X0MA 3R8UA 4EKLA 4EOJA 4DH8A 4OAVB 2EWAA 4O38A 3GNIB 5AR5A 4HVGA 4PDOA 4XRJA 1B38A 4F70A 4DGOA 4UEUA 5DEYA 3JPVA 5DEWA 2NP8A 3CEKA 2A0CX 5JMSA 2UW8A 2VWBA 4NFNA 4ZSJA 4JT3A 5CLPA 4JR7A 4FKRA 4KB8A 2CN8A 4EHEA 1QCFA 4G3DA 5E8YA 2PK9A 2ZV8A 3ZO2A 1BI8A 2X4ZA 2HAKA 1ERKA 3DK3A 3NIEA 3QLGA 4BDCA 1KE6A 2B0QA 2VTRA 3RGFA 4RWKA 3EIDA 1FQ1B 3PE2A 2YISA 2VTPA 2XNGA 3FHRA 2QOKA 5E8WA 3ZC5A 1Q8UA 3ZSIA 1OI9A 2Y4IB 3M42A 4UYNA 1KOAA 5LVPA 4FNXA 4CD0A 3PJ1A 3R63A 4K9YA 4ZMEA 3DKOA 4CFXA 4FTKA 2GHGA 1GZNA 3GCPA 3D9VA 4O82A 5HLPA 3EYGA 5IEVA 2KTYA 2XKCA 5IPJA 4ZTMA 2F7ZE 3R0TA 4FSUA 2UW9A 1IR3A 2QOOA 4A9TA 3CBLA 4C2VA 5CNOA 3EQGA 1RJBA 4KBKA 3L8PA 1LEWA 2E9UA 2G9XA 2P33A 2XB7A 2YCFA 3UYTA 5GJDA 4LGGA 3BELA 2UW7A 4OTGA 4YJOA 2QLUA 1S9JA 3BBWA 3VQHA 4BDAA 3UODA 2FO0A 3BIZA 3CY2A 3DK7A 1K3AA 4IVBA 4RVTA 4U3YA 4Y95A 4O0YA 3ZM4A 4Z55A 2YAAA 1LEZA 3LFBA 2V62A 3LFQA 4FIIA 4TWCA 1UKHA 3E8NA 2OJGA 3L1SA 4JQ7A 3P9JA 2PVNA 3RAWA 2F4JA 4WG4A 2QD9A 3KGAA 4BGHA 1OKVA 5IKWA 1OECA 5CEOA 4E6AA 4EH3A 4DC2A 1R0PA 5HG8A 5IH6A 4DN5A 2WMXA 4YNOA 3TUBA 4FEWA 3N4UA 5AV2A 2CGUA 4AOIA 4HVDA 3HDNA 3NLBA 2B9JA 3OOMA 5DRBA 3VIDA 3DJ7A 5DLSA 4BDDA 5IDPA 3K54A 2G2IA 3LFAA 3QYWA 4JBQA 3VBWA 3UIMA 4D2PA 5JK3A 3ZRMA 4GCJA 3BGZA 1ATPE 4F9BA 4YHTA 2QC6A 2VU3A 5IH5A 4UWYA 4G5PA 4MBLA 3TZMA 3OXIA 4EK8A 2XK4A 5EHLA 4DFBA 3IECA 2OO8X 4IAYA 3NCZA 3VN9A 3G0FA 3PJ2A 1OBGA 3OW3A 3IGOA 4AZWA 3RM7A 4I22A 3ZBFA 4WHZA 2BRBA 4MNEB 5BUJA 4FTLA 5HX8A 4NCTA 5A4TA 2HK5A 4LL0A 2XCKA 4U79A 4V01A 3V6SA 5TOZA 3QKKA 3KEXA 5FRIA 2EB2A 4MXAA 4Z7GA 1PRYA 3OROA 4LMUA 2FSLX 4YPDA 3BKBA 5EK7A 3FKNA 3M1SA 3QQLA 1SVGA 3AD6A 2AUHA 5FP6A 3EQCA 4RX9A 5H8BA 1FPUA 3OF0A 4UN0C 5BQ0A 2V5QA 2W1FA 3EYHA 5H3QA 4TL0A 2NNWB 4FKTA 2VZ6A 4LFIA 4CFUA 3G90X 2RIOA 2JC6A 3ETAA 4S34A 2F2CB 2BIYA 3P5KA 3ZRKA 4C59A 4BTJA 5HTBA 4QMUA 4JI9A 5HZNA 4MAOA 4GG7A 3LFEA 4F65A 5HORA 1NVQA 2ETRA 1W8CA 4QMLA 3PDTA 5FM3A 2VRXA 3R1SA 4FT0A 4AT4A 4JOAA 1J1CA 4LL5A 5FD2A 1OIUA 4Z3VA 4O0UA 3UZPA 3FQSA 5KMLA 2QI8A 5AUWA 2PMLX 3A7GA 4UMQA 5AEPA 5LJJA 2WPAA 3KK8A 3ORZA 4RA5A 4XG2A 2R3NA 3DDQA 3CTJA 2QG7A 3D15A 4B8MA 4NYEA 4HYSA 1ZYCA 4DGGA 1PXKA 2G2HA 3DCVA 5KHXA 3W2PA 3OT3A 5CSPA 3O8UA 3EN7A 4BDIA 3Q5ZA 1E1VA 2WIPA 3AOXA 4NM0A 4NT4A 1OL1A 4ZLYA 3REPA 3PZEA 3HRFA 4DYMA 1YI6A 2A2AA 4L9IA 4QNAA 4FSZA 4L3PA 4WG5A 1SZMA 1ZZ2A 3QQFA 4NCTC 5LVOA 4IX4A 4AG8A 4FV6A 3VS4A 