5ETPA

E. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.05 angstrom resolution
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
AMTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 46
structure length 160
sequence length 160
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5etpA00
1G4CA 3HSGA 3ILIA 1TMMA 5ETMA 5ETSA 1F9HA 1RAOA 3ILOA 5ETPA 1TMJA 5ETVA 1DY3A 4M5KA 1RU2A 3UD5A 3HSDA 3MCOA 3QBCA 4M5MA 5ETLA 3ILLA 2F63A 2BMBA 3HSJA 4PZVA 5ETTA 1CBKA 4CRJA 3KUHA 1RU1A 3HT0A 3KUEA 1EQ0A 3HSZA 4F7VA 1IM6A 5ETOA 5ETKA 1KBRA 4CYUA 1Q0NA 4AD6A 1RB0A 5ETRA 3UDVA 3MCNA 3MCMA 1HQ2A 3KUGA 4CYUB 3ILJA 2CG8A 4M5LA 5ETNA 3IP0A 2QX0A 4M5NA 4CWBA 1EQMA 2F65A 1EX8A 4M5IA 4M5GA 4M5HA 1HKAA 5ETQA 3UDEA 3HD1A 4M5JA 3HD2A 1RTZA 3HCXA
chains in the Genus database with same CATH superfamily
2BM0A 1OYEA 1EIYB 4DS5A 3R27A 2RUGA 1LW0A 3I9V9 4J9RA 4JUZA 2DR9A 2WBMA 2D74B 4K4YA 3CDAA 3CJSA 1DBDA 2RS8A 1WC4A 2Y1IA 2DEIA 5FDLA 3V81A 4Y00A 2GQQA 4DV6F 4FDFA 1N32F 3AAWB 1YJVA 4EZ6A 3K5PA 3D6TB 3HD1A 3QLHB 5GAEU 4DR6F 1P9YA 3CGIA 2EI5A 2R7QA 1AZSA 1B7FA 5ETOA 2IAJB 1KKHA 1YBUA 4DV2F 2QSFA 5IT9Y 4A4JA 3H4BA 4PXCA 3DKDA 4YP3A 1SVDA 3CCTA 3OTOF 3KLVA 4I64A 2EFOA 2QYGA 1HWJA 4NCGA 3W9HA 1NJZA 4OZ3A 3D3BJ 3M6UA 2V67A 4ZK7M 4I1TA 2DYAA 2BABA 2F9DA 2D1CA 1PAEX 2PDAA 1N5YB 3IS9A 5KG6A 2DRDA 2KO1A 2XMWA 3LTOA 5ETMA 5IFMA 1PSDA 4LF4F 3MM6B 1RTIB 1WKJA 4QIVA 4ILMA 2CJBA 1VCTA 3HFZB 1Q0NA 4ALZA 2CPHA 4LF9J 1GMWD 5BJRA 4DR7J 4F4KA 5B0FA 2VQEJ 2VC0A 1QY7A 3QGHA 4U67Q 2HBYB 3OHBA 4QWBA 5D3GB 1R6YA 2CG8A 2WZ1A 4PUOB 3NLCA 4I4BA 3TX0A 4ECQA 5D4PA 2ZVIA 4IKAA 2FHKA 2ROEA 1TKZB 1TL3B 1CPZA 3D4JA 3ZTPA 2IVMA 1NU4A 3BS9A 2R4FA 2IC3B 2HIQA 4RUHA 1PJ6A 3TQ1A 1DARA 2ZBQA 2CKWA 3IAM9 4QIFA 3KOAA 3N0VA 4Q2MA 5CYMA 4LSZB 4LF6F 2ZD1A 3PJWA 1ZTTA 3ZXWA 1TVRB 1S12A 4JB8B 2B51A 2ZBIA 4B08A 1D9DA 2BE2B 5E3QA 4K4WA 3H2VE 1M5PC 1L3KA 4U8YA 2DHAA 4ATNA 3HHKA 3MR3A 5D4NA 3OR1A 1C1CB 3PHTA 4Z7CA 2IVYA 2DCUB 3H2LA 3IBFB 1SJRA 2BE9B 5A8RB 2X1AA 2C2EA 4WYWA 3GMGA 4K59A 2AGPA 1HI1A 3CC7S 2BQ3A 3W1YC 4A8WA 3M9NB 4M5DB 1ZETA 4LF8J 2XWXA 2QMWA 5KG3A 1S57A 1UW4A 3OSPA 1SKWA 4CNZA 4ZP8A 1UWBA 2P9GA 4FYVB 1WACA 3V4MA 1UVJA 3UFCX 5BYQA 4OI6A 1VISA 2MZQA 3B4MA 2LQ5A 1PBUA 1ZAWA 5A0YA 4RW8B 2OKQA 2ASJA 1FRLA 3OL7A 4ZJOA 1R8BA 2GAGC 3V6DB 3KG0A 4I0WA 1RT6A 3OJUA 4IFVA 2EK6A 2CQ4A 3MMAB 4PRFA 4JV1A 3E8OA 3CCVS 2IMWP 1Z1ZA 1WOOA 2HGNA 5GAGU 4DLGA 1KVJA 1M1KT 1M0SA 3FMBA 4F4WA 5D78A 2XYPB 4DUZJ 2EC2A 4QCLA 4K5SA 1WC3A 1F0XA 5HMYA 1KNZA 3NGTA 2HWTA 2CNKB 2ATLA 8ATCB 2L3MA 4YOEA 2N3OA 3VGSA 2PC6A 3HDSA 2POKA 3IN5A 1PGZA 2ZHAA 2YQ1A 2IHR1 1UMJA 1J5EJ 2OD4A 4ENOA 1YRUA 4CTAA 1MW7A 3Q2SC 1SXLA 3MAAB 3OXFA 4ZOSA 2M2BA 3LF0A 3OXGA 4JP8A 3CJ3A 1OQ6A 4JOUA 4RNOA 2AGOA 5HROA 4H4OB 2IM3A 3GR1A 1WOSA 2LVWA 1SJFA 1B64A 1WD6A 1ZA2B 3HVTA 3JXOA 2RU9A 3DU5A 4B9MA 5KFIA 5HL7Q 5KFUA 2ZH5A 2Z2YB 4USMA 4C8OA 4PR6A 2XI2A 3ELHA 2ZZMA 3DOKB 4DR7F 2E7VA 1N6QB 4MYUA 1XR7A 2LFVA 2XZTB 3TYTA 4ERDA 2PFDA 3BREA 2VQEF 3PVXA 4M5NA 1SPBP 1EX8A 3TAMA 3J7AN 2WONB 4LBIA 1JMTA 2AIRB 3QWUA 2C22A 3ILLA 2YXLA 3M6XA 2CUYA 3HSZA 1K1SA 2VG6B 2RRBA 3KMSA 2XY7A 1EQMA 3G2XA 1HKAA 1WG5A 4LR7A 1MMDA 1OMSA 1UEVA 3TA0A 3LP2B 2FVPA 3SIPB 5HP1B 2Q79A 2ROPA 3DOMA 3OQ2A 1D9FA 2O1PA 1RKIA 2HQDA 3GG1A 5BYRA 4G1QA 3VGVA 2W24A 1XK8A 5L1JA 2GIQA 3RRHA 1RHMB 2V69A 2VH7A 4LR9A 5SUHA 1QJHA 3DXSX 3W63A 4EGLA 4BC7A 2Q3PA 1AW0A 4RUBA 3R97A 5H9EJ 4DJBA 1BWVA 4UOFA 3R6GB 3PFEA 4X62J 2VHGA 1ICEB 4G1IA 4CWBA 1LWCB 4DL4A 2F65A 5L9XA 5RUBA 4URSA 5JVHQ 3ETOA 3MM9B 2I5JB 4LF8F 1NJWA 1LNQA 2IAJA 4HVZA 2QJ3A 3S01A 4B9TA 1C4AA 4K4UA 2XS2A 1ITPA 5ETVA 1K0VA 3MCOA 3BJYA 4NXNJ 1TKDA 3PO4A 4MH8A 4P2MA 4OQJA 3QZ7A 2P9CA 3W65A 4CO4A 4GRSA 1NJIT 2XGQA 4DPUA 2HZVA 4KGMA 3BQ1A 3GIMA 3HSJA 4HT5A 2LLZA 2V4QA 1HD1A 1N5YA 5CCLA 1HMVB 3BBFA 1FDNA 3IO1A 3NXZA 2ZWOA 3H59A 2VKRA 1U47A 1VBKA 2V5HG 4MIAA 3DXBA 3MM6A 4KYZA 1RTIA 1RAJA 1U25A 4JYAJ 4DUZF 4M95A 1S0OA 2D9PA 3KFWX 3MM8B 2VD3A 3AJDA 5KT6A 1HA1A 2YWFA 2C3PA 4IH6A 1J5EF 3ONQA 1NKCA 1PC4A 4X4TA 4DV1J 5D3GA 1FERA 1VYAA 4AXJA 4NLXA 2E5LJ 4W98A 1TKZA 1TL3A 5KFYA 1RAGB 2K7KA 2CNLB 2WB4A 5K8OA 1VQ8S 2XNRA 2IC3A 3A8KA 3HJVA 3LP0B 2DB1A 2C2KB 5KFOA 3T1HJ 4YMEA 1VI7A 1VIOA 2V4RA 4WFBQ 3UE2A 1KEKA 5KG7A 3GJQB 1SC1B 3NWGA 1JLGB 4I6YA 4LJMA 1TVRA 1NUEA 4NOHA 3DI6B 3TVZA 3WX8A 3VAFA 3UVJA 5EHHA 1PJ5A 4DQRA 2MY8A 1C1CA 2XI3A 4YB7A 2VPXB 3FSIA 2XS5A 3GFYA 2HLTA 1WF1A 5A8RA 4LQ9A 3RBZA 2FLPA 3G71S 3DLBA 2Z2LA 2Z4PA 2OP5A 1YJTA 1AA1B 2UXBJ 4DQSA 1LKZA 3RZAA 2J0XA 1I51B 2QA1A 3RTVA 1FXDA 4F4AA 1RYSA 2VUGA 3MMBB 4DUTA 1QM9A 5KFBA 3R2DJ 2IJNA 1NZ8A 2JWNA 2MEWA 3A12A 1YI2S 2JL9A 2BZ2A 1FWPA 4I67A 2FHJD 4TYAA 2HFUA 3ET6B 4RW8A 2V8HA 1HWUA 1UWAA 4HEA9 4LIRA 3KLHB 2MSSA 3IR6B 4OHYA 5CAAA 3V6DA 4YS2A 1ZZNA 4BDPA 3EDRB 3KHRA 3D6FB 4ECYA 3MMAA 1ZM3A 3HKZD 3QFHA 4D3GA 2HYIB 2XY6A 3EXCX 5JMNA 2RSQA 5L46A 1TK0A 2AWZA 1S97A 4DL3A 2O5DA 3CCLS 3MPWA 1WWHA 1J2VA 4B3OB 4NXNF 1Z2ZA 2DNZA 3QRRA 1JWWA 1A9NB 5DZ6A 2IDLA 1BQNB 3ZO7A 1Q81T 2G1HA 3KHGA 4DDFA 4IYQA 4FKXA 4R0JA 4EMDA 1BLUA 2IBOA 3PR4A 2QZ8A 3HPOA 2VF3A 3FVYA 4H4OA 3Q24A 1ZYQA 1NK8A 2CG4A 4KFBB 1RK8A 3H5UA 2DR6A 3I96A 2QE5A 3V6HA 1R8HA 3OTBA 3R8YA 3DRRA 4DF8A 3UDVA 4QR0A 3RRKA 2R7WA 4ZCMA 2MMYA 5K8MA 3JTOA 2D41A 2F8EX 4NMXA 3OW2R 3DOKA 1B0VA 1JK9B 2GQ2A 4WP8A 4ECXA 2ACYA 2AJ1A 1D8YA 3G82B 1D0EA 3BN7A 3K2YA 1EAYC 4DV1F 4WU2A 1XEZA 1X0PA 1N34J 2V2QA 1VRQC 3TWZA 1FK9B 2A6MA 2P5VA 2VG6A 3MF5A 2E5LF 1YG0A 3PDNA 1FD2A 2VFVA 2EG1A 3LP2A 3LA0A 4DZDA 3Q86A 5HP1A 2DGWA 3LW5C 2HVZA 3T1HF 1JLCB 2VFSA 3MURP 3G86A 4LSNB 2FVRA 3RB0A 4P52A 4PAAA 4LRBA 1LK7A 2R2UA 3RB6A 2FJEB 2L9WA 5T7LB 4Z37A 1FE0A 4OZ1A 4PEOA 2D9OA 1CS4B 2NYIA 3THTA 5J1PA 3LGNA 1KQGB 2CQCA 4RNNA 5F8NA 1VQYA 3HCXA 2W01A 1P8GA 4QIEA 2UXDF 3OUYB 2A10A 1N33J 2O66A 1URNA 2GQCA 2GMHA 1JLEB 1EETB 3MOJB 1PG5B 2AHOB 1LWCA 1S1WB 3ZC4A 1KOOA 4MIWA 3HZGA 1S6UA 3R9LA 2OD6A 3MM9A 5M2PA 2HVHA 4IR9A 2I5JA 4ETZA 2H65B 1FRXA 2CNNB 4GKKJ 2BJ8A 4YR0A 1RAEB 2DNKA 4PWUA 3GP9A 2YNFA 2VZ9A 3E2EA 1P6TA 1PYSB 3WZ0A 5B0CA 2AKWB 4DUYJ 3HMJG 3CTRA 1CSJA 3GE9A 3ZZZA 3I32A 3MFIA 2Z58B 4I2QB 4WJBA 2J0WA 3PKYA 2VC1A 1IKWB 4NLSA 1X9WA 2W4DA 4YUDA 1YJWS 3M8ZA 4TLRA 2HHVA 3HT3A 3BO2A 2DNPA 3E01B 2KYZA 2DNRA 1CJTB 1M5HA 1QD1A 3H7HB 1GK8A 2NXUA 1S79A 1N56A 2AP6A 3PYDA 4WIQA 1DTTB 1U24A 2ZFHA 1TAQA 3I5BA 5G4DA 3G6ES 3MM8A 2ILYA 1C1BB 4EWTA 1KQSR 3LAKA 1N4LA 2OI2A 3CVKA 1Q95G 4ZN1A 5LJ3Y 2H9ZA 3EZ5A 1Y11A 2G1DA 2ZDOA 1L3UA 2V9WA 3EM1A 2W2OP 3J80U 1X4AA 3SDEB 4MK8A 3K58A 1YK9A 5HVGA 5KFCA 4L3KA 1HWKA 1XN9A 2RU3A 1RUSA 1NHVA 2ZNZA 3MEEB 4EYHB 2C2ZB 4A47A 4FYDA 1KN6A 4E98A 3LP0A 2ZH4A 2BE7D 2QA4S 5CZXA 4NLYA 2ZOGA 3CNQP 1JLGA 2CQ1A 1SC3B 4AFFA 4TYBA 2X1BA 4OJ1A 2ZHBA 1SC6A 4DX5A 1FI4A 4ETXA 2IRUA 4CYUB 1UAWA 3LUYA 2DGUA 2DO0A 1OY9A 3IBWA 5IC4B 4KSEB 1BMQB 4DV3J 3FGVA 1N54B 5EX0A 2IM2A 5E3RA 1XTZA 3SQGB 4LREA 1HI8A 4OV1A 4OV6A 3WBZA 2DHGA 3GYGA 1DQ8A 3G9CA 2ZDPA 2ZM6J 4J9MA 1VK8A 4I7FB 1SL1A 1XMBA 4EO6A 4ZLJA 5E33A 1EKSA 2EPIA 2ZEJA 2JC1A 2RHSB 3LAMA 3QT8A 4OLOA 3MR5A 2OPPB 4N41A 4HHJA 5DLGA 2H4WB 2L9NA 2V8DA 5C42B 4OFZA 3MMBA 4MKYA 1TV6B 1IM6A 1WEXA 3ZNUA 4K4TA 2QLFB 5CD4H 1S76D 3GYXB 5IWAJ 2VOPA 2UVWA 4J9VA 1U1QA 3GSDA 2EW9A 2JEGA 3KLHA 1U6FA 2EWHA 3EGNA 5CYQB 1WTBA 2FJDB 2VDHA 5KG0A 4BC9A 4X4RA 2GFFA 3TVKA 3JB9k 1QTMA 2RQCA 3OD2A 1Q78A 3R3TA 4CO5A 3RBEA 3J7A1 5D6GA 3EICA 2GIRA 4O3QA 3OV7A 3F0NA 4B02A 2CPDA 4K0KJ 1BQMB 3T5JA 4X66J 3Q8SB 3OTCA 1V9OA 4M5HA 1HR0F 1JLQB 2WK4A 4EI2A 1K44A 9RUBA 3UNYA 3L9ZA 5HANA 1SQGA 3FQKA 2DNGA 3THPA 4DSEA 3JSBA 3CCES 2HNYB 1Q16B 4FN5A 1P1LA 1XIQA 1BQNA 2LMIA 3GG0A 3DRXA 2NPIA 2F8MA 3IBCB 4O3RA 2BV3A 1S1TB 4WE1B 1H38A 2V2ZA 4ECSA 4L73A 3ISNC 4USWA 2DRAA 3KMQA 3OFEA 2R8GA 4KFBA 2MQQA 4IOAQ 3DFEA 3HM9A 2ZJPQ 3M2VA 1JJ2R 4FXDA 1NDKA 4HDGA 3H40A 1VQSA 2J9DE 4ZITA 3NKYA 3EDQB 1TL1B 1H2VZ 5BR8J 1U1MA 1IBLJ 4P75A 2L9DA 4H54A 2RF2B 2IY5B 3CSKA 2VA3A 3Q8UA 1FCAA 4ECUA 2DNLA 1UFKA 2PA8D 1NNDA 3MM7B 4HT7A 3I4PA 2R9LA 4OHWA 3AB2B 3G82A 2QYCA 1LXJA 4LF2A 1B0TA 2OFHX 1FK9A 4QIGA 2JZ5A 1WEZA 1FVSA 1X60A 2R42A 3KLEB 3CCRS 4NE9C 1FJGJ 4E8UA 4Q7AA 4KC5A 5KFEA 1NHKL 1VQ6S 2QLWA 2YKNB 2FVSA 3BGLA 2AYBA 3CJ4A 4MIBA 2DEJA 1D3WA 1JLCA 2I9SA 3NS7B 4KAIA 3V2UC 4LSNA 2HMIB 1AXQA 3R7SB 5HVHA 4FYXB 3QJJA 1F60B 5T7LA 2J7KA 4AQYJ 1CS4A 2AD9A 4P7VA 2I2YA 2AJ2A 1UJ6A 4WFYA 2N3LA 4DV3F 4RKUC 1EJ7L 2MLYA 1VJWA 1U2CA 4UUWA 5EGYA 3DLKB 1X7VA 3EUNA 3EVWA 2FIUA 2QRRA 2XS7A 2MJUA 2LQ8A 3OUYA 2DGXA 4F02A 2YKOA 1JLEA 1EETA 3GWCA 2IYIA 3H2UB 1S1WA 2FDNA 2KRRA 4LRDA 2KI2A 4WFZA 1AFIA 3PX4A 2E9TA 2HWIA 3SXLA 2CQHA 1NMEB 5KOXA 2X3DA 3KK3B 5KT3A 4OLPA 4IRCA 1OQ3A 2ZBPA 2V8GA 5KFDA 4NLPA 1R3NA 2ZUGA 2CPEA 3OFHA 4QJVA 1FRHA 5E3CA 4J9QA 5DJBA 1XNQJ 1ELOA 2RVJA 2CJXB 3RB3A 2WCXA 3PR5B 1UVLA 4OYXA 4ID5B 2CZVC 5IWAF 3GQCA 1LEOA 4OX9J 1IKWA 2JRSA 3BYPA 2W9CB 3UD3P 2VB6A 4QR2A 2NUHA 1ROFA 1LQ9A 3CWJA 1KVKA 7AT1B 3C19A 1BGXT 1S10A 1CJTA 3OFFA 2K3IA 3OSNA 3D1HA 2CNOB 4LBPA 3BEGB 2Q6BA 5J1EB 3PW4A 3HVRA 1VR6A 1DTTA 4K0KF 2IJFA 4X66F 5HO4A 1RU2A 2JEFA 4PG4A 1KTQA 4PYDA 3W8GA 1WG1A 1ZM9A 2QN6B 5HI7A 1HNWJ 3LGHA 5J2PB 4NXMJ 5E41A 2ZE2A 1YQHA 1ZA1B 1HYSB 2R2RA 4J91A 3THVA 4ZP9A 3BSNA 2XZDB 3SDEA 4ZKAA 2XMKA 2DGOA 5EWEA 4CLSA 2HQGA 1BXNA 4QWDA 1U02A 4F2SA 3MPYA 2MKCA 4NEYA 1F1BB 3MEEA 1PBAA 2Y9HA 3H5YA 1LXNA 4EO8A 4F0KA 3KHLA 1RABB 4DLEA 4OJ3A 3L3CA 4EZ9A 1T95A 2J9EA 1RSCA 4B3RF 4Y2KA 3CCZA 1QE1B 3OLBA 4C7QA 3EWGA 2N4CA 3Q8RB 2HHHJ 4ZVRB 3O6QA 4CH0S 1UFLA 3WC2A 4ZPBA 2DHSA 2H1YA 5HMXA 1IQTA 2CPZA 4C0BA 1N5VA 2F7VA 2KHCA 3SQGA 5CCMA 3RBDA 1JJCB 2AEMA 5IT4A 4NZ6A 5J2NB 2LXIA 2DHXA 2ILZA 2KT2A 3R6LB 2JEIA 2W2MP 4OL8A 5ADZA 2QTWA 2MQLA 4I7FA 1YX2A 3FBFA 3ICLA 3V5RA 4JI6F 5KTQA 3KUEA 3CJ8A 2M0GB 2PT0A 4U7UD 1Q1KA 4HI2A 1VFJA 1RWUA 2XCPA 2F4VF 2OPPA 2B7CB 2C2DA 3EZOA 1S4FA 5C42A 1TV6A 1VBYA 2CWXA 5CXTA 3UW1A 1IKYB 1T9WA 3HK2A 2AMCB 4AQYF 2AZ3A 3T5LA 3NOCA 4CLUA 1FFWB 2CDRB 2C28A 1M1HA 3CPWR 3FKBA 3NL0A 1IJFB 2VG7B 2YH1A 1TKXB 1R0CB 3Q0AA 5EDWA 3M30B 5CYQA 5AJ3F 3AHPA 4ED3A 2ZC3A 