1TKIA 4CZYB 4M68A 2IW8A 2QOQA 3MH0A 3PP0A 2JDSA 4MXZA 3UZRA 2YITA 4QMTA 1U54A 2YIXA 3DK6A 5FQDC 4G1WA 1XBBA 4L43A 2J5EA 4PV0A 4AA0A 4ZY4A 2PHKA 3O50A 4GVAA 2OU7A 2WFYA 4B8LA 3RZBA 5M4FA 3DB8A 3CKWA 5HU3A 5I5ZA 3PY3A 2PVMA 3QWKA 5CENA 1OL7A 3TDVA 2IJMA 5IQHA 5L8JA 3TUCA 2GSFA 4USFA 3AGMA 3CCNA 5CALA 4ZJVA 4FV8A 3SKCA 2VD5A 5L3AA 2GFCA 4B99A 3Q3BA 2AC3A 3ORPA 3QTQA 2O5KA 3EL8A 4XG8A 1JSUA 3K3IA 4LM5A 5IA4A 2VO3A 2ZOQA 2XNBA 4X6RA 4J1RA 1YQJA 4MXYA 5F95A 5HOAA 1E9HA 3O7LD 4HZRA 1YHVA 2Z7SA 5HQ0A 2I7QA 5EI2A 2DYLA 3NUNA 2Z7RA 5HHWA 3BWFA 2GMXA 2YJSA 4YR8A 2ZVAA 1A48A 1BX6A 1GZKA 3FMKA 3QTXA 3R8ZA 2FSOX 3E87A 3QD2B 4J96A 2JDTA 5CU4A 3ZZWA 4DEHA 4KKHA 3MH1A 3KB7A 4BL1A 5HBJA 2W1HA 4BTKA 1PHKA 1Y6AA 4FGRA 2C5OA 4KINA 1XH4A 2JAVA 4Z9LA 2WZJA 5CSHA 4F7JA 4A4XA 2XIYA 4CFMA 5AP5A 3PVUA 5HG7A 5LXMA 2VTJA 4EOOA 5BVEA 2X6EA 1PXLA 3Q4CA 3QTIA 4AW5A 4YMJA 4ZTQA 2FGIA 3GC7A 2B55A 4IVCA 3HV7A 4QNYA 1L3RE 3CQUA 4DEAA 3QTWA 4NJDA 4FV3A 1Q24A 4BYIA 1OL5A 2ITNA 3FKOA 3FLNC 4AF3A 3OCSA 2WOUA 5CS6A 5E4HA 5HTIA 3G15A 1OB3A 3CPCA 4FNYA 3QZFA 3PXRA 4O0WA 5CT7A 3V8TA 4Z7HA 3BYVA 3TZ9A 2UZUE 4QQ5A 3PE1A 3VUMA 4HCUA 4HJOA 5LQFA 2HZ0A 3VJOA 4FE2A 3G33A 4G3GA 2IVVA 4WA9A 4FTAA 4FV2A 5CVGA 4FOCA 3HKOA 3TEIA 2PYWA 1H1SA 3ORXA 2UZWE 3SQQA 3ZLWA 5KBQA 2E9OA 1NA7A 4C4IA 1JNKA 3D7ZA 5A14A 2YHVA 4YZNA 2J6MA 4H1JA 4ZZNA 3UNJA 5TKDA 4KA3A 3AXWA 3ZFYA 1Y8GA 2UW3A 4NK9A 4RJ7A 4BZDA 3COHA 4YZDA 1ZOGA 4G9CA 1H28A 2OZAA 4GJ3A 2EB3A 3KMMA 4TXCA 3AT3A 1WAKA 4JBPA 3IW8A 3MJ1A 5KMOA 2Y7JA 3HMPA 3RNYA 4ALWA 1U46A 2BZIB 4CEGA 1J3HA 2XNOA 2VWVA 3Q9XA 4TKSA 4X2FA 5BX0A 3OP5A 5IA2A 3ANQA 3KXHA 1H25A 4ASEA 5BUEA 3UJGA 2W06A 5IF1A 2ZM4A 5HE2A 4NM3A 1KV2A 2OIBA 3THBA 1OGUA 3Q04A 5JZNA 4PNKA 2DS1A 2J4ZA 5DG5A 2FH9A 3A99A 4OTWA 4WO5A 4EBWA 2WIHA 3TUDA 4EH8A 4IQ6A 5GIPE 4C4JA 4BCQA 2GS6A 4RPVA 2IVTA 2NRUA 2WMRA 3KU2A 2FVDA 3QF9A 4WBOA 5EM8A 3ZXTA 1IAJA 1ZYJA 4C3RA 3I1AA 3R1QA 1YDTE 4G3CA 2UW0A 3QHRA 3R7IA 4IAZA 2PVRA 4DLIA 4I6QA 3I81A 3UC3A 4ALVA 4MBIA 3SX9A 2I6LA 4AW1A 3ZUUA 1VJYA 2H8HA 4A4OA 3RTPA 5C1QB 4IZ5A 4EZ5A 3R8PA 3M2WA 3UOLA 3U6HA 4M67A 5ETCA 2XVDA 1SVEA 3OG7A 4EEVA 1Q3WA 3JVRA 3ZRLA 4IWPA 4GIIA 5JT2A 4S33A 3LFSA 3W18A 4CRLA 4ACGA 4FKIA 2FB8A 4BDKA 4K11A 4MD9E 5F1ZA 2OZAB 3D2IA 3WF5A 4QP2A 3CD3A 1QPDA 5IQCA 4C33A 4HGLA 3UZTA 3L8SA 3UMWA 5EQPA 1PXNA 2WMQA 4R7IA 4IM0A 2GU8A 3NR9A 4X3FB 4QYHA 3W33A 1MRYA 2BCJA 4BYJA 3CJFA 3PY0A 4O27B 2YIWA 3VS5A 4EUTA 4M0YA 1XQZA 4R5SA 4KWPA 4FTRA 3NMUF 3AQVA 2NPQA 3MFRA 4FT9A 3TWJA 4CCBA 3DU8A 4M69A 3LMGA 5FUTA 3ORTA 4GUBA 2IPXA 3PG3A 4PPAA 2Z2WA 4AUAA 4DINA 3QYZA 4G31A 4ANBA 5C27A 2BROA 4CG8A 2XNPA 1PYXA 4RFZA 4E73A 2VX1A 3D83A 2BHHA 2WOTA 3L9MA 2RG5A 4NM7A 5JZJA 5E7RA 5E8XA 3KULA 2BFXA 3KREA 5DHJA 2YDJA 5HE0A 5HE3A 3R30A 4ZSGA 1OPKA 2WQEA 4YO4A 2GCDA 2W9ZB 3BEGA 4MEDA 5A4LA 2OI4X 5BNJA 2CGVA 4QQTA 1ZLTA 5IA0A 3DTCA 1FMOE 1Q99A 2UVXA 4XYFA 3TV6A 2UZTA 3GOPA 2AYPA 2GPHA 2XBAA 3F3ZA 4W9WA 1ZMWA 4M0ZA 3LMIA 5FLFA 1G3NA 2R2PA 3MB7A 2OK1A 4N6ZA 5FXQA 3W2CA 4AX8A 4WBBB 1DS5A 4BKYA 4EOIA 5A4EA 2PWLA 2YAKA 3LCTA 2E9PA 2J0IA 4F1MA 3QC4A 3T8OA 3N9XA 5AP1A 3U9NA
chains in the Genus database with same CATH superfamily
3Q9YA 4WIHA 1JKTA 4M69B 3KCKA 3WIGA 2WQBA 4OBQA 2QLQA 3BLHA 3I79A 4ACHA 4EH4A 4EHZA 4V0GA 1VLRA 1B6CB 3G6HA 4K33A 4EK5A 1FOTA 3DB6A 4FSRA 2HZIA 4RG0A 2W96B 4D4SA 4IZAA 3PFQA 5AV4A 4ITJA 1GIJA 4QPAA 4JG7A 3HRBA 3EKKA 5ETFA 4MBJA 3E3PA 4XCUA 4X2KA 4GT5A 1GOLA 3GC8A 2JKOA 5CXZA 2IW6A 2WELA 4PMPA 5JFSA 1XKKA 5GZ9A 3FKLA 3QCSA 2PZ5A 3HECA 4ID7A 4D1SA 2XNEA 4I6BA 5J7HA 2HXLA 3MSSA 3UTOA 3FQHA 3MY1A 3P0MA 4D2TA 5LCKA 3N51A 4Y5QA 4JDKA 5IQEA 3FMLA 4XRLA 4R1VA 1XMMA 4IM2A 3IGGA 3UO6A 1UU9A 3CS9A 4N4SA 4BY9E 4NL0A 3FC1X 4YBJA 3VS2A 3JY9A 3OFMA 4UBAA 4CYIA 4I41A 4MXXA 4O4FA 3VHKA 1Z9XA 4FODA 1Z57A 3IDPA 4WRSA 2VAGA 5A6OA 4FI1A 4CLJA 2PVYA 3PPZA 4MD7E 4YZBA 2OZOA 3S95A 2J7TA 4X2JA 3VQUA 2ZDUA 2X2MA 5JQ8A 5M4CA 2OLCA 1NY3A 3QUDA 1VYWA 3NW7A 4V0GB 5EDQA 4UMUA 4C38A 5AP3A 4FZAB 2BTRA 3GQIA 3R8MA 1GAGA 1GZOA 3VF9A 1T46A 4F7NA 1MQ4A 5DGZA 1SNUA 4QMXA 5BPYA 5CAPA 5EM5A 3O0GA 4AQCA 4ZZOA 5L8KA 5M08A 2YM7A 2P0CA 3S4QA 3KN5A 1OIRA 2BHEA 4E6QA 5I9WA 4I21A 4F4PA 3F3UA 4PRJA 1F0QA 4UV0A 4IACA 5D1JA 3WIKA 4FTOA 2YIYA 4KAOA 3JR1A 3QRKA 5FTQA 4TN6A 4U97A 3QZIA 2PZIA 4FIGA 4FSYA 2J9MA 3C0GA 2VGPA 4DGMA 1U5QA 1B39A 1J7IA 4HYHA 3ZFMA 1WBPA 3JYAA 3PJCA 4ZY5A 1L8TA 5AMNA 5E1SA 4YLKA 3ZONA 4AGWA 5K4JA 2Z60A 3AC5A 3FSFA 4YC6A 3QRTA 3VUHA 4ACDA 4CXAA 5L2IA 1LUFA 2I0VA 4K1BA 5J9YA 2GQRA 3TIYA 5F20A 1JKSA 2YEXA 2UV2A 3E63A 3Q6UA 5TT7A 1V0BA 4I23A 2W17A 1Q62A 5EW8A 3ULZA 4CG9A 3AT4A 2ZMCA 2BZKB 3A61A 4ZJIA 4BCNA 5C8KA 5EI8A 4F6UA 4ANNA 4RLLA 2WGJA 3ITZA 3AD4A 2C6TA 3G0EA 2WO6A 4FL2A 4A07A 2E2BA 3IDBA 3MVMA 4IAFA 1KSWA 1S9IA 1LR4A 2QO9A 5EH0A 5JEBA 