1T9YA 1PCAA 4BBYA 1BQMA 1JXEA 1O8BA 1VBZA 5G0RB 1YVFA 1MLAA 2ZH3A 3CCSS 4DMZA 1T05B 2HGMA 1U2RA 3OL6A 4L76A 1U1NA 3E3XA 2D3ZA 2HNYA 2B5JA 1KTVA 4C6AA 2MB0B 3POTA 4LIWA 5KFPA 3J81j 2X1FA 2YNIB 2XLJA 1S1TA 4OX9F 4LUBA 2G9OA 4WE1A 3PFOA 5L38A 1VQKS 1ACMB 4JV0A 2QC3A 4G1PA 5D0EA 5HVFA 2MQNA 5AXLA 3MOZA 4X64F 1WEYA 3HP6A 3D2WA 5KFQA 2UVUA 3WHIA 2P6SA 3NG8A 4DL5A 3N6NA 2HAIA 4F7VA 2XB2D 1TL1A 2QIFA 4OYAA 4AUKA 1K0TA 2VKZG 3H4DA 2IRXA 2OO4A 4FBTA 1T9VA 3MM7A 3HX9A 3CD5A 3PY8A 4LF1A 3R1HA 1CLFA 4C0OC 5K14B 2AJ4A 4RNMA 2D3O1 4ED8A 2XSJB 1FEHA 3D68A 4USTA 3KLEA 3E51A 2VA2A 4LF5J 2LA6A 4YHHJ 2RNEA 2YKNA 1D9AA 2VONA 5DO2A 1KP6A 4NMLA 1N0VC 5D4OA 5KG1A 1EQ0A 1Y0HA 2GO8A 2F9JA 4ELUA 3PEJA 4CLPA 2HMIA 3O3LA 3WIVA 4PYAA 2NREA 2CJQA 4KB7A 1XR6A 1U1OA 4CDIA 2HHHF 1X4FA 1C0UA 3H8YA 3Q8PB 3CIMA 3SEOA 4HTJA 1W7WA 1BWEA 4DFJA 3DLKA 2ZNYA 2DO4A 3JTPA 2LCWA 1Q7LB 1GMUA 2CA9A 4A8SA 1VQOS 2UUAJ 3PTWA 2E66A 3FBEA 4DFKA 2MGZA 2OPRB 4DQPA 4UOGA 1FJEB 3UR0A 4DCPB 3G6XA 2A1BA 5DGBA 4O4RA 1SJ3P 3K5LA 2HS0A 3KK3A 3GONA 3QAEA 1RT1B 2EEYA 5ETSA 3HSDA 2MHEA 3K5NA 1HI0P 4RZRA 3UN2A 3VAMA 2DR5A 4YY3J 4ID5A 3D6HB 3KWMA 2FZKB 5KFKA 3DLLQ 5DDPC 1RWNB 4DR5F 1FDDA 4L75A 2AEJA 3GB0A 2P2CB 5LXRA 2W9CA 3C16B 1XR5A 4WK3A 4TY8B 1U09A 4ED2A 2B4UA 2OEJA 5HQ8A 3I87A 3UD5A 1UEUA 2OAUA 1NK4A 3SZ2A 3TNVA 2EFGA 2QLXA 4DI6A 3EVOA 5DQHA 5H9FJ 3HULA 5J2PA 4DR1J 3K8VA 1S6OA 4XIUA 1VDHA 2O3DA 3QBCA 4YDXA 1HYSA 1YGYA 4GKJF 3B78A 1U26A 2CQGA 4XK8C 4DV5F 3I9ZA 3C2PA 2HWHA 4HHHA 3ZZUA 2YQ0A 1MWQA 2KM8C 4Y2MA 1RT4B 4GO7X 4WTOB 1JLFB 1PO6A 2YWKA 5CABA 1XQIA 1QE1A 1ZBTA 4ZS6A 2UUCJ 1X4GA 5KFLA 1CJKB 4F36A 1NKEA 4KHPJ 2HNDB 4OHZA 1NK5A 2OPQB 1YIJS 1VHFA 4RNFA 4LRCA 1KSPA 3D67A 1HHSA 4ZPAA 5ETLA 2XEXA 5J2NA 2DH7A 3SCIE 1O5JA 5F9NA 1NH7A 5LSOA 4CI0B 2DNHA 1B70B 5L1IA 2NXCA 1NLKL 1U1KA 4KBIA 1QDUB 2W7AA 1W2IA 3BSCA 3N28A 2MLZA 3QFWA 3CJ5A 4P73A 3BBCA 5AE2A 3JS9A 4JI0J 2A3JA 2CQ3A 1CVJA 1TL5A 2BQRA 3P49B 1IBMJ 2JJ4D 4AD6A 1IKYA 2JVRA 3F73A 3AY0A 2EG2A 2FQQB 3K7RA 1EZZB 4J7CA 2OTJS 3MAQA 2L41A 1WC6A 4IG0B 2P6TA 4NI2B 2Z57B 3NNCA 1HW8A 3DLHA 5IT0A 4ECRA 3M30A 3D9BA 5HBMA 4IO9Q 2AQ4A 3HHLC 4PXDA 3PHEA 1PILA 1N52B 3R5CA 1WI6A 1ZAXA 3KKFA 3KLFA 3G8QA 3Q8VA 2RB7A 3D1OA 2AX1A 4LRAA 1U48A 2HBQB 1OPIA 3W62A 1YITS 2WBRA 3JSRA 1RWXB 3NRBA 2DPIA 1T05A 1ULRA 1FKOB 3I55S 3RR7A 1HNXJ 1UTAA 3TJ9A 1RTDB 1LK5A 2HFZA 5LM7E 3IR7B 3AD9C 4KQZA 2MQ8A 2RT3A 3QPIA 2YNIA 5ETTA 2GX8A 2YNGA 1FTCA 3O44A 4F8RA 3QGIA 2GZOA 3N5FA 5A6PA 1FX4A 1N5TA 4ER8A 1VGYA 4Y2IA 3TW0A 2YWWA 1PKUA 2MZ1A 2KZMA 4G3IA 2Y8WA 4DOZA 2M3DA 1FFGB 3P3DA 2HHTA 4DV6J 1N32J 2W9AA 1XNRJ 1OSCA 5GVQA 2VODA 3HT0A 2VQFJ 4DR6J 3M32B 4R8UB 4DEZA 4CO0A 1IKXB 1ZTWA 4DHVA 4MKBA 2VPWB 2NQPA 3SV4A 2BJDA 2ZZTA 3NGSA 2H54B 3TANA 5U47A 5K14A 3SCJE 4MTPA 2AEFA 2WSEC 2YX1A 2XSJA 2B3TB 4NRUA 4ZPTR 3WQPA 3X1LB 3HJFA 2DR8A 3DMJB 2HIYA 3PW7A 4GO5X 1FVQA 3KLGB 3VAJA 1P9QC 1OYDA 3ULHA 3QNWB 5IC6B 4C48A 1DLOB 3ENWA 1QUPA 3EZUA 5B0GA 2KT3A 1SIZA 1YKWA 2DNOA 1BHNA 3MTJA 3HZEA 3BYRA 4J9OA 1CBKA 3QRPA 3IWXA 1GXTA 1IBCB 1RT2B 3D28A 3MCMA 4USKA 4LF4J 4HLBA 5E5NA 4FF3A 4Q44A 2KTQA 4RW4B 5AXMA 3RRGA 5HLFB 1RGVA 4OX6A 2HHUA 2HFNA 3FJ2A 4NLGA 5THWA 4HDHA 2GV1A 1SH3A 2XY5A 4IR1A 1QVGR 1R8CA 1TELA 4OJHA 1RAFB 5KT4A 2M8DB 4ID8A 2DH9A 4C4WA 1RT1A 1IBMF 4AE5A 1T02A 1I5OB 3DC2A 4C97A 1QSSA 3O5TB 1YDLA 2R2SA 1ZH5A 4WZMA 1KFSA 4NLTA 4CLKA 2B7BB 4Y2AA 4R25A 3TP2A 2EC0A 2HZCA 2XM3A 3GCWP 3ADAC 3C16A 1TAUA 5LMNF 5SZTA 1VOMA 4LFAF 4RNHA 4KY3A 2GAHC 3T3FA 1S5ZA 1Q4RA 1QSLA 4KRWA 5B09A 3AQOA 3A4TA 1HWIA 4NA2A 3ZTOA 2MDAA 3G96A 4DL2A 3W8PA 3FMWA 1ZS6A 3P6YC 4NYPA 2GJFA 1HNXF 3W60A 2DGQA 2ZOMA 1APSA 4OZNA 2JLEA 1TUWA 1OJ4A 3BO4A 1SC4B 1U1LA 1VQ7S 4RPFA 1M1GA 4CLYA 2CQ2A 1S99A 4MK9A 3G4SS 3BKUA 4WXOA 1FFSB 5KFGA 3QATA 1Y3JA 2J6TA 1LW2B 1JLFA 3LPYA 3MEDB 3UNGC 4RBUA 3NNAA 3IWNC 4N8OA 2MTLA 4FXWA 4RU2A 1T9TA 3ILOA 3FZ2A 4CT8A 2NZ4A 4ZP7A 1FHTA 1M5OC 4EBDA 1CULB 1HBOB 3HKWA 4ILRA 2V2VA 1CJKA 5I3QA 1OS5A 2HNDA 1XNRF 2FHOB 5E7OB 2G13A 2Q1LA 5DZ7A 2PMZD 2VQFF 2OPQA 2VBZA 1H6KX 2C2OB 1OSDA 1S9GB 1KQFB 2MLXA 1PAUB 1TKTB 3LOUA 1S7IA 3U27A 1QAYA 2LQ9A 4WZQA 3J7Z5 3HF5A 1NXIA 1URRA 4B3SF 1DY3A 1R0BG 2VJVA 3KK2B 4F3OA 2KT5A 2HHQA 2VG5A 1QLNA 4YQWA 3J7ZT 4RR5A 4OI1A 1FT8A 3BKFA 1NB2A 1HW9A 3PEHA 1G1XA 2DD8S 3L7UA 2BJ7A 3DNCA 4IH5A 3QT7A 1RLDA 4P74A 5EWGA 2MZRA 1Z4UA 4USVA 1X5OA 3VVUA 3HHDA 1F5BA 2B4PA 4X4UA 4PG6A 4OZLA 4IG0A 4NI2A 2VPZB 5J2QB 4C8YA 1NK6A 3KTQA 3RGIA 2FC9A 3AA9A 3T9NA 2FZCB 4K50A 1R89A 3KJVA 1SBRA 4RUAA 1X5SA 1RACB 4OYMA 4ED1A 3DM2A 2UUTA 3OVSA 5KFNA 3AD7C 1UFWA 1CJVB 1I1GA 2KVIA 1Q8LA 2E5JA 2EKYA 1YLXA 2X7IA 4K4XA 1FRKA 2BACA 3SFGA 1FKOA 2QV6A 2IRYA 1RTDA 2JLGA 4KJIA 1RAAB 2PEBA 4I68A 1B3TA 1RADB 5EWFA 4AXIA 2Z30B 4DU8A 1RLCL 4RWWA 3SQOP 5T41A 4H4MB 3GIRA 2VOOA 3JQKA 2K1RB 1NSKL 3RU0A 3I5CA 2CDQA 1RWPB 4FYYB 4O3NA 5LT5A 1OO0B 3TUPA 2HHWA 1B0PA 2KU7A 4DL7A 2FVQA 2UVRA 3QSIA 1TFWA 4I2PB 2QG9B 3UN5A 3M8PB 3NY0A 2HQIA 3MPUB 2GJIA 3JTNA 3AD8C 4F4XA 1UCNA 2DY9A 5K8PA 1FESA 1WC0A 5HJYA 2VIHA 2RQMA 3QO9B 2G0CA 3NCQA 3M32A 4C11B 3VAIA 4R8UA 3PG9A 2PEHA 1IKXA 3BSOA 4LSLB 2GNKA 1F5AA 4PPZA 4AL5A 3QSYB 1FEEA 3S8SA 2YPZA 4QU7A 1MU2B 5AE1A 3Q83A 3R7BB 3GSIA 3NWRA 3M8YA 4F4YA 1JJ4A 2HW3A 3DMJA 4ZVFA 2V4JB 5KT5A 3UDCA 2B43A 3KLGA 5F3TA 3DRPB 5I3UB 3SI8A 3DLEB 2EBGA 1GXLA 4YR2A 1T11A 1DLOA 4B9LA 1REVB 4DFPA 3SFUA 5CZVA 3MPVA 4ZVEA 1HBUB 3B8HA 2E1RA 4A8KA 3IC1A 2ZJQQ 4ELVA 1RT2A 3GLJA 3ZZTA 1U8WA 5B0DA 3I31A 4TN2A 2ASYA 2HS4A 2ZKUA 2Y1JA 4K4SA 3ZTSA 4RW4A 5HLFA 4JI7F 3QIDA 4KT0C 1M5VC 3KDNA 4DQIA 1Y5LB 4YB6A 3CO9A 4B9VA 3PM9A 4Q43A 4C9DA 1S1VB 4NLDA 5D77A 1AYEA 2XMVA 1T03B 2LP4A 4ZA1A 2C3YA 2XCAA 3NP5A 5K8NA 4AT1B 1V5VA 1YTYA 2GO9A 2FHJA 4N56A 3I0SA 4MT1A 2E7XA 4PXBA 4NL5A 1UVIA 1EB0A 3C15B 1GXUA 2V8PA 3CJTA 4USIA 1NPRA 5F0WA 4JI1F 2C3OA 3EVMA 3NMRA 1GFWB 2Y3YA 2MZTA 3NGUA 1RHUB 4ZVUB 1VQNS 1RHQB 2Y1RI 4DV4F 1LWEB 3BH6B 5F8LA 1X0FA 4WTYA 1TP7A 1FNMA 1MMNA 4F26A 2V6AA 4CH1A 4ANCA 1R0AB 1T3OA 4DF4A 1VC0A 3MGJA 4WU3A 3BPSP 1H7XA 1WC5A 3SSRA 5GADI 3VQSA 4RW9B 1NJXA 3D0IE 5T14A 1WG4A 2K06A 2B4VA 2IA0A 1N5QA 2SXLA 4K8RA 3VQTA 4ELTA 2VPYB 3UDLA 2WB1D 2KM8B 3EE3A 3N01A 1H74A 1CJUB 1FRIA 1LW2A 3S1TA 2BKPA 1RJJA 4NLWA 1NDLA 3MEDA 3W9JA 1KOHA 3NEKA 2ZBRA 2ZKTA 1Q5VA 5GMDA 4YR3A 5GAHI 4CNYA 1T9XA 2OIHA 3MXHP 1CULA 1HBOA 2YY3A 1RU1A 1XMQJ 2HQFA 3MZIA 1FD8A 4QIWD 1R6VA 3QLHA 9ATCB 2XMJA 4ED0A 1LWXA 2XG8A 4B3MJ 3EGWB 3DGPB 5DM7Q 2ACMA 1SB6A 2UV8G 1S9GA 3W7BA 3RAQA 5AT1B 1X4EA 2QL5B 1TKTA 2EXUA 3M4XA 4F25A 3CDWA 4EU0A 2FPHX 3TRGA 2FD2A 4JI5F 3VTIA 2OSQA 3BM7A 4TQRA 1SIWB 3EMTA 1Q8BA 3OT9A 3KK2A 4GC6A 2I0XA 2M5YA 3I82A 2NR0A 1U6ZA 3V81B 3CD7A 3T41A 3ILIA 3NCPA 3J7YI 1A6LA 4RBVA 4IG3B 1P1TA 5LSRA 1ZM4A 1RBOB 1BC6A 2GGPB 3G8SA 3CO0P 1FJ7A 5J2QA 1TFYA 3ISND 1RAIB 3D5MA 2ZVSA 4QPXA 1S6PB 1AFJA 1HLWA 1NDPA 3HHLB 3VWSA 3TAQA 1AROP 3DU6A 3KXDA 1F3VA 4I6WA 1I6JA 4X65J 3TARA 4WP9A 1VHIA 2ZH9A 2COLA 4NLOA 1J5OB 4OZ5A 1WC1A 4PUOA 4C8NA 1HARA 2JHEA 1CJVA 4C3MA 3IMQJ 3FQLA 3BKTA 3CUNA 2F4FA 1TK5A 2I1RA 2R7SA 1IQZA 1MG7A 2RILA 4O3SA 4BWMA 5A76A 3MMCB 2BKOA 2WVDA 2LEBA 5F8IA 1I94J 2LEPA 2V34A 2K1RA 4PQAA 4DV7J 2J9CA 3HFVA 4Q45A 3B54A 1FE4A 1HWLA 1U6BA 5LL6d 1S9EB 2BE2A 3GPAA 1X4BA 4USUA 2HGLA 2BQUA 4O0NA 2XMUA 2GMLA 5I4MA 1NDCA 2WW8A 2E1MC 4O23A 4A8XA 2CJYB 2FLLA 4DFMA 1U45A 2UXDJ 2B9YA 4PXEA 4DV0F 2E5GA 3F41A 1VRTB 3BDPA 2LECA 3OPKA 4ZPCA 1X31C 1SV5B 3O1LA 3LP1B 2U2FA 4C11A 2C3UA 2ZD1B 2FB0A 4LR8A 4LSLA 1CG2A 4M5DA 1V3SA 3M8WA 3EYZA 1YZ7A 4IUFA 1MMLA 1HQEB 4GVBB 2CRLA 1NZAA 1MU2A 2DBBA 2V94A 1MWYA 4X2BA 2B0GA 4O3PA 2RRAA 4C2MA 2V4JA 2P8IA 2QX0A 2HVDA 1RKJA 2H3EB 2GVZB 1PYTA 3DRPA 5I3UA 1YSJA 3UR3C 3DLEA 2C3MA 3UPFA 2MQMA 1JXVA 3Q23A 2FLNA 2LEAA 3MPDA 3BF4A 3CCQS 2A6OA 1KD1T 1WELA 2KXFA 3OFGA 4WWSA 2EFPA 2L48A 2BDPA 1REVA 4CH7A 1A7GE 4DR3F 4MKAA 1XMQF 1M5SA 2OGUA 4X4QA 1HBUA 5H9FK 2M9KA 2CJAA 4OHVA 4B3MF 2VBYA 1NBEB 4ZN3A 4P2FA 4DPWA 4FS1A 2RJZA 1OY6A 3CC2S 1FX2A 1TMJA 2R8JA 2W8LA 1WHVA 3M6VA 2ALYB 3GIKA 1HBMB 4ECZA 2DT9A 4FKYA 4K2JA 2XMTA 1S1VA 1T03A 3IFEA 3IG1B 1U49A 4J9NA 1RT6B 1FNOA 4ECWA 1H2UX 3MAAA 4C3LA 1Q5YA 2DXEA 2HNZB 1WSVA 2MPUA 8RUCA 4UT4A 4U8VA 2M70A 4UY85 2R2TA 5KFAA 3C15A 4X4NA 2J9DA 4ZVGA 3NNHA 3AB4B 1GT8A 2GCFA 2QT7A 5F8MA 4ZIVA 2KHDA 4KGZB 2ZH2A 3MHYA 3G87A 5HN0A 1NCLA 4KO0B 5CHCB 1GMVA 2FJAB 2M4MA 1L3TA 4OZJA 1LWEA 1D1UA 2KRBA 4S0MA 1N6QA 2X51A 3MR6A 1U1PA 4U7UK 4X65F 1R0AA 3QIPB 4W4MA 1GQEA 2WONA 2XO7A 4M5JA 1K9MT 5F0UA 3MMJA 1T8EA 1ZPWX 4QWEA 1MWZA 2G4BA 4DN9A 1YRTA 2WAQD 3H90A 4WXWA 2X1GA 2QFIA 2R7VA 3HVTB 5C25B 3DHWC 4RW9A 1V3RA 4UQTA 1WKKA 1IWGA 3QWPA 4YB1P 4BCAA 3DRYA 1JNRB 5IQQA 4ZMMA 3K57A 4C8ZA 5A2QU 1I94F 2UXCJ 1HFEL 3IM8A 4DV7F 1TMMA 3IRXB 1Y9OA 3DGVA 2Y1LB 1WSRA 3OXLA 4LMZA 2V0NA 4UOCA 2J7UA 1WUUA 2BMBA 3NS6A 2WRMA 1CJUA 2BRKA 4KGVB 3PIOQ 4JI8F 3K5MA 3HFKA 4LFCF 1RZMA 2ZWPA 2VBXA 2VFUA 1XBWA 3OVBA 3RJMB 1SQFA 2NPFA 1J27A 3CE8A 2J7WA 4PPDA 1TQLA 3A8EA 1C0TB 3FDSA 2W2QP 2ADBA 3C46A 3IWLA 1X5TA 4USJC 2V50A 1U1RA 1UPMB 4RLEA 3DGPA 2E29A 4W90B 4HHUA 8AT1B 1RA6A 2DVIA 5AXNA 3G6VA 1HR0J 2XNQA 5DQGA 2B9XA 4DXLA 1NM2A 4N7TA 4QWCA 3VV2B 2AF6A 1V6HA 3FSXA 1RDRA 4ICLB 4RWXA 3GCXP 2GHWA 2R8KA 5KFJA 3MFHA 1RI7A 4UF4A 2FTRA 3BV8A 3G8TA 4P2SA 2W9BB 4FS2A 2BEFA 5KFHA 3FZBA 1OY8A 5HMWA 4E2FB 5L8RC 2XMAA 4ZPVR 1IR0A 1E6YB 5C2CA 4YDDB 4WFAQ 1V5IB 3MUMP 2CJ9A 2K8GA 4IG3A 2H48B 3CMQA 5C24B 1YWXA 2G2YA 2W2NP 1VMBA 2J6SA 1NH8A 2PE8A 2CZ9A 1HMVA 5E2QA 1S0MA 4MMOA 1DJ0A 5GMKa 2XZWA 2GGPA 3D6MB 2KYXA 2DGVA 2OPSB 2L08A 2OHDA 2ZHOA 4UOHA 3FEYB 1S6PA 1JB0C 5MLCV 2IVFB 3HHLA 2GS8A 4HH1A 1HNZJ 4DCOB 2FYXA 3VR1A 5CQGA 2BM1A 3JSYA 4PZVA 3A3OB 5C5JA 1SH0A 2BW2A 1J5OA 2CIMA 2HEKA 4MKVA 4CO2A 3CCUS 2LXUA 2QSWA 2V63A 3L09A 3W2WB 2WVEA 3N9UC 4I56A 2IPOB 5KAKA 4ZJLA 3UD4P 3KK1B 2H51B 2KFZA 3MMCA 1QSYA 1ZM2A 3N4WA 3QYYA 1OPZA 4K2XA 2ASDA 3AFGA 3KJFB 2OH2A 2KH9A 1S9EA 3FEZA 3DI6A 2W7PA 4TXSA 4B17A 1K47A 2YKAA 1FDAA 5E3AA 3FK4A 4L3NA 4Q5VA 3OTDA 2IIHA 4F67A 4NX9A 5KOWA 1S77D 3TA1A 1VRTA 1UVKA 2LXFA 2B9EA 2YTCA 