4QDVA 2V7OA 2YM6A 4L6QA 4BFMA 3GCVA 5ANDA 5HLWA 1V0OA 3FY0A 4QMVA 4RWLA 2C3JA 3GU7A 1VR2A 5EYDA 4DH7A 5JH6A 3H9OA 3HV4A 2W1CA 4DT9A 3W8LA 4R7HA 3MPTA 4NU1A 3FI4A 4PX6A 5AP2A 2LGCA 3AC1A 3BEAA 4FV7A 4DHZA 2QHMA 3KMWA 4RX5A 1UWHA 1STCE 5AR3A 4ZIMA 4PQNA 4GSBA 4LRJA 3VBTA 4P7EA 5CF4A 1XJDA 4K6ZA 3SA0A 2FYSA 5BYZA 1PW2A 4G3FA 2I0HA 2ZJWA 3QXOA 4GS6A 3IKAA 4QYGA 5LVLA 4PDPA 3ZYAA 4AN3A 3TT0A 4U41A 1BKXA 4O22A 3TZ8A 3PYYA 4QD6A 1PY5A 2C69A 3EFWA 4DFLA 1MUOA 2XEYA 1KE8A 1ZOHA 1ZZLA 4XV1A 3PA3A 4YSMA 5ANIA 3UVQA 3VF8A 2IWIA 5K5XA 4DE4A 4GK3A 4BHZA 2RFDA 3BYSA 3FL4A 1XR1A 4BDHA 1XBCA 2GTNA 2UZVA 2XK3A 4IBMA 2BKKA 3ZO1A 3RBWA 2JIIA 5IMEA 4G6NA 4FTMA 4YPSA 2WMUA 2P2HA 4RWIA 5KZ0A 1HCLA 4OR5A 1H1RA 1EH4A 5H2UA 4IZYA 4H05A 5EOBA 3U51A 2JFMA 3ZSGA 4O86A 3S2PA 3CJGA 4C62A 4F78A 5IUGA 3OUNB 5J87A 1PYEA 4OTQA 2RFNA 3NUAA 2GHLA 1YW2A 4U80A 2F7EE 4JIAA 4GKHA 1OIQA 4EC9A 3L8XA 3PRIA 2W4KA 3ZS5A 4WUNA 2O3PA 4Y73A 3UDBA 1KE9A 4EK6A 4OAUC 1KOBA 3KKVA 4TY1A 4C4EA 4QMYA 2Y8OA 2WEVA 2QR7A 3FMDA 3HLLA 2UW5A 2OFVA 3PVGA 4O0RA 4AXEA 4HYIA 4TYIA 1CDKA 2HENA 4D2VA 3MFTA 3GT8A 1QPCA 3ODZX 4JAJA 1NT2A 4FZDB 4XG3A 3SAYA 4PL4A 3EJ1A 3ZUVA 1M2PA 1W98A 5BVNA 4RGJA 3ZU7A 4O1PA 3W0NA 3D7TA 1K2PA 3D5VA 4DEEA 3COIA 3VVHA 4FEVA 5DE2A 3IDCA 4C4FA 3IW5A 1M7NA 2IZSA 3EHAA 3E7VA 4JDJA 3W55A 2JIUA 3QRJA 3SLSA 2HWOA 4LOPA 2R3FA 4DAWA 4A9YA 1LP4A 1YXXA 4OTFA 3EQHA 4FL3A 4CT2A 3P86A 3EN6A 4IX5A 3R9OA 4FGBA 5IQIA 4GIHA 5H9BA 2YACA 4UXLA 2C0IA 4FK3A 4RJ5A 4ZZMA 2O63A 2R3JA 3FMMA 2GDOA 4BTMA 3IK3A 3DJ6A 3Q32A 4XLIA 4X2GA 3GENA 5J9ZA 3QZHA 3ROCA 3BU5A 3U4WA 4I93A 1OUKA 5L4QA 2QO7A 3DQWA 3NUYA 1BMKA 3QC9A 4O7WA 4PDYA 2UUEA 3EQPA 5GZ8A 2RL5A 5JFWA 2G01A 3RPVA 2HIWA 3K3JA 4HVSA 2YN8A 3F3TA 3TN8A 1OPJA 4FG9A 2VO6A 3KY2A 4DITA 4NJ3A 3BGQA 4XG9A 4D1ZA 2JITA 2Y9QA 2OJJA 2OXXA 2BUJA 1P4FA 5AR4A 4E4LA 4CT1A 2GTMA 5JGBA 3FV8A 1ZYDA 5KZIA 4FTQA 5DT3A 4H36A 3FQEA 3WILA 3MB6A 4AOJA 3PTGA 3SRVA 1OKYA 4Y72A 5B2LA 3DKCA 4EWQA 5EKNA 3G6GA 3E88A 4FUXA 4L45A 1ZOEA 5KO1A 3C5UA 4NWMA 5E8ZA 4JAIA 5M09A 3MJ2A 4J7BA 3CTHA 4UZDA 4QP1A 2W0JA 3R7VA 3PXZA 3V8WA 3MIYA 4B7TA 5IMXA 3ZLYA 2VWYA 4QYYA 1UNHA 3BCEA 5L6WL 4CMOA 3JY0A 3WYYA 2GQGA 5M55A 4P5QA 4UXQA 2W5HA 2B4SB 2JKMA 3EWHA 5D11A 2PVHA 3VUKA 1U59A 3ENMA 4OT6A 3DKFA 4J71A 5JRSA 1E1XA 5TR6A 3BU3A 4RIYA 3FZSA 4W4XA 3ORLA 2PVJA 4X2NA 2QHNA 1G8SA 3UDTA 3GBZA 5CF5A 3LQ8A 5IA5A 3OY3A 4M66A 4K2RA 5LARA 1YOLA 4OTDA 3RKBA 5D9HA 5M07A 4I0RA 2PE1A 3ZSHA 1BI7A 1J7UA 2XCHA 5CNNA 5IQGA 5JKGA 1X8BA 4LV7A 4K18A 1MP8A 3G5DA 3Q4UA 4FKSA 1XH5A 1V0PA 2BRMA 2H96A 3HUBA 3QQJA 4U45A 3W2SA 4O7NA 4O1OA 3VUIA 3E92A 2W99B 5AWMA 3ZH8A 5HX6A 2Y4PA 4CKJA 5I9VA 2YWPA 3R7GA 1W0XC 3BHTA 3HA6A 3SRVB 3V8SA 4EH6A 4CZUA 4KIKA 4EHGA 2WKMA 5AM7A 2UVZA 4FMQA 3LQ3A 4E4MA 3NUPA 2VTHA 4DTAA 5CU3A 4BCMA 3PFYA 5L8LA 4DH3A 3FLQA 3IW6A 1YHSA 5AUXA 1CKIA 3P08A 1OMWA 5IU2A 5DRDA 2QG5A 1UU3A 3EN9A 4JXFA 5BVWA 4YBKA 3QHWA 2R4BA 2W1GA 3PUPA 1JVPP 2A27A 2X81A 3FZRA 3LJ0A 1FBNA 2BR1A 2XYNA 3VUGA 3VS6A 4RIYB 3BQCA 3OTUA 4F99A 4FEUA 4BIBA 3MS9A 2JDOA 4YO6A 4PMSA 3L9LA 3NUUA 4L68A 5FDXA 2X8IA 4ZK5A 3RPSA 3SVVA 4Y8DA 3UP2A 4H39A 2VTSA 1DAYA 5EW3A 4RIOA 4AACA 3KC3A 4QTEA 5E8TA 1PJKA 4C8BA 3BPRA 4L44A 5BYYA 2CMWA 3KXXA 4HPUE 3HV5A 5KBRA 2UVYA 4FKPA 4GYGA 3V5JA 1BYGA 4EQCA 4CKRA 1VEBA 3NX8A 5A6NA 4S2ZA 2OJIA 3LPBA 4KIKB 4LGHA 2W4JA 3QQHA 4EYJA 3TJCA 5DN3A 3SGCA 3MTLA 5JRQA 5B7VA 2ITXA 5EM6A 4GU9A 4D9TA 5IUIA 3OBGA 3MVJA 2QOFA 4BCGA 1H1WA 1YI3A 2CCIA 2BRHA 4AP7A 4KKEA 4G9RA 4J53A 4QYEA 4XJ0A 3DQXA 3ZEPA 4IDVA 5AAFA 4C57A 5DOSA 2DUVA 4KSQA 4FSQA 3AC3A 3UGCA 2QNJA 4FOBA 1J1BA 2W9FB 3TKIA 3H9FA 4L7FA 2WTKB 3AC4A 3PA5A 1H07A 4MD8E 4DDGA 4O83A 3ORMA 4JG6A 3SXFA 3GC9A 4HGSA 2XK7A 3MA3A 3ERKA 4FIJA 4XG6A 3KK9A 4RT7A 4U43A 4YZ9A 1ZYLA 5L2WA 5TF9A 2EXMA 4FEQA 1Y57A 3QQKA 2WTKC 2VTAA 2W1ZA 3FSKA 3BYOA 3WF7A 1YOMA 2O64A 4M12A 3V04A 4APCA 2OKRA 3F88A 3A7FA 2BRNA 4RQKA 5CEKA 5HU9A 4ZTSA 5GHVA 5AUTA 2QKWB 1WBSA 3CP9A 3Q9WA 1Q61A 1JQHA 2ZB0A 4BB4A 5CYIA 3GCUA 4EOMA 4S30A 3S0OA 4B6LA 4BDGA 3KXZA 3LXKA 1BLXA 5AA8A 3CPBA 4G34A 3SG8A 4YTFA 3AMBA 3LQ5A 1WBTA 3E64A 2ETMA 3SC1A 4RIWA 3MFUA 5M06A 5IQAA 4P90A 1QL6A 4JMQA 4XBRA 3WBLA 5CT0A 4RIXA 4M3QA 3R1YA 4IX6A 2HW7A 1G5SA 5ACBC 3RI1A 4CQEA 1GNGA 2WU6A 1ZARA 3BLRA 4H1MA 5E8UA 4LG4A 2PUPA 3C50A 3GU5A 3VBVA 2EU9A 3H0YA 3MVHA 3OC1A 4GVJA 3A2CA 3QTZA 2CNUA 2XJ1A 4EI4A 4QPMA 4C3FA 3UIXA 4Q5HA 2IZUA 3PVWA 4YJQA 2WTDA 3I0OA 3DBDA 2WTVA 4J52A 3RAIA 3GVUA 5DWRA 4HVHA 3HEGA 2I0EA 2ERKA 2GNFA 3NUSA 2BKZA 5AAEA 4FZ7A 4HYUA 4G17A 3RVGA 2X7OA 2WTJA 3MYGA 4KRDA 3UO4A 4C36A 4BZNA 4PWNA 2HOGA 5J5SA 5CU2A 1YWRA 3RCDA 2G15A 3S00A 2IVUA 3BYMA 5HKMA 4DLJA 3P78A 4FC0A 5EQEA 3EN4A 5KX8A 4DHIB 3D4QA 1WVYA 2QOIA 4OGRA 4BF2A 4IHPA 2PZPA 3TNWA 3E8DA 4LV8A 3DLZA 3OHTA 3FLWA 