1SV5A 3LP1A 2IBKA 3TZZA 4DR2J 4GVLA 1NEEA 3CDEA 2DTJA 1REGX 3MM5B 4OHXA 5ETQA 1HQEA 3CDBA 4GVBA 2AYGA 1UA0A 1R7IA 3TEHB 3UVJB 4EEYA 3ETMA 2ADCA 4L6V3 3WIUA 2BA9A 2DITA 2UXCF 4NA3A 4QWAA 3M8SA 2M8HA 4FF2A 2YX4A 1NJYA 3PW2A 1F9EB 2GVZA 3MR2A 2PN6A 4DU7A 3ET6A 3UCZP 1VQ5S 2ZOFA 4ZPDA 3A3PB 1NK0A 3X3UA 3W5XA 4BLGA 3BR8A 1QTNB 2NXEA 2YPYA 2IFXA 1N36J 1T0TV 4WF9Q 4JI2F 1RAHB 3ZZOA 2HS3A 1LOUA 1RE1B 4U95A 4B3TJ 4HKQA 4NA1A 2G0IA 1SJ1A 2DXFA 4ED4A 1F2HA 3UWTA 4KKOB 3J81U 5GADU 1O6XA 1KS2A 2GJ2A 3W5YA 3FRZA 2BR0A 2K2PA 4RO0A 5DG7A 2JH3A 1HBMA 4NWBA 7FDRA 4O3OA 3JAMY 4XTTA 4B9SA 4ZVQB 4B3OA 5D4LA 1HNIB 3IG1A 1SUQB 4OYBA 2XQCA 1P27B 2H5IB 1RWWB 1ZPVA 2HNZA 4C0HA 4HYKA 4RUCA 2D3UA 5I3PA 4I6AA 6FDRA 5GAHU 3MCSA 3LWMA 4KO0A 4B3RJ 2V68A 1OIAA 3LWLA 4A8MP 3VHQA 2R7UA 3BGFA 1H7WA 3HHNB 1DQAA 3PX6A 3PKMA 4FF1A 3CULA 2BJ1A 4NASA 2F1FA 1HNZF 3GFHA 3VALA 1FRMA 1TUVA 3QIPA 2FZGB 2RDJA 4H4KC 4P72A 4DN0A 3DYAB 1O0PA 1RAOA 1VS3A 3A8IA 2RE1A 2WSCC 4CO1A 1U4BA 4IRKA 5JUMA 4F04B 2HG4A 2V2KA 3DRRB 1F6TA 5C25A 3NBPB 2DKOB 3OTEA 5B08A 4JI6J 2NYHA 1YJUA 3AA8A 4TLQA 1S9FA 3CIZA 1UP1A 2VU5A 2KDOA 1UVMA 4LF9F 1F3FA 3J7YU 1X9SA 3LPEA 4DX8H 2F4VJ 3RAXA 2JC0A 4D3HA 2F8HA 2QLBB 1Y00A 3IRXA 1Z2LA 5IV4A 1IN0A 1KFDA 1SH2A 1NSQA 4O4GB 5IM0B 4M1KA 4B9UA 5J2MB 4M5KA 1ZOTA 2OEKA 1M5KC 5AJ3J 3PW5A 2E9RX 5K5MA 4NCBA 1UZDA 2GMJA 1C0TA 4J9PA 1SL2A 2I8EA 1BUXA 1JJHA 1FXLA 2MYFA 4P10A 4OYWA 4P6QA 1WI8A 4LVNP 4DR2F 2FHMA 3L7OA 2M7SA 2AX0A 2YWGA 3ZZPA 1T9UA 4OZ0A 2YWHA 3HHLD 1G6BA 2U1AA 1HBNB 5HQLA 2E9ZA 4ICLA 2DNMA 3SCLE 4KV8B 4CZCA 2XHCA 2W9BA 5ETKA 3WC0A 3RYLA 2E5IA 4I2QA 2CQBA 4K5RA 4FZVA 4KPYA 3PV8A 1E6YA 4FP9A 2KL8A 2ZH7A 1N36F 3E01A 5C24A 4X64J 1LWFB 3AJ2A 1KWMA 1FO1A 4DSIA 4IDKB 4KIAA 1S1UB 4KH0B 3U02A 2EKNA 5DDRC 4B3TF 5KFWA 2YKPA 2CQ0A 3FBBA 2YNFB 2OPSA 2QEXS 3ZZYA 3B82A 2OMOA 2MJNA 3U1MA 4C8MA 3NGDA 1C1BA 2BJ9A 3DN9A 3N5BA 4ZVOB 3GIJA 2DXDA 3KJNB 2E1PA 4ZVPB 3B6BA 3W3SA 3AOAA 1K1QA 3FUYA 1FKAF 3KLIB 1KDNA 1W25A 1JQGA 4CQ1A 3ZZRA 1R43A 4X84A 5ITHA 1VBXA 4IO1A 3H98A 1BQXA 3PJ9A 2AV5A 3W2WA 1Y10A 3VGTA 2C42A 1HHQA 4EBEA 3AT1B 2DJWA 3KK1A 3OJSA 4QW9A 4LFBJ 1WHWA 1RWVB 4DS4A 3NS5A 1FJCA 1KLMB 3ZTQA 3IR5B 3CJ2A 3CCMS 4QU6A 3NAHA 4CYUA 2J0SD 4DPYA 1V3ZA 4DZ6A 3VGUA 3D7SB 4UZCA 3FCWA 1YBTA 3M6WA 2E7WA 1S1XB 3TAPA 5L1LA 2XBPA 1CC8A 4XAKA 3MR7A 2RH3A 5A8KB 3T19A 4IQMA 1IM4A 2W1BA 1KR4A 1YZ6A 4DPXA 2HZAA 1XMOJ 3MM5A 3GJSB 5E3PA 1NHUA 1K73T 2LU2A 4KHRA 2PA3A 2G0JA 4XPEA 5ETRA 2UZAA 4LT6A 3M8QB 5L39A 4WCEQ 5F3ZA 1S0VA 5D0GA 3PYGA 3K89A 2B56A 5KFXA 3MUVP 2W2PP 1SJQA 4RL1A 4DR5J 1TTHB 2CFXA 1SCJB 3C6UB 4YFUA 4G65A 4ZVSB 1OWXA 1HHTP 5L1KA 3A8JA 5BXIA 1UVNA 2RUSA 1TK8A 3JYTB 1IR1A 1VJQA 1YRXA 1F5CA 2HK2A 4KKOA 3IP0A 3WX4A 1JLQA 1F2GA 2A0FB 4FPIA 1RA7A 2AYEA 1RXOB 2VBWA 4ZLLA 2CVEA 1HNIA 1SUQA 1VQ9S 2CPYA 3N79A 1RT3B 3RW6A 3TZXA 2ATCB 4GKJJ 1NPPA 2YH0A 4X62F 1U7LA 1RCXB 4ES2A 4Q8FA 4DV5J 5M2RA 4NLRA 2DGSA 2BKNA 3UN3A 1JLAB 4Y0FA 3N6LA 5K9FA 5DG9A 2KG0A 4I69A 2DH8A 5MAOA 2HURA 2QL9B 2A2CA 3BBBA 3K59A 2LU1A 4QYRA 1DHMA 4RJVA 2D69A 2O01C 2BX6A 5DLFA 2HFSA 3M2UB 3K17A 4P2XA 4MK7A 3BH7B 2RF2A 3TO8A 5FLXU 3ITHB 1B4SA 5HQMA 3GV5B 4F50A 5IZHA 2HVEA 4KH1B 1ZZFA 2W8KA 3DYAA 4YN3B 1G4CA 3MEGB 1UW9A 2VFRA 1H73A 5F9LA 3M2VB 3NBPA 4Q0BB 3N6MA 5ETNA 3CJQA 5IS2A 2ALZA 4JYAF 2CWKA 2GHPA 2ZH8A 1BY9A 2KN4A 4LFBF 2C1EB 2VV5A 4ED7A 1GAOA 1XJWB 1SQEA 2Y0SD 3C6TB 4HR2A 4DQQA 1NK9A 1RBAA 2YNHB 1S49A 2C2NA 1R8PA 2BRLA 5DETA 1S4EA 1LFPA 1CQNA 1EKRA 3JQMA 2DNNA 3CW2C 3BGRB 2ROGA 5B7WA 4TQSA 4L74A 5HATA 4O4GA 5IM0A 3QT6A 4ZCLA 2BJEA 1TUGB 2J5AA 5DGAA 1NPKA 1L3SA 2FJVA 2OSRA 4OJGA 5J2MA 2AT1B 1LFWA 2BANB 1RTJB 2ERRA 4E0DA 1U2FA 4FF4A 3MD1A 1XMOF 1CC7A 1S6QB 1SKRA 2Q43A 5FIIA 4OI2A 3P4UB 4Z2XA 4KGKA 4J37A 1H3DA 3R5BA 1HBNA 3QGPA 1JLBB 4A8FA 3HD2A 3HSGA 3FFIB 3EGVA 3LH2S 3GFXA 3GIIA 3TR5A 1Q86T 3C8YA 2HSEB 4HI1A 4KV8A 4ILLA 3D54A 5B0AA 4ZJQA 1EP4B 3AH6A 2R8HA 3CMAS 2R7OA 3IRWP 5DRKA 3S6EA 4PQUB 2RS2A 3PRBA 1YJNS 2MKJA 3L95X 1LWFA 3Q89A 3ENAA 2UXBF 2HQCA 4IDKA 3L4BC 5J1EA 2UU9J 1QVFR 1S1UA 1Q53A 4ZVTB 1X8DA 4LVOP 4DSKA 4IRDA 6FD1A 1DQ9A 2HAFA 3GR0A 3EXYA 3RAMA 1U8SA 2RAQA 1HPZB 3VF0B 5GMEA 1JX4A 3U7JA 2KVQE 3EGZA 4QYZK 2JSXA 1L5UA 1TR0A 1Q8IA 3P8BB 3ZFVA 4V19J 4RX6A 2LKZA 3CEDA 3H20A 3KLIA 2ZC4A 3BN4A 4FVCA 4K7QA 2YQ3A 4CM0A 2WVFA 1T3NA 2IYGA 5F8HA 2MQOA 1TU0B 3EPIA 1JXLA 3FRYA 4XDCA 2HQ3A 1NB7A 2XMMA 3GV8B 2BOPA 3CJRA 3OVAA 4CLWA 1U0HB 2FJXA 4IOCQ 3FC9A 3DDNA 4J9UE 2Z8QA 3QMQA 5DM6Q 1IVZA 2PMWA 4NCAA 3FEXB 4MFBB 2WOMB 4FBUA 3PW0A 1KLMA 1XERA 2ZE2B 4LQ3A 5E0OA 2DHHA 3W64A 1D8ZA 2KZZA 2AJQA 4EFAC 2YWEA 5B0BA 1MN7A 2JDJA 2KJWA 2BW7A 4ZHRB 3GJRB 4DG1B 3CT9A 3UI3A 2RRNA 2FLOA 2OEMA 2GW8A 1S1XA 4ECVA 3I6PA 2CYYA 4Q2LA 4BHQA 4DSLA 1H72C 4M5GA 2R7XA 5A8KA 3GFZA 4JI4J 2EFNA 1DRZA 2N7YA 3GU0A 1DURA 1HNVB 2OLWA 5I42B 3BZQA 3LANA 2NZCA 1GNKA 2DRBA 3MAHA 3OHAA 1CQMA 2Z2MA 2Q66A 3RG6A 3JSMB 1FKPB 2JOQA 4F0HA 3CJ0A 4OIXA 1RHRB 3M8QA 2UP1A 2RKIB 3AXMA 1KONA 3K0JA 1N34F 3QT5A 3QRQA 2UUWA 4P7TA 1T7PA 1Q8KA 3IGVA 5IT9U 2MKYA 2APOA 2VG7A 3DRSB 2MKKA 2OELA 1TKXA 4ITSA 1C4CA 3C6UA 1UZHA 2AYMA 5F8GA 5LMNJ 3AODA 1RWMB 4LFAJ 4HACB 3ZNJ1 2DGTA 3JYTA 2CJKA 3U1LA 2CPXA 4USHA 4M5LA 4P9SA 5G0RA 3M1VB 3B4DA 4IFYB 3PJXA 1Q82T 3ZZ0A 5IV3A 3DDIA 2KG1A 4N76A 2AGQA 2PFFB 4OI0A 3HXMA 3L7PA 4V1Ak 3A3NB 5KFRA 4DL6A 2QA4G 3BGUA 1UA1A 4N5SA 1RT3A 1RYRA 1N33F 3R1LA 3LO3A 4TNOA 3PZPA 4CO3A 2JLFA 1X4HA 2MHNA 1JLAA 3O8WA 3R2CJ 4WKYA 3GTYX 5LXYA 6AT1B 4U7CA 2CADA 4XO0A 1SJ4P 4A8OA 4GKKF 2GHVC 5KFZA 2KFYA 1TL4A 2UU9F 2ZH1A 1H98A 4LBHA 3KUHA 4DCJB 5HK4A 3D66A 3M2UA 3GJTB 2BBEA 1VQPS 5D8HB 2AW0A 3ITHA 4ANDA 2B5JB 3V6JA 4DUYF 3KNAA 2LQJA 1UJ5A 4GC7A 3POTB 2R8IA 2RIJA 2J76E 2OJ3A 1FNXH 5LOQA 1XWLA 1L3VA 2ZUAA 4Y28C 3MEGA 1Y7PA 2HRUA 3BPDA 1IKVB 1RHJB 3T1YJ 4J90A 3BO3A 1IWAA 1RTHB 4CLFA 4B3SJ 4A8QA 3IXQA 3KG1A 4Q0BA 3UCGA 3SV3A 1VK3A 1WOPA 4EK2A 2DISA 4KHMA 4CM2A 2NSBA 1QAIA 4ZCKA 2HHPA 2CQDA 3CF5Q 4N77A 2R7RA 3C6TA 2YNHA 1NKBA 4TKTA 1HD0A 4PWDB 5KT7A 2IMOA 5A2QY 3BGRA 2I6WA 3OBIA 4DSFA 1ZAVA 1S72S 1R8AA 3RUBL 2CPJA 3JQJA 3QAUA 1UL3A 2YX7A 3MD3A 3D0HE 2O67A 3VAKA 2UV8A 2GC8A 2BANA 4ZLPA 1DZ5A 1RBLA 1RTJA 2BYCA 4TVAB 5JVGQ 2RDIA 2CVIA 4J5OA 4EUVA 5L9NA 3JAMU 1E6VB 5C2GA 1YJRA 3KUGA 4JI4F 2V9KA 3ENVA 3RB4A 2OPRA 4MJKA 4NZ7A 4A46A 2RQ4A 2ASLA 1S6QA 5ETPA 1DFDA 4UW2A 2VASA 1M90T 2J8SA 3CCJS 3C3LA 1C0UB 4PWWA 3P5BP 2ABYA 2G2OA 4OX7A 3NGKA 1JLBA 1SL0A 3FFIA 1U0SA 4ES1A 3US5A 1N0UA 4WK1A 4NPOA 1KHVA 2DNYA 3CDUA 2YKMB 2NUUG 4IH7A 4PABA 3SSSA 4DX6A 1EP4A 5AXKA 2ZM6F 1WF0A 1NO8A 3KJQB 4R5PB 2MGZB 4PQUA 2CQIA 3QZ8A 1KLNA 3CB4A 1QUVA 3PRVA 2QGFB 1FTRA 4ZPWR 4TY8A 5D0RA 1FF2A 1O51A 5CD4A 2J0QD 4J9KA 1WTFA 2MY7A 3F56A 4QZVB 2AZ1A 1RCOB 4DSJA 2ZITA 5HAOA 4DPTA 1HPZA 1G7CB 1MROB 3R5DA 5M2UA 1PJ7A 2MKIA 2N82B 2F3JA 1NSPA 4U9RA 2CAJA 2PSZA 3T6JA 3ISZA 4ZDNA 4CRJA 2DCLA 1KC8T 4C8LA 4DPOA 2VICA 3GZ7A 3EPGA 2JX2A 1RT5B 1CEZA 1RHKB 1RTZA 4KGXB 3RR8A 1U0HA 1RT4A 1X4CA 4A48A 1KHWA 3FSYA 3G6YA 2VL1A 3WDOA 4XPCA 1GX6A 3R5GA 5JJBA 3D1QA 1FXRA 4MFBA 1DTQB 2AU0A 2PGCA 2WOMA 1RP5A 5A8WB 4QW8A 2W7OA 3UQSA 2OTLS 4X4VA 1VRUB 2J6UA 4LRFA 2HKEA 3TVYA 4KR0B 3C14B 3DCAA 3MECB 3H25A 5H1SV 4ZHRA 4MAKA 4DG1A 2CPFA 1T94A 2MXYA 2H5EA 4URGA 3CXCR 4CLLA 3CCWA 4JV2A 3AOCA 2UVVA 1R31A 2J8AA 3KG4A 1FWLA 4JI7J 2K3KA 3T1YF 2HFOA 1KQKA 3VZHA 2KB2A 2XHWA 3A1YG 3W2VB 4QBUA 3P45B 2D3OR 4ZP6A 5BR8F 3T9ZA 4X4OA 1IBLF 1HNVA 3GV7B 1QAJA 5I42A 3HLUA 3H5XA 4WPAA 2HHXA 1WF2A 4O44B 1YHQS 4YB5A 4DWIA 3JSMA 4NLUA 1FKPA 1N88A 4WYLA 2CQPA 2MQPA 2RKIA 4JI1J 2P9EA 2HFVA 3U1NA 3HI9A 2I38A 3DRSA 3PX0A 4NYOA 4DV4J 1FJGF 4UZBA 2QO3A 1KRPA 4LF7J 2FY1A 1AUSL 3A13A 4JBCA 4HACA 1PC5A 2MZSA 3DLGB 3K5OA 1MNEA 3HO1A 1HQ2A 3J81Y 4NLQA 1YJ9S 2LDIA 3M1VA 3IA0A 4IFYA 5KG2A 4ZCIA 4RBTA 3PACA 2IM0A 2ZBCA 2EFVA 3Q8YA 4OX8A 2JFDA 3OL9A 3HHEA 3I0RB 2MZJA 4TU9A 5KFMA 5HBMB 3R5JB 1W26A 3W66A 3PYEA 4M5MA 1JKHB 2FGCA 4NRTA 3KLFB 1JIHA 5KT2A 4N8NA 5A6WA 3I56S 3NOGA 5GAEI 2BJ3A 1D09B 1IJEB 2YBVA 2E1CA 3M8RA 3HVAA 3AOBA 1VIXA 3I4HX 1GH8A 1S48A 4C8KA 3MI7X 1XNQF 3BDEA 2G2ZA 1N8RT 3BGOP 3TUZC 2XLIA 1TL7B 1RT7B 2FVCA 4C98A 2IA6A 2WTFA 4H4KA 2YNGB 4URQU 4U6PA 2QMXA 4IQXA 5H9EK 4OMFG 4UTGA 2X3GA 4TY9A 4ED6A 3BQ0A 4L72B 1IKVA 4JI5J 1I3OB 4J9SA 2FY8A 1B99A 1RTHA 4PG7A 4RW7B 3H42A 3IGNA 2BUNA 3M9OB 4F4ZA 3R5AA 1VLYA 1HNWF 4F2RA 2ZJRQ 4J9LA 4ZLNA 2R7TA 3TUJC 4ZVHA 1IR2A 5IQ6A 2OMLA 2YVSA 4PWDA 1AUDA 4NXMF 4Y2CA 1RQ0A 3PNIA 1SI9A 1LV5A 3TJAA 4X4SA 2KJVA 5CA5A 5K20B 4M63A 4NZ0A 2W4CA 3DOLB 1HIYA 4TU8A 3VVTA 2GA7A 2F5GA 4DL0C 2BOAA 4RW6B 2XGPA 1VQLS 4JV5J 4QOTA 1WNEA 2EVZA 4CT9A 1E6VA 4CIOA 3HVWA 1Q7YT 3KYLA 5JXSA 4PCQA 3T1AA 1Y5IB 2NSCA 3I5AA 2LA4A 3FNNA 4WFNQ 1AT1B 4G6VB 4ECTA 4OZ2A 3M2RB 5F41A 2FUG9 3T5KA 3TUIC 3PIPQ 2HVIA 3AXKA 3MUTP 4W92B 2DK2A 1RWKB 2IDEA 5DQIA 2Y8YA 2FC8A 2RD5C 4TU7A 3SMZA 3P5TL 4WKRA 2YKMA 1X9MA 2XYGB 4OYIA 3PO5A 2GVDB 2LYVA 4R5PA 1WHXA 4LF7F 4XDDA 3EX7B 2M52A 2AJ0A 3QJPA 5C7PA 2W25A 4FXVA 1W2BR 2JNJA 2M88A 1UEKA 3M7VA 1Y5NB 2Z0GA 4ZIWA 3P96A 3TA2A 5EN1A 3DHXA 2HRTA 1S59A 2K7JA 1EHWA 2IJRA 3NMAA 4DV0J 1MROA 1IBKJ 2KXHA 2HK3A 3MTKA 3H5SA 4EBCA 3T5HA 3OLAA 4Y65A 4UUXA 3CD6S 3MWBA 5LMUJ 2QFJA 1YJ7A 4Y6IA 1NSAA 5LSLA 2Y0BB 1X5PA 1FWKA 2DPJA 2WW4A 3ILJA 1RT5A 1SKUB 1HQUB 2ZH6A 2B6AB 2XSFA 3BB5A 2KKHA 3LALA 4Z7YA 5GAGI 2RHQB 2WVBA 2YKQA 2NS1B 2UUBJ 1NRKA 1F9FA 4M8LA 3CC4S 3UDEA 1SKSA 1DTQA 4B9NA 5A8WA 4FNHA 1RWOB 1Y3KA 4OYOA 2DNQA 4JI3J 1RISA 4DR3J 3TZYA 5AE3A 4FVMA 1VRUA 3V4IB 4CP5A 3TEGA 3PYFA 3OR2B 3C14A 3MECA 3AQPA 2PIIA 4HL9A 5FJ4A 3CJKB 2HBZB 2B8PA 4FPRA 1H2TZ 1UKUA 1BE4A 2DR7A 1LW0B 3V6KA 3K8WA 3VAHA 2NLWA 2QLJB 1NAQA 4ANEA 1A0OB 5KFFA 1MN9A 2QMUB 3W2VA 3SYZA 3IAS9 1S0NA 4AL7A 1IUJA 3CD0A 2XYHB 4WBFA 2Z2ZA 2VDIA 3PCOB 5FDLB 4O0IA 1GTHA 3W9IA 3OL8A 3TX8A 5KG5A 4QQBA 1B7YB 1VQMS 2NXJA 4O44A 4A8YA 1VQ4S 4CLZA 1Q79A 1AB8A 4WP3A 5KFSA 3VAGA 1AZSB 1FA0A 3PXGa 5IOLA 2WSFC 1RB0A 2PD1A 4EYIB 4OYZA 1X4DA 3LGMA 2NCKL 3F44A 3Q2TC 1WJ9A 2E1AA 5D15A 2RMLA 4IOBA 4OI4A 2VG5B 1KBRA 4LF5F 4JV5F 4YHHF 2F40A 5F8JA 4Q8EA 5CYJA 4NCGB 3DLJA 3TOQA 3GILA 3VCDA 3DLGA 1MSWD 2DIVA 3FCVA 1NK7A 3LQVA 2B9WA 3IS9B 3ZTRA 5HJXA 2RDDA 4BS2A 1S7HA 2Q6CA 2JFKA 1PYOB 4Y34A 3FCHA 3I0RA 3TQEA 5KFTA 3UCUP 3DDKA 3MEKA 1TZ0A 4H4MA 2FJBB 5B0EA 4DR4J 3KJVB 1JKHA 2UUAF 1XC9A 3RW7A 4X4PA 4K4VA 4F0MA 2PI5A 3DM2B 3M05A 4MYTA 2E44A 2HHSA 2E5HA 1UPPA 3QGGA 4JI8J 1K8AT 4YEAA 3QJLA 4ED5A 3IM9A 2MKSA 4I2PA 4LFCJ 3M8PA 1JNZB 3O2IA 3MDFA 1G3OA 3C66A 2EK1A 2QA2A 2VJUA 5FLXY 2B4OA 4YY3F 1IBKF 3QO9A 2DY1A 1WDTA 4F3MA 1EARA 1TL7A 4OI3A 2QL7B 5CYMB 4KE5A 1RT7A 4ES3A 4HTIA 5LMUF 1FDBA 4F3QA 1WORA 1GMWA 3AJ1A 1VC5A 5EX3A 4Y3CA 1BD6A 4QYZJ 4QR1A 1YBAA 4RW7A 2PI4A 3OR1B 1GX5A 2MKHA 4QPTA 2V8VA 3S7RA 2JEJA 3W61A 3H0PA 3ENQA 2D7SA 5KG4A 2UUBF 1UJ4A 2W4PA 2AJFE 2N4DA 4FYWB 1IXKA 2XLKA 3QQCD 4DR1F 3Q8QB 2HLUA 2GIFA 2WHOA 2EBEA 4JI3F 2R3VA 5CH7B 2VFTA 7FD1A 2XWYA 4DX7A 4DV2J 3TJ8A 1N5SA 1UWBB 3DOLA 2MSTA 4M94A 2C2MB 1HL6A 3OTOJ 2PO4A 3D0GE 3EJMA 3KNGA 4RW6A 1GEHA 5IXUA 4PG5A 3NCRA 1WKLA 1WDDA 4C3KA 2OUGA 2WVCA 4DBQA 5A0YB 3GYNA 2F63A 1FRJA 4FNIA 3CMES 5BYSA 1R27B 2CZ4A 4P71A 2LQBA 2XULA 4IFVB 2UUCF 3D3CJ 3W5ZA 5DG8A 2HRYA 2XO6A 4KHPF 4PKDB 3M2RA 2FJWA 2CXEA 1C2PA 2XTJP 5HSPA 4AL6A 2BXJA 5FD1A 1Y4ZB 4UQGA 3SCKE 5DDQC 5EUHA 2IM1A 3BSAA 4V19X 2HPUA 1VC6A 2HBRB 2CPIA 4GMKA 4NEZA 2XC9A 4UY8T 2KFNA 2GVDA 4M5IA 4WFXA 2H4YB 4AYBD 1H0HB 4CTAB 3NGRA 4KTQA 2LDYA 3KDOA 1N48A 3Q22A 2EFQA 5HMZA 4CCHA 2BVZA 4K4ZA 2FGOA 3FBCA 3MCNA 3I0SB 2N7CA 2C2RA 4JI0F 5DS7A 5HROB 1DAXA 2PMHA 1UETA 3R7NB 4RU9A 2RQKA 3T6BA 2NXNA 4NYZA 3BQ2A 1VLOA 2DIUA 3BR9A 4NLVA 4WIIA 2A18A 4KPCA 4LF6J 1WHYA 2ZZNA 1PIEA 3PRDA 4HH0A 2B8QA 5D0HA 2KXNB 3SSQA 4DR4F 3UO0A 3KHHA 1HQUA 4BWJA 2B6AA 3TAMB 1F9HA 3RBXA 4PG8A 5KFVA 4U96A 1GTEA 4N47A 3SBMA 4R0EA 3M9MB 3TZWA 5J1NA 4CLTA 3NAIA 2Z56B 4JI2J 3DOMB 3V4IA 1KVIA 3VZIA 3OR2A 2JVOA 1G2EA 5DDOC 4OYPA 5LJ5Y 3TI0A 2A2DA 2H5JB 4G1QB 3CJKA 3J80Y 1QAXA 2OFGX
chains in the Genus database with same CATH topology
1G4CA 3HSGA 3ILIA 1TMMA 5ETMA 5ETSA 1F9HA 1RAOA 3ILOA 5ETPA 1TMJA 5ETVA 1DY3A 4M5KA 1RU2A 3UD5A 3HSDA 3MCOA 3QBCA 4M5MA 5ETLA 3ILLA 2F63A 2BMBA 3HSJA 4PZVA 5ETTA 1CBKA 4CRJA 3KUHA 1RU1A 3HT0A 3KUEA 1EQ0A 3HSZA 4F7VA 1IM6A 5ETOA 5ETKA 1KBRA 4CYUA 1Q0NA 4AD6A 1RB0A 5ETRA 3UDVA 3MCNA 3MCMA 1HQ2A 3KUGA 4CYUB 3ILJA 2CG8A 4M5LA 5ETNA 3IP0A 2QX0A 4M5NA 4CWBA 1EQMA 2F65A 1EX8A 4M5IA 4M5GA 4M5HA 1HKAA 5ETQA 3UDEA 3HD1A 4M5JA 3HD2A 1RTZA 3HCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4C A;  3HSG A;  3ILI A;  1TMM A;  5ETM A;  5ETS A;  1F9H A;  1RAO A;  3ILO A;  5ETP A;  1TMJ A;  5ETV A;  1DY3 A;  4M5K A;  1RU2 A;  3UD5 A;  3HSD A;  3MCO A;  3QBC A;  4M5M A;  5ETL A;  3ILL A;  2F63 A;  2BMB A;  3HSJ A;  4PZV A;  5ETT A;  1CBK A;  4CRJ A;  3KUH A;  1RU1 A;  3HT0 A;  3KUE A;  1EQ0 A;  3HSZ A;  4F7V A;  1IM6 A;  5ETO A;  5ETK A;  1KBR A;  4CYU A;  1Q0N A;  4AD6 A;  1RB0 A;  5ETR A;  3UDV A;  3MCN A;  3MCM A;  1HQ2 A;  3KUG A;  4CYU B;  3ILJ A;  2CG8 A;  4M5L A;  5ETN A;  3IP0 A;  2QX0 A;  4M5N A;  4CWB A;  1EQM A;  2F65 A;  1EX8 A;  4M5I A;  4M5G A;  4M5H A;  1HKA A;  5ETQ A;  3UDE A;  3HD1 A;  4M5J A;  3HD2 A;  1RTZ A;  3HCX A; 
#chains in the Genus database with same CATH topology
 2BM0 A;  1OYE A;  1EIY B;  4DS5 A;  3R27 A;  2RUG A;  1LW0 A;  3I9V 9;  4J9R A;  4JUZ A;  2DR9 A;  2WBM A;  2D74 B;  4K4Y A;  3CDA A;  3CJS A;  1DBD A;  2RS8 A;  1WC4 A;  2Y1I A;  2DEI A;  5FDL A;  3V81 A;  4Y00 A;  2GQQ A;  4DV6 F;  4FDF A;  1N32 F;  3AAW B;  1YJV A;  4EZ6 A;  3K5P A;  3D6T B;  3HD1 A;  3QLH B;  5GAE U;  4DR6 F;  1P9Y A;  3CGI A;  2EI5 A;  2R7Q A;  1AZS A;  1B7F A;  5ETO A;  2IAJ B;  1KKH A;  1YBU A;  4DV2 F;  2QSF A;  5IT9 Y;  4A4J A;  3H4B A;  4PXC A;  3DKD A;  4YP3 A;  1SVD A;  3CCT A;  3OTO F;  3KLV A;  4I64 A;  2EFO A;  2QYG A;  1HWJ A;  4NCG A;  3W9H A;  1NJZ A;  4OZ3 A;  3D3B J;  3M6U A;  2V67 A;  4ZK7 M;  4I1T A;  2DYA A;  2BAB A;  2F9D A;  2D1C A;  1PAE X;  2PDA A;  1N5Y B;  3IS9 A;  5KG6 A;  2DRD A;  2KO1 A;  2XMW A;  3LTO A;  5ETM A;  5IFM A;  1PSD A;  4LF4 F;  3MM6 B;  1RTI B;  1WKJ A;  4QIV A;  4ILM A;  2CJB A;  1VCT A;  3HFZ B;  1Q0N A;  4ALZ A;  2CPH A;  4LF9 J;  1GMW D;  5BJR A;  4DR7 J;  4F4K A;  5B0F A;  2VQE J;  2VC0 A;  1QY7 A;  3QGH A;  4U67 Q;  2HBY B;  3OHB A;  4QWB A;  5D3G B;  1R6Y A;  2CG8 A;  2WZ1 A;  4PUO B;  3NLC A;  4I4B A;  3TX0 A;  4ECQ A;  5D4P A;  2ZVI A;  4IKA A;  2FHK A;  2ROE A;  1TKZ B;  1TL3 B;  1CPZ A;  3D4J A;  3ZTP A;  2IVM A;  1NU4 A;  3BS9 A;  2R4F A;  2IC3 B;  2HIQ A;  4RUH A;  1PJ6 A;  3TQ1 A;  1DAR A;  2ZBQ A;  2CKW A;  3IAM 9;  4QIF A;  3KOA A;  3N0V A;  4Q2M A;  5CYM A;  4LSZ B;  4LF6 F;  2ZD1 A;  3PJW A;  1ZTT A;  3ZXW A;  1TVR B;  1S12 A;  4JB8 B;  2B51 A;  2ZBI A;  4B08 A;  1D9D A;  2BE2 B;  5E3Q A;  4K4W A;  3H2V E;  1M5P C;  1L3K A;  4U8Y A;  2DHA A;  4ATN A;  3HHK A;  3MR3 A;  5D4N A;  3OR1 A;  1C1C B;  3PHT A;  4Z7C A;  2IVY A;  2DCU B;  3H2L A;  3IBF B;  1SJR A;  2BE9 B;  5A8R B;  2X1A A;  2C2E A;  4WYW A;  3GMG A;  4K59 A;  2AGP A;  1HI1 A;  3CC7 S;  2BQ3 A;  3W1Y C;  4A8W A;  3M9N B;  4M5D B;  1ZET A;  4LF8 J;  2XWX A;  2QMW A;  5KG3 A;  1S57 A;  1UW4 A;  3OSP A;  1SKW A;  4CNZ A;  4ZP8 A;  1UWB A;  2P9G A;  4FYV B;  1WAC A;  3V4M A;  1UVJ A;  3UFC X;  5BYQ A;  4OI6 A;  1VIS A;  2MZQ A;  3B4M A;  2LQ5 A;  1PBU A;  1ZAW A;  5A0Y A;  4RW8 B;  2OKQ A;  2ASJ A;  1FRL A;  3OL7 A;  4ZJO A;  1R8B A;  2GAG C;  3V6D B;  3KG0 A;  4I0W A;  1RT6 A;  3OJU A;  4IFV A;  2EK6 A;  2CQ4 A;  3MMA B;  4PRF A;  4JV1 A;  3E8O A;  3CCV S;  2IMW P;  1Z1Z A;  1WOO A;  2HGN A;  5GAG U;  4DLG A;  1KVJ A;  1M1K T;  1M0S A;  3FMB A;  4F4W A;  5D78 A;  2XYP B;  4DUZ J;  2EC2 A;  4QCL A;  4K5S A;  1WC3 A;  1F0X A;  5HMY A;  1KNZ A;  3NGT A;  2HWT A;  2CNK B;  2ATL A;  8ATC B;  2L3M A;  4YOE A;  2N3O A;  3VGS A;  2PC6 A;  3HDS A;  2POK A;  3IN5 A;  1PGZ A;  2ZHA A;  2YQ1 A;  2IHR 1;  1UMJ A;  1J5E J;  2OD4 A;  4ENO A;  1YRU A;  4CTA A;  1MW7 A;  3Q2S C;  1SXL A;  3MAA B;  3OXF A;  4ZOS A;  2M2B A;  3LF0 A;  3OXG A;  4JP8 A;  3CJ3 A;  1OQ6 A;  4JOU A;  4RNO A;  2AGO A;  5HRO A;  4H4O B;  2IM3 A;  3GR1 A;  1WOS A;  2LVW A;  1SJF A;  1B64 A;  1WD6 A;  1ZA2 B;  3HVT A;  3JXO A;  2RU9 A;  3DU5 A;  4B9M A;  5KFI A;  5HL7 Q;  5KFU A;  2ZH5 A;  2Z2Y B;  4USM A;  4C8O A;  4PR6 A;  2XI2 A;  3ELH A;  2ZZM A;  3DOK B;  4DR7 F;  2E7V A;  1N6Q B;  4MYU A;  1XR7 A;  2LFV A;  2XZT B;  3TYT A;  4ERD A;  2PFD A;  3BRE A;  2VQE F;  3PVX A;  4M5N A;  1SPB P;  1EX8 A;  3TAM A;  3J7A N;  2WON B;  4LBI A;  1JMT A;  2AIR B;  3QWU A;  2C22 A;  3ILL A;  2YXL A;  3M6X A;  2CUY A;  3HSZ A;  1K1S A;  2VG6 B;  2RRB A;  3KMS A;  2XY7 A;  1EQM A;  3G2X A;  1HKA A;  1WG5 A;  4LR7 A;  1MMD A;  1OMS A;  1UEV A;  3TA0 A;  3LP2 B;  2FVP A;  3SIP B;  5HP1 B;  2Q79 A;  2ROP A;  3DOM A;  3OQ2 A;  1D9F A;  2O1P A;  1RKI A;  2HQD A;  3GG1 A;  5BYR A;  4G1Q A;  3VGV A;  2W24 A;  1XK8 A;  5L1J A;  2GIQ A;  3RRH A;  1RHM B;  2V69 A;  2VH7 A;  4LR9 A;  5SUH A;  1QJH A;  3DXS X;  3W63 A;  4EGL A;  4BC7 A;  2Q3P A;  1AW0 A;  4RUB A;  3R97 A;  5H9E J;  4DJB A;  1BWV A;  4UOF A;  3R6G B;  3PFE A;  4X62 J;  2VHG A;  1ICE B;  4G1I A;  4CWB A;  1LWC B;  4DL4 A;  2F65 A;  5L9X A;  5RUB A;  4URS A;  5JVH Q;  3ETO A;  3MM9 B;  2I5J B;  4LF8 F;  1NJW A;  1LNQ A;  2IAJ A;  4HVZ A;  2QJ3 A;  3S01 A;  4B9T A;  1C4A A;  4K4U A;  2XS2 A;  1ITP A;  5ETV A;  1K0V A;  3MCO A;  3BJY A;  4NXN J;  1TKD A;  3PO4 A;  4MH8 A;  4P2M A;  4OQJ A;  3QZ7 A;  2P9C A;  3W65 A;  4CO4 A;  4GRS A;  1NJI T;  2XGQ A;  4DPU A;  2HZV A;  4KGM A;  3BQ1 A;  3GIM A;  3HSJ A;  4HT5 A;  2LLZ A;  2V4Q A;  1HD1 A;  1N5Y A;  5CCL A;  1HMV B;  3BBF A;  1FDN A;  3IO1 A;  3NXZ A;  2ZWO A;  3H59 A;  2VKR A;  1U47 A;  1VBK A;  2V5H G;  4MIA A;  3DXB A;  3MM6 A;  4KYZ A;  1RTI A;  1RAJ A;  1U25 A;  4JYA J;  4DUZ F;  4M95 A;  1S0O A;  2D9P A;  3KFW X;  3MM8 B;  2VD3 A;  3AJD A;  5KT6 A;  1HA1 A;  2YWF A;  2C3P A;  4IH6 A;  1J5E F;  3ONQ A;  1NKC A;  1PC4 A;  4X4T A;  4DV1 J;  5D3G A;  1FER A;  1VYA A;  4AXJ A;  4NLX A;  2E5L J;  4W98 A;  1TKZ A;  1TL3 A;  5KFY A;  1RAG B;  2K7K A;  2CNL B;  2WB4 A;  5K8O A;  1VQ8 S;  2XNR A;  2IC3 A;  3A8K A;  3HJV A;  3LP0 B;  2DB1 A;  2C2K B;  5KFO A;  3T1H J;  4YME A;  1VI7 A;  1VIO A;  2V4R A;  4WFB Q;  3UE2 A;  1KEK A;  5KG7 A;  3GJQ B;  1SC1 B;  3NWG A;  1JLG B;  4I6Y A;  4LJM A;  1TVR A;  1NUE A;  4NOH A;  3DI6 B;  3TVZ A;  3WX8 A;  3VAF A;  3UVJ A;  5EHH A;  1PJ5 A;  4DQR A;  2MY8 A;  1C1C A;  2XI3 A;  4YB7 A;  2VPX B;  3FSI A;  2XS5 A;  3GFY A;  2HLT A;  1WF1 A;  5A8R A;  4LQ9 A;  3RBZ A;  2FLP A;  3G71 S;  3DLB A;  2Z2L A;  2Z4P A;  2OP5 A;  1YJT A;  1AA1 B;  2UXB J;  4DQS A;  1LKZ A;  3RZA A;  2J0X A;  1I51 B;  2QA1 A;  3RTV A;  1FXD A;  4F4A A;  1RYS A;  2VUG A;  3MMB B;  4DUT A;  1QM9 A;  5KFB A;  3R2D J;  2IJN A;  1NZ8 A;  2JWN A;  2MEW A;  3A12 A;  1YI2 S;  2JL9 A;  2BZ2 A;  1FWP A;  4I67 A;  2FHJ D;  4TYA A;  2HFU A;  3ET6 B;  4RW8 A;  2V8H A;  1HWU A;  1UWA A;  4HEA 9;  4LIR A;  3KLH B;  2MSS A;  3IR6 B;  4OHY A;  5CAA A;  3V6D A;  4YS2 A;  1ZZN A;  4BDP A;  3EDR B;  3KHR A;  3D6F B;  4ECY A;  3MMA A;  1ZM3 A;  3HKZ D;  3QFH A;  4D3G A;  2HYI B;  2XY6 A;  3EXC X;  5JMN A;  2RSQ A;  5L46 A;  1TK0 A;  2AWZ A;  1S97 A;  4DL3 A;  2O5D A;  3CCL S;  3MPW A;  1WWH A;  1J2V A;  4B3O B;  4NXN F;  1Z2Z A;  2DNZ A;  3QRR A;  1JWW A;  1A9N B;  5DZ6 A;  2IDL A;  1BQN B;  3ZO7 A;  1Q81 T;  2G1H A;  3KHG A;  4DDF A;  4IYQ A;  4FKX A;  4R0J A;  4EMD A;  1BLU A;  2IBO A;  3PR4 A;  2QZ8 A;  3HPO A;  2VF3 A;  3FVY A;  4H4O A;  3Q24 A;  1ZYQ A;  1NK8 A;  2CG4 A;  4KFB B;  1RK8 A;  3H5U A;  2DR6 A;  3I96 A;  2QE5 A;  3V6H A;  1R8H A;  3OTB A;  3R8Y A;  3DRR A;  4DF8 A;  3UDV A;  4QR0 A;  3RRK A;  2R7W A;  4ZCM A;  2MMY A;  5K8M A;  3JTO A;  2D41 A;  2F8E X;  4NMX A;  3OW2 R;  3DOK A;  1B0V A;  1JK9 B;  2GQ2 A;  4WP8 A;  4ECX A;  2ACY A;  2AJ1 A;  1D8Y A;  3G82 B;  1D0E A;  3BN7 A;  