5AUYA 3TNIA 4GK4A 2HWPA 3FYJX 5EFQA 5AP6A 2WD1A 4F9WA 3UNKA 4FV9A 1U54B 5GJFA 4RQVA 4RIXB 1CKPA 1RE8A 4TWNA 4EH5A 3OEFX 4QMQA 3VULA 3D14A 2YCQA 4F9CA 2OGVA 2R0UA 4OT5A 5HO6A 4AGUA 4JDHA 4FJVA 3NYVA 2W05A 5DH3A 5ANGA 3TNPC 2WNTA 1ZXEA 4FKGA 5BUIA 3EFKA 5HICA 3SW4A 4BVUA 4EWHA 2C5VA 2XIXA 2Z7QA 2B54A 3RCJA 2IW9A 5ANOA 4AZTA 4IJPA 5E8SA 1UU8A 3OMVA 4J97A 3H10A 3IPHA 3OBJA 5KUPA 3R21A 4H3PA 4ASXA 4O7VA 3LFDA 2ITWA 1JKLA 3F7ZA 3I7CA 4NM5A 3FZ1A 4GYIA 2ZM3A 3ZM9A 1AGWA 5EDPA 4IAKA 5BVDA 2V55A 4UYAA 5KNJA 4O7SA 3CR0A 3HYHA 2XYUA 4EOSA 1Q8TA 5M56A 4V04A 1YWVA 4P4CA 2EVAA 3LCSA 2YERA 4IWDA 4WD5A 4IB5A 1R3CA 1TQIA 2XA4A 4I4EA 4R3PA 3II5A 1T45A 5CZIA 3KXNA 3O8TA 2BFYA 4NFMA 1MRVA 1Q8ZA 3ENHA 3ACJA 4FSWA 5D10A 2YM3A 1ZY4A 4ANLA 2HY0A 5C4LA 4NIFA 4OTIA 4KIQA 3UQGA 4XP0A 2I0YA 3NRMA 3CTQA 1Y8YA 3RNIA 3HZTA 3VC4A 3TNQB 3QD3A 5LWNA 5CF6A 3QQUA 2C1AA 4KABA 4FV0A 4A06A 1UNGA 4JIKA 4BDBA 4NW6A 1WBOA 4MK0A 2XIKA 3DTWA 4U3ZA 1PMVA 2H9VA 1CTPE 4YTIA 4WT6A 4ZTRA 3OW4A 2OG8A 3ZCLA 4GL9A 4O6LA 4C35A 4BBFA 3BX5A 2YZLA 3FI8A 1DAWA 4YJTA 4IB3A 4BR3A 2RFSA 1J7LA 4ZSAA 2CGXA 2ITQA 4L01A 1H4LA 1H00A 1IG1A 4MQ1A 4LMNA 3WI6A 5LMKC 2JAMA 4TNBA 4LOOA 5LOHA 4DTBA 3AT2A 2V7AA 4NTSA 1PXOA 2I1MA 3E3BX 3NVMB 2VTTA 4L3LA 1IRKA 2UW6A 4BKZA 3BRBA 1O6KA 3PUFC 5K0XA 2R3GA 1U5RA 4QRCA 2HCKA 3DFAA 3W0RA 4GV1A 4J99A 2HW6A 3UYSA 2R3QA 3HVCA 5CU6A 2CDZA 4O0VA 5CEMA 3SW7A 1W7HA 3KVWA 1RDQE 4LGDA 4XV9A 4FNWA 4BCFA 3ORKA 4AGDA 4IIRA 2CJMA 4XBUA 2ONLA 4HGEA 3A8XA 4NIFB 4ORKA 5HO7A 3U6JA 1OL2A 3F5XA 4KNBA 4UALA 3W2RA 3V5LA 1HOWA 3C0HA 4MCVA 4DFZE 3DNDA 2F2UA 3O8PA 3FXWA 1MQBA 2JBPA 3UE4A 3Q2MA 3QUEA 5EQYA 3HDMA 3P5JC 3F6XA 2CLXA 3R1NA 2R9SA 3CQWA 3ZDUA 5HNBA 4Y5HA 3KVXA 4KS8A 3TIZA 2XF0A 5I4NA 4M84A 4YC3A 2QURA 4XOYA 3NFFB 3QRUA 2ZDTA 3QGWA 4TW9A 3RWQA 4A7CA 3D5UA 4NTTA 5B2MA 4CQGA 4Q9ZA 1Q4LA 4FX3A 4LOQA 3RK7A 2Q0BA 2F7XE 2RGPA 3OUKA 4QP6A 4AA5A 3O7LB 4AZFA 4QP3A 2C6OA 3NAXA 4G6LA 3TJDA 4AXAA 4H3QA 2X7FA 4GJ2A 4ASDA 4JX3A 3GFEA 4FIHA 5AV3A 2ZV7A 3LOKA 3IW4A 5HIBA 4UB7A 4USDA 4YLLA 5EI6A 3VO3A 3PXQA 1IEPA 3BLQA 4QT1A 3KXMA 1Z5MA 3MTFA 4EL9A 3AKKA 3FDNA 4IAIA 2GFSA 2C4GA 4E7WA 4AS0A 1ZWSA 3TZ7A 1F3MC 4IADA 5AUZA 5ANKA 5F4NA 4RLKA 3FI2A 5CAQA 5LMAA 2W5BA 3PSDA 1P4OA 3MVLA 5FTGA 3V6RA 4M13A 3ZDIA 4JLCA 4D4VA 3MW1A 2PTKA 3CD8A 3TL8A 4OUCA 3WF9A 2B1PA 1A06A 4M14A 4DGLC 4YURA 2H34A 4BGQA 4HVIA 4E6DA 2F57A 