3K2Y A;  1EAY C;  4DV1 F;  4WU2 A;  1XEZ A;  1X0P A;  1N34 J;  2V2Q A;  1VRQ C;  3TWZ A;  1FK9 B;  2A6M A;  2P5V A;  2VG6 A;  3MF5 A;  2E5L F;  1YG0 A;  3PDN A;  1FD2 A;  2VFV A;  2EG1 A;  3LP2 A;  3LA0 A;  4DZD A;  3Q86 A;  5HP1 A;  2DGW A;  3LW5 C;  2HVZ A;  3T1H F;  1JLC B;  2VFS A;  3MUR P;  3G86 A;  4LSN B;  2FVR A;  3RB0 A;  4P52 A;  4PAA A;  4LRB A;  1LK7 A;  2R2U A;  3RB6 A;  2FJE B;  2L9W A;  5T7L B;  4Z37 A;  1FE0 A;  4OZ1 A;  4PEO A;  2D9O A;  1CS4 B;  2NYI A;  3THT A;  5J1P A;  3LGN A;  1KQG B;  2CQC A;  4RNN A;  5F8N A;  1VQY A;  3HCX A;  2W01 A;  1P8G A;  4QIE A;  2UXD F;  3OUY B;  2A10 A;  1N33 J;  2O66 A;  1URN A;  2GQC A;  2GMH A;  1JLE B;  1EET B;  3MOJ B;  1PG5 B;  2AHO B;  1LWC A;  1S1W B;  3ZC4 A;  1KOO A;  4MIW A;  3HZG A;  1S6U A;  3R9L A;  2OD6 A;  3MM9 A;  5M2P A;  2HVH A;  4IR9 A;  2I5J A;  4ETZ A;  2H65 B;  1FRX A;  2CNN B;  4GKK J;  2BJ8 A;  4YR0 A;  1RAE B;  2DNK A;  4PWU A;  3GP9 A;  2YNF A;  2VZ9 A;  3E2E A;  1P6T A;  1PYS B;  3WZ0 A;  5B0C A;  2AKW B;  4DUY J;  3HMJ G;  3CTR A;  1CSJ A;  3GE9 A;  3ZZZ A;  3I32 A;  3MFI A;  2Z58 B;  4I2Q B;  4WJB A;  2J0W A;  3PKY A;  2VC1 A;  1IKW B;  4NLS A;  1X9W A;  2W4D A;  4YUD A;  1YJW S;  3M8Z A;  4TLR A;  2HHV A;  3HT3 A;  3BO2 A;  2DNP A;  3E01 B;  2KYZ A;  2DNR A;  1CJT B;  1M5H A;  1QD1 A;  3H7H B;  1GK8 A;  2NXU A;  1S79 A;  1N56 A;  2AP6 A;  3PYD A;  4WIQ A;  1DTT B;  1U24 A;  2ZFH A;  1TAQ A;  3I5B A;  5G4D A;  3G6E S;  3MM8 A;  2ILY A;  1C1B B;  4EWT A;  1KQS R;  3LAK A;  1N4L A;  2OI2 A;  3CVK A;  1Q95 G;  4ZN1 A;  5LJ3 Y;  2H9Z A;  3EZ5 A;  1Y11 A;  2G1D A;  2ZDO A;  1L3U A;  2V9W A;  3EM1 A;  2W2O P;  3J80 U;  1X4A A;  3SDE B;  4MK8 A;  3K58 A;  1YK9 A;  5HVG A;  5KFC A;  4L3K A;  1HWK A;  1XN9 A;  2RU3 A;  1RUS A;  1NHV A;  2ZNZ A;  3MEE B;  4EYH B;  2C2Z B;  4A47 A;  4FYD A;  1KN6 A;  4E98 A;  3LP0 A;  2ZH4 A;  2BE7 D;  2QA4 S;  5CZX A;  4NLY A;  2ZOG A;  3CNQ P;  1JLG A;  2CQ1 A;  1SC3 B;  4AFF A;  4TYB A;  2X1B A;  4OJ1 A;  2ZHB A;  1SC6 A;  4DX5 A;  1FI4 A;  4ETX A;  2IRU A;  4CYU B;  1UAW A;  3LUY A;  2DGU A;  2DO0 A;  1OY9 A;  3IBW A;  5IC4 B;  4KSE B;  1BMQ B;  4DV3 J;  3FGV A;  1N54 B;  5EX0 A;  2IM2 A;  5E3R A;  1XTZ A;  3SQG B;  4LRE A;  1HI8 A;  4OV1 A;  4OV6 A;  3WBZ A;  2DHG A;  3GYG A;  1DQ8 A;  3G9C A;  2ZDP A;  2ZM6 J;  4J9M A;  1VK8 A;  4I7F B;  1SL1 A;  1XMB A;  4EO6 A;  4ZLJ A;  5E33 A;  1EKS A;  2EPI A;  2ZEJ A;  2JC1 A;  2RHS B;  3LAM A;  3QT8 A;  4OLO A;  3MR5 A;  2OPP B;  4N41 A;  4HHJ A;  5DLG A;  2H4W B;  2L9N A;  2V8D A;  5C42 B;  4OFZ A;  3MMB A;  4MKY A;  1TV6 B;  1IM6 A;  1WEX A;  3ZNU A;  4K4T A;  2QLF B;  5CD4 H;  1S76 D;  3GYX B;  5IWA J;  2VOP A;  2UVW A;  4J9V A;  1U1Q A;  3GSD A;  2EW9 A;  2JEG A;  3KLH A;  1U6F A;  2EWH A;  3EGN A;  5CYQ B;  1WTB A;  2FJD B;  2VDH A;  5KG0 A;  4BC9 A;  4X4R A;  2GFF A;  3TVK A;  3JB9 k;  1QTM A;  2RQC A;  3OD2 A;  1Q78 A;  3R3T A;  4CO5 A;  3RBE A;  3J7A 1;  5D6G A;  3EIC A;  2GIR A;  4O3Q A;  3OV7 A;  3F0N A;  4B02 A;  2CPD A;  4K0K J;  1BQM B;  3T5J A;  4X66 J;  3Q8S B;  3OTC A;  1V9O A;  4M5H A;  1HR0 F;  1JLQ B;  2WK4 A;  4EI2 A;  1K44 A;  9RUB A;  3UNY A;  3L9Z A;  5HAN A;  1SQG A;  3FQK A;  2DNG A;  3THP A;  4DSE A;  3JSB A;  3CCE S;  2HNY B;  1Q16 B;  4FN5 A;  1P1L A;  1XIQ A;  1BQN A;  2LMI A;  3GG0 A;  3DRX A;  2NPI A;  2F8M A;  3IBC B;  4O3R A;  2BV3 A;  1S1T B;  4WE1 B;  1H38 A;  2V2Z A;  4ECS A;  4L73 A;  3ISN C;  4USW A;  2DRA A;  3KMQ A;  3OFE A;  2R8G A;  4KFB A;  2MQQ A;  4IOA Q;  3DFE A;  3HM9 A;  2ZJP Q;  3M2V A;  1JJ2 R;  4FXD A;  1NDK A;  4HDG A;  3H40 A;  1VQS A;  2J9D E;  4ZIT A;  3NKY A;  3EDQ B;  1TL1 B;  1H2V Z;  5BR8 J;  1U1M A;  1IBL J;  4P75 A;  2L9D A;  4H54 A;  2RF2 B;  2IY5 B;  3CSK A;  2VA3 A;  3Q8U A;  1FCA A;  4ECU A;  2DNL A;  1UFK A;  2PA8 D;  1NND A;  3MM7 B;  4HT7 A;  3I4P A;  2R9L A;  4OHW A;  3AB2 B;  3G82 A;  2QYC A;  1LXJ A;  4LF2 A;  1B0T A;  2OFH X;  1FK9 A;  4QIG A;  2JZ5 A;  1WEZ A;  1FVS A;  1X60 A;  2R42 A;  3KLE B;  3CCR S;  4NE9 C;  1FJG J;  4E8U A;  4Q7A A;  4KC5 A;  5KFE A;  1NHK L;  1VQ6 S;  2QLW A;  2YKN B;  2FVS A;  3BGL A;  2AYB A;  3CJ4 A;  4MIB A;  2DEJ A;  1D3W A;  1JLC A;  2I9S A;  3NS7 B;  4KAI A;  3V2U C;  4LSN A;  2HMI B;  1AXQ A;  3R7S B;  5HVH A;  4FYX B;  3QJJ A;  1F60 B;  5T7L A;  2J7K A;  4AQY J;  1CS4 A;  2AD9 A;  4P7V A;  2I2Y A;  2AJ2 A;  1UJ6 A;  4WFY A;  2N3L A;  4DV3 F;  4RKU C;  1EJ7 L;  2MLY A;  1VJW A;  1U2C A;  4UUW A;  5EGY A;  3DLK B;  1X7V A;  3EUN A;  3EVW A;  2FIU A;  2QRR A;  2XS7 A;  2MJU A;  2LQ8 A;  3OUY A;  2DGX A;  4F02 A;  2YKO A;  1JLE A;  1EET A;  3GWC A;  2IYI A;  3H2U B;  1S1W A;  2FDN A;  2KRR A;  4LRD A;  2KI2 A;  4WFZ A;  1AFI A;  3PX4 A;  2E9T A;  2HWI A;  3SXL A;  2CQH A;  1NME B;  5KOX A;  2X3D A;  3KK3 B;  5KT3 A;  4OLP A;  4IRC A;  1OQ3 A;  2ZBP A;  2V8G A;  5KFD A;  4NLP A;  1R3N A;  2ZUG A;  2CPE A;  3OFH A;  4QJV A;  1FRH A;  5E3C A;  4J9Q A;  5DJB A;  1XNQ J;  1ELO A;  2RVJ A;  2CJX B;  3RB3 A;  2WCX A;  3PR5 B;  1UVL A;  4OYX A;  4ID5 B;  2CZV C;  5IWA F;  3GQC A;  1LEO A;  4OX9 J;  1IKW A;  2JRS A;  3BYP A;  2W9C B;  3UD3 P;  2VB6 A;  4QR2 A;  2NUH A;  1ROF A;  1LQ9 A;  3CWJ A;  1KVK A;  7AT1 B;  3C19 A;  1BGX T;  1S10 A;  1CJT A;  3OFF A;  2K3I A;  3OSN A;  3D1H A;  2CNO B;  4LBP A;  3BEG B;  2Q6B A;  5J1E B;  3PW4 A;  3HVR A;  1VR6 A;  1DTT A;  4K0K F;  2IJF A;  4X66 F;  5HO4 A;  1RU2 A;  2JEF A;  4PG4 A;  1KTQ A;  4PYD A;  3W8G A;  1WG1 A;  1ZM9 A;  2QN6 B;  5HI7 A;  1HNW J;  3LGH A;  5J2P B;  4NXM J;  5E41 A;  2ZE2 A;  1YQH A;  1ZA1 B;  1HYS B;  2R2R A;  4J91 A;  3THV A;  4ZP9 A;  3BSN A;  2XZD B;  3SDE A;  4ZKA A;  2XMK A;  2DGO A;  5EWE A;  4CLS A;  2HQG A;  1BXN A;  4QWD A;  1U02 A;  4F2S A;  3MPY A;  2MKC A;  4NEY A;  1F1B B;  3MEE A;  1PBA A;  2Y9H A;  3H5Y A;  1LXN A;  4EO8 A;  4F0K A;  3KHL A;  1RAB B;  4DLE A;  4OJ3 A;  3L3C A;  4EZ9 A;  1T95 A;  2J9E A;  1RSC A;  4B3R F;  4Y2K A;  3CCZ A;  1QE1 B;  3OLB A;  4C7Q A;  3EWG A;  2N4C A;  3Q8R B;  2HHH J;  4ZVR B;  3O6Q A;  4CH0 S;  1UFL A;  3WC2 A;  4ZPB A;  2DHS A;  2H1Y A;  5HMX A;  1IQT A;  2CPZ A;  4C0B A;  1N5V A;  2F7V A;  2KHC A;  3SQG A;  5CCM A;  3RBD A;  1JJC B;  2AEM A;  5IT4 A;  4NZ6 A;  5J2N B;  2LXI A;  2DHX A;  2ILZ A;  2KT2 A;  3R6L B;  2JEI A;  2W2M P;  4OL8 A;  5ADZ A;  2QTW A;  2MQL A;  4I7F A;  1YX2 A;  3FBF A;  3ICL A;  3V5R A;  4JI6 F;  5KTQ A;  3KUE A;  3CJ8 A;  2M0G B;  2PT0 A;  4U7U D;  1Q1K A;  4HI2 A;  1VFJ A;  1RWU A;  2XCP A;  2F4V F;  2OPP A;  2B7C B;  2C2D A;  3EZO A;  1S4F A;  5C42 A;  1TV6 A;  1VBY A;  2CWX A;  5CXT A;  3UW1 A;  1IKY B;  1T9W A;  3HK2 A;  2AMC B;  4AQY F;  2AZ3 A;  3T5L A;  3NOC A;  4CLU A;  1FFW B;  2CDR B;  2C28 A;  1M1H A;  3CPW R;  3FKB A;  3NL0 A;  1IJF B;  2VG7 B;  2YH1 A;  1TKX B;  1R0C B;  3Q0A A;  5EDW A;  3M30 B;  5CYQ A;  5AJ3 F;  3AHP A;  4ED3 A;  2ZC3 A;  1T9Y A;  1PCA A;  4BBY A;  1BQM A;  1JXE A;  1O8B A;  1VBZ A;  5G0R B;  1YVF A;  1MLA A;  2ZH3 A;  3CCS S;  4DMZ A;  1T05 B;  2HGM A;  1U2R A;  3OL6 A;  4L76 A;  1U1N A;  3E3X A;  2D3Z A;  2HNY A;  2B5J A;  1KTV A;  4C6A A;  2MB0 B;  3POT A;  4LIW A;  5KFP A;  3J81 j;  2X1F A;  2YNI B;  2XLJ A;  1S1T A;  4OX9 F;  4LUB A;  2G9O A;  4WE1 A;  3PFO A;  5L38 A;  1VQK S;  1ACM B;  4JV0 A;  2QC3 A;  4G1P A;  5D0E A;  5HVF A;  2MQN A;  5AXL A;  3MOZ A;  4X64 F;  1WEY A;  3HP6 A;  3D2W A;  5KFQ A;  2UVU A;  3WHI A;  2P6S A;  3NG8 A;  4DL5 A;  3N6N A;  2HAI A;  4F7V A;  2XB2 D;  1TL1 A;  2QIF A;  4OYA A;  4AUK A;  1K0T A;  2VKZ G;  3H4D A;  2IRX A;  2OO4 A;  4FBT A;  1T9V A;  3MM7 A;  3HX9 A;  3CD5 A;  3PY8 A;  4LF1 A;  3R1H A;  1CLF A;  4C0O C;  5K14 B;  2AJ4 A;  4RNM A;  2D3O 1;  4ED8 A;  2XSJ B;  1FEH A;  3D68 A;  4UST A;  3KLE A;  3E51 A;  2VA2 A;  4LF5 J;  2LA6 A;  4YHH J;  2RNE A;  2YKN A;  1D9A A;  2VON A;  5DO2 A;  1KP6 A;  4NML A;  1N0V C;  5D4O A;  5KG1 A;  1EQ0 A;  1Y0H A;  2GO8 A;  2F9J A;  4ELU A;  3PEJ A;  4CLP A;  2HMI A;  3O3L A;  3WIV A;  4PYA A;  2NRE A;  2CJQ A;  4KB7 A;  1XR6 A;  1U1O A;  4CDI A;  2HHH F;  1X4F A;  1C0U A;  3H8Y A;  3Q8P B;  3CIM A;  3SEO A;  4HTJ A;  1W7W A;  1BWE A;  4DFJ A;  3DLK A;  2ZNY A;  2DO4 A;  3JTP A;  2LCW A;  1Q7L B;  1GMU A;  2CA9 A;  4A8S A;  1VQO S;  2UUA J;  3PTW A;  2E66 A;  3FBE A;  4DFK A;  2MGZ A;  2OPR B;  4DQP A;  4UOG A;  1FJE B;  3UR0 A;  4DCP B;  3G6X A;  2A1B A;  5DGB A;  4O4R A;  1SJ3 P;  3K5L A;  2HS0 A;  3KK3 A;  3GON A;  3QAE A;  1RT1 B;  2EEY A;  5ETS A;  3HSD A;  2MHE A;  3K5N A;  1HI0 P;  4RZR A;  3UN2 A;  3VAM A;  2DR5 A;  4YY3 J;  4ID5 A;  3D6H B;  3KWM A;  2FZK B;  5KFK A;  3DLL Q;  5DDP C;  1RWN B;  4DR5 F;  1FDD A;  4L75 A;  2AEJ A;  3GB0 A;  2P2C B;  5LXR A;  2W9C A;  3C16 B;  1XR5 A;  4WK3 A;  4TY8 B;  1U09 A;  4ED2 A;  2B4U A;  2OEJ A;  5HQ8 A;  3I87 A;  3UD5 A;  1UEU A;  2OAU A;  1NK4 A;  3SZ2 A;  3TNV A;  2EFG A;  2QLX A;  4DI6 A;  3EVO A;  5DQH A;  5H9F J;  3HUL A;  5J2P A;  4DR1 J;  3K8V A;  1S6O A;  4XIU A;  1VDH A;  2O3D A;  3QBC A;  4YDX A;  1HYS A;  1YGY A;  4GKJ F;  3B78 A;  1U26 A;  2CQG A;  4XK8 C;  4DV5 F;  3I9Z A;  3C2P A;  2HWH A;  4HHH A;  3ZZU A;  2YQ0 A;  1MWQ A;  2KM8 C;  4Y2M A;  1RT4 B;  4GO7 X;  4WTO B;  1JLF B;  1PO6 A;  2YWK A;  5CAB A;  1XQI A;  1QE1 A;  1ZBT A;  4ZS6 A;  2UUC J;  1X4G A;  5KFL A;  1CJK B;  4F36 A;  1NKE A;  4KHP J;  2HND B;  4OHZ A;  1NK5 A;  2OPQ B;  1YIJ S;  1VHF A;  4RNF A;  4LRC A;  1KSP A;  3D67 A;  1HHS A;  4ZPA A;  5ETL A;  2XEX A;  5J2N A;  2DH7 A;  3SCI E;  1O5J A;  5F9N A;  1NH7 A;  5LSO A;  4CI0 B;  2DNH A;  1B70 B;  5L1I A;  2NXC A;  1NLK L;  1U1K A;  4KBI A;  1QDU B;  2W7A A;  1W2I A;  3BSC A;  3N28 A;  2MLZ A;  3QFW A;  3CJ5 A;  4P73 A;  3BBC A;  5AE2 A;  3JS9 A;  4JI0 J;  2A3J A;  2CQ3 A;  1CVJ A;  1TL5 A;  2BQR A;  3P49 B;  1IBM J;  2JJ4 D;  4AD6 A;  1IKY A;  2JVR A;  3F73 A;  3AY0 A;  2EG2 A;  2FQQ B;  3K7R A;  1EZZ B;  