4WNPA 4O7YA 4C2WA 2X2LA 2YM5A 1W84A 2ONLC 2WTIA 4QMNA 3OWJA 4FT5A 4QMSA 5DA3A 2YDIA 5EHYA 1YOJA 3RAHA 5IEXA 3ACKA 3FLYA 4XV2A 4DG0E 2OWBA 3QX4A 3CE3A 3LJ1A 1YWNA 4GT3A 4HPTE 3OWKA 2R64A 4PTEA 5E92A 4EQMA 4ZP5A 5J79A 4PMTA 2C3KA 2QOHA 2RKUA 2YCSA 1YVJA 3UBDA 4U42A 4U81A 3ZEWA 2WMBA 4IWQA 4I6FA 4KRCA 3KULB 2X4FA 4BDEA 1QMZA 4KUJA 3DKGA 4I0TA 2G2FA 4Q9SA 4TPTA 4FIEA 3HMMA 5A4QA 2ETKA 3CGOA 1OGYA 1URCA 2YDKA 1OVEA 3BI6A 3K2LA 3NZ0A 3R7EA 4EH9A 3C5IA 4W4WA 4BGGA 4YLJA 5CSXA 5H8GA 4RC3A 4LRKA 4OW8A 5CY3A 3U8WA 5EHOA 5CQUA 4AXFA 1CKJA 1SM2A 4IE9A 4LI5A 4HCTA 3BHHA 3VBXA 1PMUA 3BWJA 1W82A 3TTIA 1UNLA 3OCGA 4BIDA 2BRGA 4FKQA 5M57A 3E8EA 3HMNA 4FVQA 3MY0A 3FMHA 1XMLA 5AM6A 3JXWA 3KQ7A 3F82A 4JQ8A 4NKAA 5IEYA 3QUPA 4F9AA 3NEWA 3LM0A 4YUQA 1ST4A 4WUAA 4EZ7A 3NSZA 4TWOA 4TNDA 5DR2A 3LIJA 3RPRA 3O2MA 3Q6WA 3VW6A 1H27A 2OJ9A 3BE2A 3D94A 2OFUA 1O6LA 4KKGA 4ACMA 4N57A 3QAME 4ZLZA 4QMOA 3B2WA 4IFCA 3FEGA 5IQBA 3DZQA 3L9PA 3QA0A 3ZC6A 4AW0A 3E5AA 3FC2A 3VBQA 3CSVA 3VS0A 3ZHPC 2ITZA 3Q9ZA 3SV0A 4YHFA 3C1XA 4L8MA 4AAAA 3R7OA 4C58A 3FLSA 4PP9A 2PE2A 4QTDA 4A9RA 4A9SA 4NKSA 4HZSA 3RINA 2RG6A 3R04A 3MI9A 4TWPA 3PLAE 2FSMX 4IJ9A 4I24A 2VV9A 4I3ZA 4MX9A 2OXYA 3FLZA 3MDYA 3F66A 1OZ1A 4RFMA 4RVLA 5CI7A 3U6IA 4EK4A 2YZAA 1KV1A 4FNZA 4QQCA 4E5BA 4HW7A 2UZOA 2ZYBA 3DS6A 2X9EA 2X0OA 3I7BA 1FGKA 4ONAA 4XH6A 2PMNX 2R3KA 4ZS0A 4BDJA 3QTUA 3CQEA 3WF6A 3HUCA 3VS7A 4L46A 4BICA 4ZS4A 1Y91A 2ERZE 4QYFA 5L2QA 3TKUA 1W83A 4JVGA 2JLDA 3NW6A 5AV0A 5E1EA 4EORA 2BMCA 5L6PA 3OVVA 1RQQA 3K5UA 4MF1A 3F69A 2XK9A 4FG8A 4EJNA 2XNNA 3FAAA 1R1WA 2OJFE 5AA9A 5AUUA 5IQDA 4MYGA 3DXPA 1XH7A 5HCYA 2UZBA 3JS2A 4H58A 4GU6A 4YJRA 1UKIA 2J90A 4IAAA 1ZAOA 4FYOA 5ICPA 4EONA 3VRZA 2XS0A 4TRLA 3ZUTA 4R3CA 3WARA 1HCKA 3RHXA 4O0SA 5EDRA 4IC7A 5L2SA 3G51A 5JGAA 3KXGA 4WRGA 1XHAA 5FBNC 1OUYA 2W4OA 2XKEA 3EQBA 4AN2A 4GEOA 1G8AA 4LQMA 4OTHA 3A4OX 3IOPA 3LFFA 5FG8A 2GNGA 3DJ5A 3IOKA 3IQ7A 3TV7A 1TVOA 4TT7A 3ALNA 4ZTLA 5GZAA 5I0BA 4L42A 3PIXA 2RFEA 2PY3A 3H0ZA 4H3BA 5A46A 4FSNA 4Y85A 4DGNA 2GQSA 2C6IA 2VTNA 2ITYA 3HRCA 5D7VA 2C5NA 1PXJA 4XG7A 5AR8A 4EUUA 3COMA 4BI1A 3OY1A 1YRPA 4N0SA 3UP7A 3POOA 3LMHA 2XM9A 3GC0A 4FV4A 3AG9A 4BDFA 2BALA 2JGZA 4F09A 2Z7LA 3CC6A 4O0TA 3T9IA 1M14A 4FIFA 5HE1A 3VWAA 4D4YA 4DFXE 4F63A 2R3HA 4DFUA 2BZJA 5D12A 2R7IA 3DZOA 3DBFA 1XH9A 3F3WA 1Q97A 5DYJA 2XK8A 3NIZA 1AQ1A 5FEDA 4UMRA 5EM7A 3S1HA 3FBVA 