4J7C A;  2OTJ S;  3MAQ A;  2L41 A;  1WC6 A;  4IG0 B;  2P6T A;  4NI2 B;  2Z57 B;  3NNC A;  1HW8 A;  3DLH A;  5IT0 A;  4ECR A;  3M30 A;  3D9B A;  5HBM A;  4IO9 Q;  2AQ4 A;  3HHL C;  4PXD A;  3PHE A;  1PIL A;  1N52 B;  3R5C A;  1WI6 A;  1ZAX A;  3KKF A;  3KLF A;  3G8Q A;  3Q8V A;  2RB7 A;  3D1O A;  2AX1 A;  4LRA A;  1U48 A;  2HBQ B;  1OPI A;  3W62 A;  1YIT S;  2WBR A;  3JSR A;  1RWX B;  3NRB A;  2DPI A;  1T05 A;  1ULR A;  1FKO B;  3I55 S;  3RR7 A;  1HNX J;  1UTA A;  3TJ9 A;  1RTD B;  1LK5 A;  2HFZ A;  5LM7 E;  3IR7 B;  3AD9 C;  4KQZ A;  2MQ8 A;  2RT3 A;  3QPI A;  2YNI A;  5ETT A;  2GX8 A;  2YNG A;  1FTC A;  3O44 A;  4F8R A;  3QGI A;  2GZO A;  3N5F A;  5A6P A;  1FX4 A;  1N5T A;  4ER8 A;  1VGY A;  4Y2I A;  3TW0 A;  2YWW A;  1PKU A;  2MZ1 A;  2KZM A;  4G3I A;  2Y8W A;  4DOZ A;  2M3D A;  1FFG B;  3P3D A;  2HHT A;  4DV6 J;  1N32 J;  2W9A A;  1XNR J;  1OSC A;  5GVQ A;  2VOD A;  3HT0 A;  2VQF J;  4DR6 J;  3M32 B;  4R8U B;  4DEZ A;  4CO0 A;  1IKX B;  1ZTW A;  4DHV A;  4MKB A;  2VPW B;  2NQP A;  3SV4 A;  2BJD A;  2ZZT A;  3NGS A;  2H54 B;  3TAN A;  5U47 A;  5K14 A;  3SCJ E;  4MTP A;  2AEF A;  2WSE C;  2YX1 A;  2XSJ A;  2B3T B;  4NRU A;  4ZPT R;  3WQP A;  3X1L B;  3HJF A;  2DR8 A;  3DMJ B;  2HIY A;  3PW7 A;  4GO5 X;  1FVQ A;  3KLG B;  3VAJ A;  1P9Q C;  1OYD A;  3ULH A;  3QNW B;  5IC6 B;  4C48 A;  1DLO B;  3ENW A;  1QUP A;  3EZU A;  5B0G A;  2KT3 A;  1SIZ A;  1YKW A;  2DNO A;  1BHN A;  3MTJ A;  3HZE A;  3BYR A;  4J9O A;  1CBK A;  3QRP A;  3IWX A;  1GXT A;  1IBC B;  1RT2 B;  3D28 A;  3MCM A;  4USK A;  4LF4 J;  4HLB A;  5E5N A;  4FF3 A;  4Q44 A;  2KTQ A;  4RW4 B;  5AXM A;  3RRG A;  5HLF B;  1RGV A;  4OX6 A;  2HHU A;  2HFN A;  3FJ2 A;  4NLG A;  5THW A;  4HDH A;  2GV1 A;  1SH3 A;  2XY5 A;  4IR1 A;  1QVG R;  1R8C A;  1TEL A;  4OJH A;  1RAF B;  5KT4 A;  2M8D B;  4ID8 A;  2DH9 A;  4C4W A;  1RT1 A;  1IBM F;  4AE5 A;  1T02 A;  1I5O B;  3DC2 A;  4C97 A;  1QSS A;  3O5T B;  1YDL A;  2R2S A;  1ZH5 A;  4WZM A;  1KFS A;  4NLT A;  4CLK A;  2B7B B;  4Y2A A;  4R25 A;  3TP2 A;  2EC0 A;  2HZC A;  2XM3 A;  3GCW P;  3ADA C;  3C16 A;  1TAU A;  5LMN F;  5SZT A;  1VOM A;  4LFA F;  4RNH A;  4KY3 A;  2GAH C;  3T3F A;  1S5Z A;  1Q4R A;  1QSL A;  4KRW A;  5B09 A;  3AQO A;  3A4T A;  1HWI A;  4NA2 A;  3ZTO A;  2MDA A;  3G96 A;  4DL2 A;  3W8P A;  3FMW A;  1ZS6 A;  3P6Y C;  4NYP A;  2GJF A;  1HNX F;  3W60 A;  2DGQ A;  2ZOM A;  1APS A;  4OZN A;  2JLE A;  1TUW A;  1OJ4 A;  3BO4 A;  1SC4 B;  1U1L A;  1VQ7 S;  4RPF A;  1M1G A;  4CLY A;  2CQ2 A;  1S99 A;  4MK9 A;  3G4S S;  3BKU A;  4WXO A;  1FFS B;  5KFG A;  3QAT A;  1Y3J A;  2J6T A;  1LW2 B;  1JLF A;  3LPY A;  3MED B;  3UNG C;  4RBU A;  3NNA A;  3IWN C;  4N8O A;  2MTL A;  4FXW A;  4RU2 A;  1T9T A;  3ILO A;  3FZ2 A;  4CT8 A;  2NZ4 A;  4ZP7 A;  1FHT A;  1M5O C;  4EBD A;  1CUL B;  1HBO B;  3HKW A;  4ILR A;  2V2V A;  1CJK A;  5I3Q A;  1OS5 A;  2HND A;  1XNR F;  2FHO B;  5E7O B;  2G13 A;  2Q1L A;  5DZ7 A;  2PMZ D;  2VQF F;  2OPQ A;  2VBZ A;  1H6K X;  2C2O B;  1OSD A;  1S9G B;  1KQF B;  2MLX A;  1PAU B;  1TKT B;  3LOU A;  1S7I A;  3U27 A;  1QAY A;  2LQ9 A;  4WZQ A;  3J7Z 5;  3HF5 A;  1NXI A;  1URR A;  4B3S F;  1DY3 A;  1R0B G;  2VJV A;  3KK2 B;  4F3O A;  2KT5 A;  2HHQ A;  2VG5 A;  1QLN A;  4YQW A;  3J7Z T;  4RR5 A;  4OI1 A;  1FT8 A;  3BKF A;  1NB2 A;  1HW9 A;  3PEH A;  1G1X A;  2DD8 S;  3L7U A;  2BJ7 A;  3DNC A;  4IH5 A;  3QT7 A;  1RLD A;  4P74 A;  5EWG A;  2MZR A;  1Z4U A;  4USV A;  1X5O A;  3VVU A;  3HHD A;  1F5B A;  2B4P A;  4X4U A;  4PG6 A;  4OZL A;  4IG0 A;  4NI2 A;  2VPZ B;  5J2Q B;  4C8Y A;  1NK6 A;  3KTQ A;  3RGI A;  2FC9 A;  3AA9 A;  3T9N A;  2FZC B;  4K50 A;  1R89 A;  3KJV A;  1SBR A;  4RUA A;  1X5S A;  1RAC B;  4OYM A;  4ED1 A;  3DM2 A;  2UUT A;  3OVS A;  5KFN A;  3AD7 C;  1UFW A;  1CJV B;  1I1G A;  2KVI A;  1Q8L A;  2E5J A;  2EKY A;  1YLX A;  2X7I A;  4K4X A;  1FRK A;  2BAC A;  3SFG A;  1FKO A;  2QV6 A;  2IRY A;  1RTD A;  2JLG A;  4KJI A;  1RAA B;  2PEB A;  4I68 A;  1B3T A;  1RAD B;  5EWF A;  4AXI A;  2Z30 B;  4DU8 A;  1RLC L;  4RWW A;  3SQO P;  5T41 A;  4H4M B;  3GIR A;  2VOO A;  3JQK A;  2K1R B;  1NSK L;  3RU0 A;  3I5C A;  2CDQ A;  1RWP B;  4FYY B;  4O3N A;  5LT5 A;  1OO0 B;  3TUP A;  2HHW A;  1B0P A;  2KU7 A;  4DL7 A;  2FVQ A;  2UVR A;  3QSI A;  1TFW A;  4I2P B;  2QG9 B;  3UN5 A;  3M8P B;  3NY0 A;  2HQI A;  3MPU B;  2GJI A;  3JTN A;  3AD8 C;  4F4X A;  1UCN A;  2DY9 A;  5K8P A;  1FES A;  1WC0 A;  5HJY A;  2VIH A;  2RQM A;  3QO9 B;  2G0C A;  3NCQ A;  3M32 A;  4C11 B;  3VAI A;  4R8U A;  3PG9 A;  2PEH A;  1IKX A;  3BSO A;  4LSL B;  2GNK A;  1F5A A;  4PPZ A;  4AL5 A;  3QSY B;  1FEE A;  3S8S A;  2YPZ A;  4QU7 A;  1MU2 B;  5AE1 A;  3Q83 A;  3R7B B;  3GSI A;  3NWR A;  3M8Y A;  4F4Y A;  1JJ4 A;  2HW3 A;  3DMJ A;  4ZVF A;  2V4J B;  5KT5 A;  3UDC A;  2B43 A;  3KLG A;  5F3T A;  3DRP B;  5I3U B;  3SI8 A;  3DLE B;  2EBG A;  1GXL A;  4YR2 A;  1T11 A;  1DLO A;  4B9L A;  1REV B;  4DFP A;  3SFU A;  5CZV A;  3MPV A;  4ZVE A;  1HBU B;  3B8H A;  2E1R A;  4A8K A;  3IC1 A;  2ZJQ Q;  4ELV A;  1RT2 A;  3GLJ A;  3ZZT A;  1U8W A;  5B0D A;  3I31 A;  4TN2 A;  2ASY A;  2HS4 A;  2ZKU A;  2Y1J A;  4K4S A;  3ZTS A;  4RW4 A;  5HLF A;  4JI7 F;  3QID A;  4KT0 C;  1M5V C;  3KDN A;  4DQI A;  1Y5L B;  4YB6 A;  3CO9 A;  4B9V A;  3PM9 A;  4Q43 A;  4C9D A;  1S1V B;  4NLD A;  5D77 A;  1AYE A;  2XMV A;  1T03 B;  2LP4 A;  4ZA1 A;  2C3Y A;  2XCA A;  3NP5 A;  5K8N A;  4AT1 B;  1V5V A;  1YTY A;  2GO9 A;  2FHJ A;  4N56 A;  3I0S A;  4MT1 A;  2E7X A;  4PXB A;  4NL5 A;  1UVI A;  1EB0 A;  3C15 B;  1GXU A;  2V8P A;  3CJT A;  4USI A;  1NPR A;  5F0W A;  4JI1 F;  2C3O A;  3EVM A;  3NMR A;  1GFW B;  2Y3Y A;  2MZT A;  3NGU A;  1RHU B;  4ZVU B;  1VQN S;  1RHQ B;  2Y1R I;  4DV4 F;  1LWE B;  3BH6 B;  5F8L A;  1X0F A;  4WTY A;  1TP7 A;  1FNM A;  1MMN A;  4F26 A;  2V6A A;  4CH1 A;  4ANC A;  1R0A B;  1T3O A;  4DF4 A;  1VC0 A;  3MGJ A;  4WU3 A;  3BPS P;  1H7X A;  1WC5 A;  3SSR A;  5GAD I;  3VQS A;  4RW9 B;  1NJX A;  3D0I E;  5T14 A;  1WG4 A;  2K06 A;  2B4V A;  2IA0 A;  1N5Q A;  2SXL A;  4K8R A;  3VQT A;  4ELT A;  2VPY B;  3UDL A;  2WB1 D;  2KM8 B;  3EE3 A;  3N01 A;  1H74 A;  1CJU B;  1FRI A;  1LW2 A;  3S1T A;  2BKP A;  1RJJ A;  4NLW A;  1NDL A;  3MED A;  3W9J A;  1KOH A;  3NEK A;  2ZBR A;  2ZKT A;  1Q5V A;  5GMD A;  4YR3 A;  5GAH I;  4CNY A;  1T9X A;  2OIH A;  3MXH P;  1CUL A;  1HBO A;  2YY3 A;  1RU1 A;  1XMQ J;  2HQF A;  3MZI A;  1FD8 A;  4QIW D;  1R6V A;  3QLH A;  9ATC B;  2XMJ A;  4ED0 A;  1LWX A;  2XG8 A;  4B3M J;  3EGW B;  3DGP B;  5DM7 Q;  2ACM A;  1SB6 A;  2UV8 G;  1S9G A;  3W7B A;  3RAQ A;  5AT1 B;  1X4E A;  2QL5 B;  1TKT A;  2EXU A;  3M4X A;  4F25 A;  3CDW A;  4EU0 A;  2FPH X;  3TRG A;  2FD2 A;  4JI5 F;  3VTI A;  2OSQ A;  3BM7 A;  4TQR A;  1SIW B;  3EMT A;  1Q8B A;  3OT9 A;  3KK2 A;  4GC6 A;  2I0X A;  2M5Y A;  3I82 A;  2NR0 A;  1U6Z A;  3V81 B;  3CD7 A;  3T41 A;  3ILI A;  3NCP A;  3J7Y I;  1A6L A;  4RBV A;  4IG3 B;  1P1T A;  5LSR A;  1ZM4 A;  1RBO B;  1BC6 A;  2GGP B;  3G8S A;  3CO0 P;  1FJ7 A;  5J2Q A;  1TFY A;  3ISN D;  1RAI B;  3D5M A;  2ZVS A;  4QPX A;  1S6P B;  1AFJ A;  1HLW A;  1NDP A;  3HHL B;  3VWS A;  3TAQ A;  1ARO P;  3DU6 A;  3KXD A;  1F3V A;  4I6W A;  1I6J A;  4X65 J;  3TAR A;  4WP9 A;  1VHI A;  2ZH9 A;  2COL A;  4NLO A;  1J5O B;  4OZ5 A;  1WC1 A;  4PUO A;  4C8N A;  1HAR A;  2JHE A;  1CJV A;  4C3M A;  3IMQ J;  3FQL A;  3BKT A;  3CUN A;  2F4F A;  1TK5 A;  2I1R A;  2R7S A;  1IQZ A;  1MG7 A;  2RIL A;  4O3S A;  4BWM A;  5A76 A;  3MMC B;  2BKO A;  2WVD A;  2LEB A;  5F8I A;  1I94 J;  2LEP A;  2V34 A;  2K1R A;  4PQA A;  4DV7 J;  2J9C A;  3HFV A;  4Q45 A;  3B54 A;  1FE4 A;  1HWL A;  1U6B A;  5LL6 d;  1S9E B;  2BE2 A;  3GPA A;  1X4B A;  4USU A;  2HGL A;  2BQU A;  4O0N A;  2XMU A;  2GML A;  5I4M A;  1NDC A;  2WW8 A;  2E1M C;  4O23 A;  4A8X A;  2CJY B;  2FLL A;  4DFM A;  1U45 A;  2UXD J;  2B9Y A;  4PXE A;  4DV0 F;  2E5G A;  3F41 A;  1VRT B;  3BDP A;  2LEC A;  3OPK A;  4ZPC A;  1X31 C;  1SV5 B;  3O1L A;  3LP1 B;  2U2F A;  4C11 A;  2C3U A;  2ZD1 B;  2FB0 A;  4LR8 A;  4LSL A;  1CG2 A;  4M5D A;  1V3S A;  3M8W A;  3EYZ A;  1YZ7 A;  4IUF A;  1MML A;  1HQE B;  4GVB B;  2CRL A;  1NZA A;  1MU2 A;  2DBB A;  2V94 A;  1MWY A;  4X2B A;  2B0G A;  4O3P A;  2RRA A;  4C2M A;  2V4J A;  2P8I A;  2QX0 A;  2HVD A;  1RKJ A;  2H3E B;  2GVZ B;  1PYT A;  3DRP A;  5I3U A;  1YSJ A;  3UR3 C;  3DLE A;  2C3M A;  3UPF A;  2MQM A;  1JXV A;  3Q23 A;  2FLN A;  2LEA A;  3MPD A;  3BF4 A;  3CCQ S;  2A6O A;  1KD1 T;  1WEL A;  2KXF A;  3OFG A;  4WWS A;  2EFP A;  2L48 A;  2BDP A;  1REV A;  4CH7 A;  1A7G E;  4DR3 F;  4MKA A;  1XMQ F;  1M5S A;  2OGU A;  4X4Q A;  1HBU A;  5H9F K;  2M9K A;  2CJA A;  4OHV A;  4B3M F;  2VBY A;  1NBE B;  4ZN3 A;  4P2F A;  4DPW A;  4FS1 A;  2RJZ A;  1OY6 A;  3CC2 S;  1FX2 A;  1TMJ A;  2R8J A;  2W8L A;  1WHV A;  3M6V A;  2ALY B;  3GIK A;  1HBM B;  4ECZ A;  2DT9 A;  4FKY A;  4K2J A;  2XMT A;  1S1V A;  1T03 A;  3IFE A;  3IG1 B;  1U49 A;  4J9N A;  1RT6 B;  1FNO A;  4ECW A;  1H2U X;  3MAA A;  4C3L A;  1Q5Y A;  2DXE A;  2HNZ B;  1WSV A;  2MPU A;  8RUC A;  4UT4 A;  4U8V A;  2M70 A;  4UY8 5;  2R2T A;  5KFA A;  3C15 A;  4X4N A;  2J9D A;  4ZVG A;  3NNH A;  3AB4 B;  1GT8 A;  2GCF A;  2QT7 A;  5F8M A;  4ZIV A;  2KHD A;  4KGZ B;  2ZH2 A;  3MHY A;  3G87 A;  5HN0 A;  1NCL A;  4KO0 B;  5CHC B;  1GMV A;  2FJA B;  2M4M A;  1L3T A;  4OZJ A;  1LWE A;  1D1U A;  2KRB A;  4S0M A;  1N6Q A;  2X51 A;  3MR6 A;  1U1P A;  4U7U K;  4X65 F;  1R0A A;  3QIP B;  4W4M A;  1GQE A;  2WON A;  2XO7 A;  4M5J A;  1K9M T;  5F0U A;  3MMJ A;  1T8E A;  1ZPW X;  4QWE A;  1MWZ A;  2G4B A;  4DN9 A;  1YRT A;  2WAQ D;  3H90 A;  4WXW A;  2X1G A;  2QFI A;  2R7V A;  3HVT B;  5C25 B;  3DHW C;  4RW9 A;  1V3R A;  4UQT A;  1WKK A;  1IWG A;  3QWP A;  4YB1 P;  4BCA A;  3DRY A;  1JNR B;  5IQQ A;  4ZMM A;  3K57 A;  4C8Z A;  5A2Q U;  1I94 F;  2UXC J;  1HFE L;  3IM8 A;  4DV7 F;  1TMM A;  3IRX B;  1Y9O A;  3DGV A;  2Y1L B;  1WSR A;  3OXL A;  4LMZ A;  2V0N A;  4UOC A;  2J7U A;  1WUU A;  2BMB A;  3NS6 A;  2WRM A;  1CJU A;  2BRK A;  4KGV B;  3PIO Q;  4JI8 F;  3K5M A;  3HFK A;  4LFC F;  1RZM A;  2ZWP A;  2VBX A;  2VFU A;  1XBW A;  3OVB A;  3RJM B;  1SQF A;  2NPF A;  1J27 A;  3CE8 A;  2J7W A;  4PPD A;  1TQL A;  3A8E A;  1C0T B;  3FDS A;  2W2Q P;  2ADB A;  3C46 A;  3IWL A;  1X5T A;  4USJ C;  2V50 A;  1U1R A;  1UPM B;  4RLE A;  3DGP A;  2E29 A;  4W90 B;  4HHU A;  8AT1 B;  1RA6 A;  2DVI A;  5AXN A;  3G6V A;  1HR0 J;  2XNQ A;  5DQG A;  2B9X A;  4DXL A;  1NM2 A;  4N7T A;  4QWC A;  3VV2 B;  2AF6 A;  1V6H A;  3FSX A;  1RDR A;  4ICL B;  4RWX A;  3GCX P;  2GHW A;  2R8K A;  5KFJ A;  3MFH A;  1RI7 A;  4UF4 A;  2FTR A;  3BV8 A;  3G8T A;  4P2S A;  2W9B B;  4FS2 A;  2BEF A;  5KFH A;  3FZB A;  1OY8 A;  5HMW A;  4E2F B;  5L8R C;  2XMA A;  4ZPV R;  1IR0 A;  1E6Y B;  5C2C A;  4YDD B;  4WFA Q;  1V5I B;  3MUM P;  2CJ9 A;  2K8G A;  4IG3 A;  2H48 B;  3CMQ A;  5C24 B;  1YWX A;  2G2Y A;  2W2N P;  1VMB A;  2J6S A;  1NH8 A;  2PE8 A;  2CZ9 A;  1HMV A;  5E2Q A;  1S0M A;  4MMO A;  1DJ0 A;  5GMK a;  2XZW A;  2GGP A;  3D6M B;  2KYX A;  2DGV A;  2OPS B;  2L08 A;  2OHD A;  2ZHO A;  4UOH A;  3FEY B;  1S6P A;  1JB0 C;  5MLC V;  2IVF B;  3HHL A;  2GS8 A;  4HH1 A;  1HNZ J;  4DCO B;  2FYX A;  3VR1 A;  5CQG A;  2BM1 A;  3JSY A;  4PZV A;  3A3O B;  5C5J A;  1SH0 A;  2BW2 A;  1J5O A;  2CIM A;  2HEK A;  4MKV A;  4CO2 A;  3CCU S;  2LXU A;  2QSW A;  2V63 A;  3L09 A;  3W2W B;  2WVE A;  3N9U C;  4I56 A;  2IPO B;  5KAK A;  4ZJL A;  3UD4 P;  3KK1 B;  2H51 B;  2KFZ A;  3MMC A;  1QSY A;  1ZM2 A;  3N4W A;  3QYY A;  1OPZ A;  4K2X A;  2ASD A;  3AFG A;  3KJF B;  2OH2 A;  2KH9 A;  1S9E A;  3FEZ A;  3DI6 A;  2W7P A;  4TXS A;  4B17 A;  1K47 A;  2YKA A;  1FDA A;  5E3A A;  3FK4 A;  4L3N A;  4Q5V A;  3OTD A;  2IIH A;  4F67 A;  4NX9 A;  5KOW A;  1S77 D;  3TA1 A;  1VRT A;  1UVK A;  2LXF A;  2B9E A;  2YTC A;  1SV5 A;  3LP1 A;  2IBK A;  3TZZ A;  4DR2 J;  4GVL A;  1NEE A;  3CDE A;  2DTJ A;  1REG X;  3MM5 B;  4OHX A;  5ETQ A;  1HQE A;  3CDB A;  4GVB A;  2AYG A;  1UA0 A;  1R7I A;  3TEH B;  3UVJ B;  4EEY A;  3ETM A;  2ADC A;  4L6V 3;  3WIU A;  2BA9 A;  2DIT A;  2UXC F;  4NA3 A;  4QWA A;  3M8S A;  2M8H A;  4FF2 A;  2YX4 A;  1NJY A;  3PW2 A;  1F9E B;  2GVZ A;  3MR2 A;  2PN6 A;  4DU7 A;  3ET6 A;  3UCZ P;  1VQ5 S;  2ZOF A;  4ZPD A;  3A3P B;  1NK0 A;  3X3U A;  3W5X A;  4BLG A;  3BR8 A;  1QTN B;  2NXE A;  2YPY A;  2IFX A;  1N36 J;  1T0T V;  4WF9 Q;  4JI2 F;  1RAH B;  3ZZO A;  2HS3 A;  1LOU A;  1RE1 B;  4U95 A;  4B3T J;  4HKQ A;  4NA1 A;  2G0I A;  1SJ1 A;  2DXF A;  4ED4 A;  1F2H A;  3UWT A;  4KKO B;  3J81 U;  5GAD U;  1O6X A;  1KS2 A;  2GJ2 A;  3W5Y A;  3FRZ A;  2BR0 A;  2K2P A;  4RO0 A;  5DG7 A;  2JH3 A;  1HBM A;  4NWB A;  7FDR A;  4O3O A;  3JAM Y;  4XTT A;  4B9S A;  4ZVQ B;  4B3O A;  5D4L A;  1HNI B;  3IG1 A;  1SUQ B;  4OYB A;  2XQC A;  1P27 B;  2H5I B;  1RWW B;  1ZPV A;  2HNZ A;  4C0H A;  4HYK A;  4RUC A;  2D3U A;  5I3P A;  4I6A A;  6FDR A;  5GAH U;  3MCS A;  3LWM A;  4KO0 A;  4B3R J;  2V68 A;  1OIA A;  3LWL A;  4A8M P;  3VHQ A;  2R7U A;  3BGF A;  1H7W A;  3HHN B;  1DQA A;  3PX6 A;  3PKM A;  4FF1 A;  3CUL A;  2BJ1 A;  4NAS A;  2F1F A;  1HNZ F;  3GFH A;  3VAL A;  1FRM A;  1TUV A;  3QIP A;  2FZG B;  2RDJ A;  4H4K C;  4P72 A;  4DN0 A;  3DYA B;  1O0P A;  1RAO A;  1VS3 A;  3A8I A;  2RE1 A;  2WSC C;  4CO1 A;  1U4B A;  4IRK A;  5JUM A;  4F04 B;  2HG4 A;  2V2K A;  3DRR B;  1F6T A;  5C25 A;  3NBP B;  2DKO B;  3OTE A;  5B08 A;  4JI6 J;  2NYH A;  1YJU A;  3AA8 A;  4TLQ A;  1S9F A;  3CIZ A;  1UP1 A;  2VU5 A;  2KDO A;  1UVM A;  4LF9 F;  1F3F A;  3J7Y U;  1X9S A;  3LPE A;  4DX8 H;  2F4V J;  3RAX A;  2JC0 A;  4D3H A;  2F8H A;  2QLB B;  1Y00 A;  3IRX A;  1Z2L A;  5IV4 A;  1IN0 A;  1KFD A;  1SH2 A;  1NSQ A;  4O4G B;  5IM0 B;  4M1K A;  4B9U A;  5J2M B;  4M5K A;  1ZOT A;  2OEK A;  1M5K C;  5AJ3 J;  3PW5 A;  2E9R X;  5K5M A;  4NCB A;  1UZD A;  2GMJ A;  1C0T A;  4J9P A;  1SL2 A;  2I8E A;  1BUX A;  1JJH A;  1FXL A;  2MYF A;  4P10 A;  4OYW A;  4P6Q A;  1WI8 A;  4LVN P;  4DR2 F;  2FHM A;  3L7O A;  2M7S A;  2AX0 A;  2YWG A;  3ZZP A;  1T9U A;  4OZ0 A;  2YWH A;  3HHL D;  1G6B A;  2U1A A;  1HBN B;  5HQL A;  2E9Z A;  4ICL A;  2DNM A;  3SCL E;  4KV8 B;  4CZC A;  2XHC A;  2W9B A;  5ETK A;  3WC0 A;  3RYL A;  2E5I A;  4I2Q A;  2CQB A;  4K5R A;  4FZV A;  4KPY A;  3PV8 A;  1E6Y A;  4FP9 A;  2KL8 A;  2ZH7 A;  1N36 F;  3E01 A;  5C24 A;  4X64 J;  1LWF B;  3AJ2 A;  1KWM A;  1FO1 A;  4DSI A;  4IDK B;  4KIA A;  1S1U B;  4KH0 B;  3U02 A;  2EKN A;  5DDR C;  4B3T F;  5KFW A;  2YKP A;  2CQ0 A;  3FBB A;  2YNF B;  2OPS A;  2QEX S;  3ZZY A;  3B82 A;  2OMO A;  2MJN A;  3U1M A;  4C8M A;  3NGD A;  1C1B A;  2BJ9 A;  3DN9 A;  3N5B A;  4ZVO B;  3GIJ A;  2DXD A;  3KJN B;  2E1P A;  4ZVP B;  3B6B A;  3W3S A;  3AOA A;  1K1Q A;  3FUY A;  1FKA F;  3KLI B;  1KDN A;  1W25 A;  1JQG A;  4CQ1 A;  3ZZR A;  1R43 A;  4X84 A;  5ITH A;  1VBX A;  4IO1 A;  3H98 A;  1BQX A;  3PJ9 A;  2AV5 A;  3W2W A;  1Y10 A;  3VGT A;  2C42 A;  1HHQ A;  4EBE A;  3AT1 B;  2DJW A;  3KK1 A;  3OJS A;  4QW9 A;  4LFB J;  1WHW A;  1RWV B;  4DS4 A;  3NS5 A;  1FJC A;  1KLM B;  3ZTQ A;  3IR5 B;  3CJ2 A;  3CCM S;  4QU6 A;  3NAH A;  4CYU A;  2J0S D;  4DPY A;  1V3Z A;  4DZ6 A;  3VGU A;  3D7S B;  4UZC A;  3FCW A;  1YBT A;  3M6W A;  2E7W A;  1S1X B;  3TAP A;  5L1L A;  2XBP A;  1CC8 A;  4XAK A;  3MR7 A;  2RH3 A;  5A8K B;  3T19 A;  4IQM A;  1IM4 A;  2W1B A;  1KR4 A;  1YZ6 A;  4DPX A;  2HZA A;  1XMO J;  3MM5 A;  3GJS B;  5E3P A;  1NHU A;  1K73 T;  2LU2 A;  4KHR A;  2PA3 A;  2G0J A;  4XPE A;  5ETR A;  2UZA A;  4LT6 A;  3M8Q B;  5L39 A;  4WCE Q;  5F3Z A;  1S0V A;  5D0G A;  3PYG A;  3K89 A;  2B56 A;  5KFX A;  3MUV P;  2W2P P;  1SJQ A;  4RL1 A;  4DR5 J;  1TTH B;  2CFX A;  1SCJ B;  3C6U B;  4YFU A;  4G65 A;  4ZVS B;  1OWX A;  1HHT P;  5L1K A;  3A8J A;  5BXI A;  1UVN A;  2RUS A;  1TK8 A;  3JYT B;  1IR1 A;  1VJQ A;  1YRX A;  1F5C A;  2HK2 A;  4KKO A;  3IP0 A;  3WX4 A;  1JLQ A;  1F2G A;  2A0F B;  4FPI A;  1RA7 A;  2AYE A;  1RXO B;  2VBW A;  4ZLL A;  2CVE A;  1HNI A;  1SUQ A;  1VQ9 S;  2CPY A;  3N79 A;  1RT3 B;  3RW6 A;  3TZX A;  2ATC B;  4GKJ J;  1NPP A;  2YH0 A;  4X62 F;  1U7L A;  1RCX B;  4ES2 A;  4Q8F A;  4DV5 J;  5M2R A;  4NLR A;  2DGS A;  2BKN A;  3UN3 A;  1JLA B;  4Y0F A;  3N6L A;  5K9F A;  5DG9 A;  2KG0 A;  4I69 A;  2DH8 A;  5MAO A;  2HUR A;  2QL9 B;  2A2C A;  3BBB A;  3K59 A;  2LU1 A;  4QYR A;  1DHM A;  4RJV A;  2D69 A;  2O01 C;  2BX6 A;  5DLF A;  2HFS A;  3M2U B;  3K17 A;  4P2X A;  4MK7 A;  3BH7 B;  2RF2 A;  3TO8 A;  5FLX U;  3ITH B;  1B4S A;  5HQM A;  3GV5 B;  4F50 A;  5IZH A;  2HVE A;  4KH1 B;  1ZZF A;  2W8K A;  3DYA A;  4YN3 B;  1G4C A;  3MEG B;  1UW9 A;  2VFR A;  1H73 A;  5F9L A;  3M2V B;  3NBP A;  4Q0B B;  3N6M A;  5ETN A;  3CJQ A;  5IS2 A;  2ALZ A;  4JYA F;  2CWK A;  2GHP A;  2ZH8 A;  1BY9 A;  2KN4 A;  4LFB F;  2C1E B;  2VV5 A;  4ED7 A;  1GAO A;  1XJW B;  1SQE A;  2Y0S D;  3C6T B;  4HR2 A;  4DQQ A;  1NK9 A;  1RBA A;  2YNH B;  1S49 A;  2C2N A;  1R8P A;  2BRL A;  5DET A;  1S4E A;  1LFP A;  1CQN A;  1EKR A;  3JQM A;  2DNN A;  3CW2 C;  3BGR B;  2ROG A;  5B7W A;  4TQS A;  4L74 A;  5HAT A;  4O4G A;  5IM0 A;  3QT6 A;  4ZCL A;  2BJE A;  1TUG B;  2J5A A;  5DGA A;  1NPK A;  1L3S A;  2FJV A;  2OSR A;  4OJG A;  5J2M A;  2AT1 B;  1LFW A;  2BAN B;  1RTJ B;  2ERR A;  4E0D A;  1U2F A;  4FF4 A;  3MD1 A;  1XMO F;  1CC7 A;  1S6Q B;  1SKR A;  2Q43 A;  5FII A;  4OI2 A;  3P4U B;  4Z2X A;  4KGK A;  4J37 A;  1H3D A;  3R5B A;  1HBN A;  3QGP A;  1JLB B;  4A8F A;  3HD2 A;  3HSG A;  3FFI B;  3EGV A;  3LH2 S;  3GFX A;  3GII A;  3TR5 A;  1Q86 T;  3C8Y A;  2HSE B;  4HI1 A;  4KV8 A;  4ILL A;  3D54 A;  5B0A A;  4ZJQ A;  1EP4 B;  3AH6 A;  2R8H A;  3CMA S;  2R7O A;  3IRW P;  5DRK A;  3S6E A;  4PQU B;  2RS2 A;  3PRB A;  1YJN S;  2MKJ A;  3L95 X;  1LWF A;  3Q89 A;  3ENA A;  2UXB F;  2HQC A;  4IDK A;  3L4B C;  5J1E A;  2UU9 J;  1QVF R;  1S1U A;  1Q53 A;  4ZVT B;  1X8D A;  4LVO P;  4DSK A;  4IRD A;  6FD1 A;  1DQ9 A;  2HAF A;  3GR0 A;  3EXY A;  3RAM A;  1U8S A;  2RAQ A;  1HPZ B;  3VF0 B;  5GME A;  1JX4 A;  3U7J A;  2KVQ E;  3EGZ A;  4QYZ K;  2JSX A;  1L5U A;  1TR0 A;  1Q8I A;  3P8B B;  3ZFV A;  4V19 J;  4RX6 A;  2LKZ A;  3CED A;  3H20 A;  3KLI A;  2ZC4 A;  3BN4 A;  4FVC A;  4K7Q A;  2YQ3 A;  4CM0 A;  2WVF A;  1T3N A;  2IYG A;  5F8H A;  2MQO A;  1TU0 B;  3EPI A;  1JXL A;  3FRY A;  4XDC A;  2HQ3 A;  1NB7 A;  2XMM A;  3GV8 B;  2BOP A;  3CJR A;  3OVA A;  4CLW A;  1U0H B;  2FJX A;  4IOC Q;  3FC9 A;  3DDN A;  4J9U E;  2Z8Q A;  3QMQ A;  5DM6 Q;  1IVZ A;  2PMW A;  4NCA A;  3FEX B;  4MFB B;  2WOM B;  4FBU A;  3PW0 A;  1KLM A;  1XER A;  2ZE2 B;  4LQ3 A;  5E0O A;  2DHH A;  3W64 A;  1D8Z A;  2KZZ A;  2AJQ A;  4EFA C;  2YWE A;  5B0B A;  1MN7 A;  2JDJ A;  2KJW A;  2BW7 A;  4ZHR B;  3GJR B;  4DG1 B;  3CT9 A;  3UI3 A;  2RRN A;  2FLO A;  2OEM A;  2GW8 A;  1S1X A;  4ECV A;  3I6P A;  2CYY A;  4Q2L A;  4BHQ A;  4DSL A;  1H72 C;  4M5G A;  2R7X A;  5A8K A;  3GFZ A;  4JI4 J;  2EFN A;  1DRZ A;  2N7Y A;  3GU0 A;  1DUR A;  1HNV B;  2OLW A;  5I42 B;  3BZQ A;  3LAN A;  2NZC A;  1GNK A;  2DRB A;  3MAH A;  3OHA A;  1CQM A;  2Z2M A;  2Q66 A;  3RG6 A;  3JSM B;  1FKP B;  2JOQ A;  4F0H A;  3CJ0 A;  4OIX A;  1RHR B;  3M8Q A;  2UP1 A;  2RKI B;  3AXM A;  1KON A;  3K0J A;  1N34 F;  3QT5 A;  3QRQ A;  2UUW A;  4P7T A;  1T7P A;  1Q8K A;  3IGV A;  5IT9 U;  2MKY A;  2APO A;  2VG7 A;  3DRS B;  2MKK A;  2OEL A;  1TKX A;  4ITS A;  1C4C A;  3C6U A;  1UZH A;  2AYM A;  5F8G A;  5LMN J;  3AOD A;  1RWM B;  4LFA J;  4HAC B;  3ZNJ 1;  2DGT A;  3JYT A;  2CJK A;  3U1L A;  2CPX A;  4USH A;  4M5L A;  4P9S A;  5G0R A;  3M1V B;  3B4D A;  4IFY B;  3PJX A;  1Q82 T;  3ZZ0 A;  5IV3 A;  3DDI A;  2KG1 A;  4N76 A;  2AGQ A;  2PFF B;  4OI0 A;  3HXM A;  3L7P A;  4V1A k;  3A3N B;  5KFR A;  4DL6 A;  2QA4 G;  3BGU A;  1UA1 A;  4N5S A;  1RT3 A;  1RYR A;  