1G8KA 3UG1A 5HD4A 2C6KA 4CSVA 3ID6C 5I3RA 5I9ZA 5FGKA 5FTOA 5DT4A 2PE0A 3LXPA 3RHKA 1OM1A 1WBNA 4FK6A 1ZMUA 3TYKA 4ANQA 3C51A 3PWDA 3TXOA 3ZMMA 3NWWA 3KL8A 1SMHA 2HYYA 1P5EA 3RP9A 4YJVA 3PJ8A 4FF8A 5ETAA 2EXEA 1OKZA 2YLFA 2WMVA 3ALOA 1M2QA 3LCOA 5HTCA 3E62A 4U44A 4FTCA 5F94A 2VNWA 4TTHB 1IA9A 3E7OA 5J9LA 4Z16A 1NXKA 4DTKA 4PPCA 4CV9A 2VN9A 5CSWA 3KFAA 4GK2A 3W16A 2GHMA 3P4KA 4I4FA 3VAPA 3O23A 5C4KA 4DEIA 4ZEGA 4YC8A 2ACXA 1KE7A 3A7HA 4IFGA 4IC8A 4ZMFA 3NPCA 3T9TA 5AADA 2AEGA 5AIKA 4UX9A 1IA8A 5JSMA 2PUNA 4IEBA 4S31A 3GUBA 2PPQA 5J7BA 2WU7A 3O5AA 2EUFB 3DOGA 3LCDA 3E8CA 4MTAA 2JDRA 4O6EA 4AE6A 3NNUA 4QP8A 2QCSA 4HNFA 3BU6A 3H3CA 3R7UA 4E4NA 3W0PA 2GS7A 1NVRA 3ET7A 2PMOX 3P23A 3PA4A 1ZYSA 2I40A 1ZMVA 2PSQA 4Q5EA 3I60A 4XS2A 5HESA 4EOLA 4APPA 2C6LA 4MH7A 3I0QA 1UWJA 3ZTXA 4BCIA 2XIZA 1GZ8A 1JKKA 3UVPA 3UOJA 5KMIA 2NRYA 4OTPA 4QEBA 4E26A 4MNFA 4X6QC 3V3VA 3KIOC 3GXLA 3UVRA 3OOGA 3QCYA 2R0IA 4KIOA 5IUHA 4C0TA 1FVTA 4QMMA 2ITTA 2BDWA 3Q52A 2W1EA 2XARA 5G6VA 4WNOA 3PXYA 4CFVA 1XH8A 2OSCA 4G16A 2JD5A 4MVFA 4QTCA 4R3RA 3D7TB 2OICA 4RRVA 5HNIX 3NW5A 4F6SA 1J91A 4ANMA 2CNQA 2QO2A 3MA6A 3P7AA 2E9NA 2QODA 3QQGA 2CCHA 4I0SA 4LUEA 3W1FA 3SXRA 3WZJA 4ANSA 4C02A 4E8AA 3OS3A 3R9DA 4F1TA 3TCPA 3NYNA 4IB1A 1WCCA 3D2KA 5K9IA 4DEBA 3WZDA 4CZTA 4R77A 4PL5A 4FKWA 4YGAA 3DXQA 1BUHA 2O65A 5CAVA 4YHJA 4I92A 4C4HA 3KN6A 2KULA 4RWJA 2QU5A 3DT1A 3HX4A 2VWIA 1VZOA 3OXZA 4X7QA 5EYMA 1JWHA 2C6DA 4E20A 1H26A 4JS8A 4D2SA 3CY3A 1JOWB 1YKRA 2QR8A 3LW0A 3VUDA 4CLIA 3F3VA 4JG8A 5LWMA 4BCPA 3BV3A 4L52A 2R5TA 2JBOA 4XHKB 4OTRA 2XBJA 1XBAA 4DA5A 2X0GA 2BDFA 4BCHA 2V22A 4E1ZA 2B9HA 2EXCX 4CFFA 3ORNA 3LZBA 4RC4A 4DBXA 5CAOA 1WVXA 3LLTA 2B7AA 4AGCA 4O4DA 4B4LA 3B8QA 4MWIA 3R01A 3ATTA 2CKQA 1PKGA 3VRYA 2CNVA 3F5GA 3EQRA 5KHWA 4YJPA 5JN2A 2BTSA 4FRFA 4CV8A 2WQMA 2YIRA 2X2KA 3FHIA 5J1VA 5TO8A 3DXNA 3PPJA 3WYXA 1CMKE 4AZEA 4UY9A 2VX0A 2PUIA 4FKUA 5ACKA 3NFGB 4JBOA 4CNHA 2A19B 3C13A 1TZDA 2VO0A 5J8IA 4F64A 2CHLA 2XAOA 3EFJA 4YSJA 2Y4IC 4R1YA 1ST0A 4D0WA 5BVKA 2UZEA 3GCSA 5AP0A 3HAMA 2R3OA 4MNEA 2BDJA 3FMNA 2VWZA 3NCGA 4WNMA 3FZOA 4Q2AA 5ANEA 3N4TA 3Q53A 2ZB1A 5JQ5A 3DAJA 2OW3A 5FXRA 3R6XA 4EHVA 4CCUA 2QKRA 3COKA 4JL9A 4YZMA 3ZO3A 3EMGA 5GINE 2XJ2A 4OBOA 4DBNA 4AAYA 5E8VA 4CMUA 2AQXA 4PUZA 4E4XA 4I94A 2ZV2A 4CFWA 5AFVA 3R28A 3Q4TA 4XG4A 2PVKA 3I4BA 3NNXA 5FM2A 4F7LA 4UMTA 4JRVA 2PU8A 3ZOSA 1WMKA