1N33 F;  3R1L A;  3LO3 A;  4TNO A;  3PZP A;  4CO3 A;  2JLF A;  1X4H A;  2MHN A;  1JLA A;  3O8W A;  3R2C J;  4WKY A;  3GTY X;  5LXY A;  6AT1 B;  4U7C A;  2CAD A;  4XO0 A;  1SJ4 P;  4A8O A;  4GKK F;  2GHV C;  5KFZ A;  2KFY A;  1TL4 A;  2UU9 F;  2ZH1 A;  1H98 A;  4LBH A;  3KUH A;  4DCJ B;  5HK4 A;  3D66 A;  3M2U A;  3GJT B;  2BBE A;  1VQP S;  5D8H B;  2AW0 A;  3ITH A;  4AND A;  2B5J B;  3V6J A;  4DUY F;  3KNA A;  2LQJ A;  1UJ5 A;  4GC7 A;  3POT B;  2R8I A;  2RIJ A;  2J76 E;  2OJ3 A;  1FNX H;  5LOQ A;  1XWL A;  1L3V A;  2ZUA A;  4Y28 C;  3MEG A;  1Y7P A;  2HRU A;  3BPD A;  1IKV B;  1RHJ B;  3T1Y J;  4J90 A;  3BO3 A;  1IWA A;  1RTH B;  4CLF A;  4B3S J;  4A8Q A;  3IXQ A;  3KG1 A;  4Q0B A;  3UCG A;  3SV3 A;  1VK3 A;  1WOP A;  4EK2 A;  2DIS A;  4KHM A;  4CM2 A;  2NSB A;  1QAI A;  4ZCK A;  2HHP A;  2CQD A;  3CF5 Q;  4N77 A;  2R7R A;  3C6T A;  2YNH A;  1NKB A;  4TKT A;  1HD0 A;  4PWD B;  5KT7 A;  2IMO A;  5A2Q Y;  3BGR A;  2I6W A;  3OBI A;  4DSF A;  1ZAV A;  1S72 S;  1R8A A;  3RUB L;  2CPJ A;  3JQJ A;  3QAU A;  1UL3 A;  2YX7 A;  3MD3 A;  3D0H E;  2O67 A;  3VAK A;  2UV8 A;  2GC8 A;  2BAN A;  4ZLP A;  1DZ5 A;  1RBL A;  1RTJ A;  2BYC A;  4TVA B;  5JVG Q;  2RDI A;  2CVI A;  4J5O A;  4EUV A;  5L9N A;  3JAM U;  1E6V B;  5C2G A;  1YJR A;  3KUG A;  4JI4 F;  2V9K A;  3ENV A;  3RB4 A;  2OPR A;  4MJK A;  4NZ7 A;  4A46 A;  2RQ4 A;  2ASL A;  1S6Q A;  5ETP A;  1DFD A;  4UW2 A;  2VAS A;  1M90 T;  2J8S A;  3CCJ S;  3C3L A;  1C0U B;  4PWW A;  3P5B P;  2ABY A;  2G2O A;  4OX7 A;  3NGK A;  1JLB A;  1SL0 A;  3FFI A;  1U0S A;  4ES1 A;  3US5 A;  1N0U A;  4WK1 A;  4NPO A;  1KHV A;  2DNY A;  3CDU A;  2YKM B;  2NUU G;  4IH7 A;  4PAB A;  3SSS A;  4DX6 A;  1EP4 A;  5AXK A;  2ZM6 F;  1WF0 A;  1NO8 A;  3KJQ B;  4R5P B;  2MGZ B;  4PQU A;  2CQI A;  3QZ8 A;  1KLN A;  3CB4 A;  1QUV A;  3PRV A;  2QGF B;  1FTR A;  4ZPW R;  4TY8 A;  5D0R A;  1FF2 A;  1O51 A;  5CD4 A;  2J0Q D;  4J9K A;  1WTF A;  2MY7 A;  3F56 A;  4QZV B;  2AZ1 A;  1RCO B;  4DSJ A;  2ZIT A;  5HAO A;  4DPT A;  1HPZ A;  1G7C B;  1MRO B;  3R5D A;  5M2U A;  1PJ7 A;  2MKI A;  2N82 B;  2F3J A;  1NSP A;  4U9R A;  2CAJ A;  2PSZ A;  3T6J A;  3ISZ A;  4ZDN A;  4CRJ A;  2DCL A;  1KC8 T;  4C8L A;  4DPO A;  2VIC A;  3GZ7 A;  3EPG A;  2JX2 A;  1RT5 B;  1CEZ A;  1RHK B;  1RTZ A;  4KGX B;  3RR8 A;  1U0H A;  1RT4 A;  1X4C A;  4A48 A;  1KHW A;  3FSY A;  3G6Y A;  2VL1 A;  3WDO A;  4XPC A;  1GX6 A;  3R5G A;  5JJB A;  3D1Q A;  1FXR A;  4MFB A;  1DTQ B;  2AU0 A;  2PGC A;  2WOM A;  1RP5 A;  5A8W B;  4QW8 A;  2W7O A;  3UQS A;  2OTL S;  4X4V A;  1VRU B;  2J6U A;  4LRF A;  2HKE A;  3TVY A;  4KR0 B;  3C14 B;  3DCA A;  3MEC B;  3H25 A;  5H1S V;  4ZHR A;  4MAK A;  4DG1 A;  2CPF A;  1T94 A;  2MXY A;  2H5E A;  4URG A;  3CXC R;  4CLL A;  3CCW A;  4JV2 A;  3AOC A;  2UVV A;  1R31 A;  2J8A A;  3KG4 A;  1FWL A;  4JI7 J;  2K3K A;  3T1Y F;  2HFO A;  1KQK A;  3VZH A;  2KB2 A;  2XHW A;  3A1Y G;  3W2V B;  4QBU A;  3P45 B;  2D3O R;  4ZP6 A;  5BR8 F;  3T9Z A;  4X4O A;  1IBL F;  1HNV A;  3GV7 B;  1QAJ A;  5I42 A;  3HLU A;  3H5X A;  4WPA A;  2HHX A;  1WF2 A;  4O44 B;  1YHQ S;  4YB5 A;  4DWI A;  3JSM A;  4NLU A;  1FKP A;  1N88 A;  4WYL A;  2CQP A;  2MQP A;  2RKI A;  4JI1 J;  2P9E A;  2HFV A;  3U1N A;  3HI9 A;  2I38 A;  3DRS A;  3PX0 A;  4NYO A;  4DV4 J;  1FJG F;  4UZB A;  2QO3 A;  1KRP A;  4LF7 J;  2FY1 A;  1AUS L;  3A13 A;  4JBC A;  4HAC A;  1PC5 A;  2MZS A;  3DLG B;  3K5O A;  1MNE A;  3HO1 A;  1HQ2 A;  3J81 Y;  4NLQ A;  1YJ9 S;  2LDI A;  3M1V A;  3IA0 A;  4IFY A;  5KG2 A;  4ZCI A;  4RBT A;  3PAC A;  2IM0 A;  2ZBC A;  2EFV A;  3Q8Y A;  4OX8 A;  2JFD A;  3OL9 A;  3HHE A;  3I0R B;  2MZJ A;  4TU9 A;  5KFM A;  5HBM B;  3R5J B;  1W26 A;  3W66 A;  3PYE A;  4M5M A;  1JKH B;  2FGC A;  4NRT A;  3KLF B;  1JIH A;  5KT2 A;  4N8N A;  5A6W A;  3I56 S;  3NOG A;  5GAE I;  2BJ3 A;  1D09 B;  1IJE B;  2YBV A;  2E1C A;  3M8R A;  3HVA A;  3AOB A;  1VIX A;  3I4H X;  1GH8 A;  1S48 A;  4C8K A;  3MI7 X;  1XNQ F;  3BDE A;  2G2Z A;  1N8R T;  3BGO P;  3TUZ C;  2XLI A;  1TL7 B;  1RT7 B;  2FVC A;  4C98 A;  2IA6 A;  2WTF A;  4H4K A;  2YNG B;  4URQ U;  4U6P A;  2QMX A;  4IQX A;  5H9E K;  4OMF G;  4UTG A;  2X3G A;  4TY9 A;  4ED6 A;  3BQ0 A;  4L72 B;  1IKV A;  4JI5 J;  1I3O B;  4J9S A;  2FY8 A;  1B99 A;  1RTH A;  4PG7 A;  4RW7 B;  3H42 A;  3IGN A;  2BUN A;  3M9O B;  4F4Z A;  3R5A A;  1VLY A;  1HNW F;  4F2R A;  2ZJR Q;  4J9L A;  4ZLN A;  2R7T A;  3TUJ C;  4ZVH A;  1IR2 A;  5IQ6 A;  2OML A;  2YVS A;  4PWD A;  1AUD A;  4NXM F;  4Y2C A;  1RQ0 A;  3PNI A;  1SI9 A;  1LV5 A;  3TJA A;  4X4S A;  2KJV A;  5CA5 A;  5K20 B;  4M63 A;  4NZ0 A;  2W4C A;  3DOL B;  1HIY A;  4TU8 A;  3VVT A;  2GA7 A;  2F5G A;  4DL0 C;  2BOA A;  4RW6 B;  2XGP A;  1VQL S;  4JV5 J;  4QOT A;  1WNE A;  2EVZ A;  4CT9 A;  1E6V A;  4CIO A;  3HVW A;  1Q7Y T;  3KYL A;  5JXS A;  4PCQ A;  3T1A A;  1Y5I B;  2NSC A;  3I5A A;  2LA4 A;  3FNN A;  4WFN Q;  1AT1 B;  4G6V B;  4ECT A;  4OZ2 A;  3M2R B;  5F41 A;  2FUG 9;  3T5K A;  3TUI C;  3PIP Q;  2HVI A;  3AXK A;  3MUT P;  4W92 B;  2DK2 A;  1RWK B;  2IDE A;  5DQI A;  2Y8Y A;  2FC8 A;  2RD5 C;  4TU7 A;  3SMZ A;  3P5T L;  4WKR A;  2YKM A;  1X9M A;  2XYG B;  4OYI A;  3PO5 A;  2GVD B;  2LYV A;  4R5P A;  1WHX A;  4LF7 F;  4XDD A;  3EX7 B;  2M52 A;  2AJ0 A;  3QJP A;  5C7P A;  2W25 A;  4FXV A;  1W2B R;  2JNJ A;  2M88 A;  1UEK A;  3M7V A;  1Y5N B;  2Z0G A;  4ZIW A;  3P96 A;  3TA2 A;  5EN1 A;  3DHX A;  2HRT A;  1S59 A;  2K7J A;  1EHW A;  2IJR A;  3NMA A;  4DV0 J;  1MRO A;  1IBK J;  2KXH A;  2HK3 A;  3MTK A;  3H5S A;  4EBC A;  3T5H A;  3OLA A;  4Y65 A;  4UUX A;  3CD6 S;  3MWB A;  5LMU J;  2QFJ A;  1YJ7 A;  4Y6I A;  1NSA A;  5LSL A;  2Y0B B;  1X5P A;  1FWK A;  2DPJ A;  2WW4 A;  3ILJ A;  1RT5 A;  1SKU B;  1HQU B;  2ZH6 A;  2B6A B;  2XSF A;  3BB5 A;  2KKH A;  3LAL A;  4Z7Y A;  5GAG I;  2RHQ B;  2WVB A;  2YKQ A;  2NS1 B;  2UUB J;  1NRK A;  1F9F A;  4M8L A;  3CC4 S;  3UDE A;  1SKS A;  1DTQ A;  4B9N A;  5A8W A;  4FNH A;  1RWO B;  1Y3K A;  4OYO A;  2DNQ A;  4JI3 J;  1RIS A;  4DR3 J;  3TZY A;  5AE3 A;  4FVM A;  1VRU A;  3V4I B;  4CP5 A;  3TEG A;  3PYF A;  3OR2 B;  3C14 A;  3MEC A;  3AQP A;  2PII A;  4HL9 A;  5FJ4 A;  3CJK B;  2HBZ B;  2B8P A;  4FPR A;  1H2T Z;  1UKU A;  1BE4 A;  2DR7 A;  1LW0 B;  3V6K A;  3K8W A;  3VAH A;  2NLW A;  2QLJ B;  1NAQ A;  4ANE A;  1A0O B;  5KFF A;  1MN9 A;  2QMU B;  3W2V A;  3SYZ A;  3IAS 9;  1S0N A;  4AL7 A;  1IUJ A;  3CD0 A;  2XYH B;  4WBF A;  2Z2Z A;  2VDI A;  3PCO B;  5FDL B;  4O0I A;  1GTH A;  3W9I A;  3OL8 A;  3TX8 A;  5KG5 A;  4QQB A;  1B7Y B;  1VQM S;  2NXJ A;  4O44 A;  4A8Y A;  1VQ4 S;  4CLZ A;  1Q79 A;  1AB8 A;  4WP3 A;  5KFS A;  3VAG A;  1AZS B;  1FA0 A;  3PXG a;  5IOL A;  2WSF C;  1RB0 A;  2PD1 A;  4EYI B;  4OYZ A;  1X4D A;  3LGM A;  2NCK L;  3F44 A;  3Q2T C;  1WJ9 A;  2E1A A;  5D15 A;  2RML A;  4IOB A;  4OI4 A;  2VG5 B;  1KBR A;  4LF5 F;  4JV5 F;  4YHH F;  2F40 A;  5F8J A;  4Q8E A;  5CYJ A;  4NCG B;  3DLJ A;  3TOQ A;  3GIL A;  3VCD A;  3DLG A;  1MSW D;  2DIV A;  3FCV A;  1NK7 A;  3LQV A;  2B9W A;  3IS9 B;  3ZTR A;  5HJX A;  2RDD A;  4BS2 A;  1S7H A;  2Q6C A;  2JFK A;  1PYO B;  4Y34 A;  3FCH A;  3I0R A;  3TQE A;  5KFT A;  3UCU P;  3DDK A;  3MEK A;  1TZ0 A;  4H4M A;  2FJB B;  5B0E A;  4DR4 J;  3KJV B;  1JKH A;  2UUA F;  1XC9 A;  3RW7 A;  4X4P A;  4K4V A;  4F0M A;  2PI5 A;  3DM2 B;  3M05 A;  4MYT A;  2E44 A;  2HHS A;  2E5H A;  1UPP A;  3QGG A;  4JI8 J;  1K8A T;  4YEA A;  3QJL A;  4ED5 A;  3IM9 A;  2MKS A;  4I2P A;  4LFC J;  3M8P A;  1JNZ B;  3O2I A;  3MDF A;  1G3O A;  3C66 A;  2EK1 A;  2QA2 A;  2VJU A;  5FLX Y;  2B4O A;  4YY3 F;  1IBK F;  3QO9 A;  2DY1 A;  1WDT A;  4F3M A;  1EAR A;  1TL7 A;  4OI3 A;  2QL7 B;  5CYM B;  4KE5 A;  1RT7 A;  4ES3 A;  4HTI A;  5LMU F;  1FDB A;  4F3Q A;  1WOR A;  1GMW A;  3AJ1 A;  1VC5 A;  5EX3 A;  4Y3C A;  1BD6 A;  4QYZ J;  4QR1 A;  1YBA A;  4RW7 A;  2PI4 A;  3OR1 B;  1GX5 A;  2MKH A;  4QPT A;  2V8V A;  3S7R A;  2JEJ A;  3W61 A;  3H0P A;  3ENQ A;  2D7S A;  5KG4 A;  2UUB F;  1UJ4 A;  2W4P A;  2AJF E;  2N4D A;  4FYW B;  1IXK A;  2XLK A;  3QQC D;  4DR1 F;  3Q8Q B;  2HLU A;  2GIF A;  2WHO A;  2EBE A;  4JI3 F;  2R3V A;  5CH7 B;  2VFT A;  7FD1 A;  2XWY A;  4DX7 A;  4DV2 J;  3TJ8 A;  1N5S A;  1UWB B;  3DOL A;  2MST A;  4M94 A;  2C2M B;  1HL6 A;  3OTO J;  2PO4 A;  3D0G E;  3EJM A;  3KNG A;  4RW6 A;  1GEH A;  5IXU A;  4PG5 A;  3NCR A;  1WKL A;  1WDD A;  4C3K A;  2OUG A;  2WVC A;  4DBQ A;  5A0Y B;  3GYN A;  2F63 A;  1FRJ A;  4FNI A;  3CME S;  5BYS A;  1R27 B;  2CZ4 A;  4P71 A;  2LQB A;  2XUL A;  4IFV B;  2UUC F;  3D3C J;  3W5Z A;  5DG8 A;  2HRY A;  2XO6 A;  4KHP F;  4PKD B;  3M2R A;  2FJW A;  2CXE A;  1C2P A;  2XTJ P;  5HSP A;  4AL6 A;  2BXJ A;  5FD1 A;  1Y4Z B;  4UQG A;  3SCK E;  5DDQ C;  5EUH A;  2IM1 A;  3BSA A;  4V19 X;  2HPU A;  1VC6 A;  2HBR B;  2CPI A;  4GMK A;  4NEZ A;  2XC9 A;  4UY8 T;  2KFN A;  2GVD A;  4M5I A;  4WFX A;  2H4Y B;  4AYB D;  1H0H B;  4CTA B;  3NGR A;  4KTQ A;  2LDY A;  3KDO A;  1N48 A;  3Q22 A;  2EFQ A;  5HMZ A;  4CCH A;  2BVZ A;  4K4Z A;  2FGO A;  3FBC A;  3MCN A;  3I0S B;  2N7C A;  2C2R A;  4JI0 F;  5DS7 A;  5HRO B;  1DAX A;  2PMH A;  1UET A;  3R7N B;  4RU9 A;  2RQK A;  3T6B A;  2NXN A;  4NYZ A;  3BQ2 A;  1VLO A;  2DIU A;  3BR9 A;  4NLV A;  4WII A;  2A18 A;  4KPC A;  4LF6 J;  1WHY A;  2ZZN A;  1PIE A;  3PRD A;  4HH0 A;  2B8Q A;  5D0H A;  2KXN B;  3SSQ A;  4DR4 F;  3UO0 A;  3KHH A;  1HQU A;  4BWJ A;  2B6A A;  3TAM B;  1F9H A;  3RBX A;  4PG8 A;  5KFV A;  4U96 A;  1GTE A;  4N47 A;  3SBM A;  4R0E A;  3M9M B;  3TZW A;  5J1N A;  4CLT A;  3NAI A;  2Z56 B;  4JI2 J;  3DOM B;  3V4I A;  1KVI A;  3VZI A;  3OR2 A;  2JVO A;  1G2E A;  5DDO C;  4OYP A;  5LJ5 Y;  3TI0 A;  2A2D A;  2H5J B;  4G1Q B;  3CJK A;  3J80 Y;  1QAX A;  2OFG X; 
#chains in the Genus database with same CATH homology
 1G4C A;  3HSG A;  3ILI A;  1TMM A;  5ETM A;  5ETS A;  1F9H A;  1RAO A;  3ILO A;  5ETP A;  1TMJ A;  5ETV A;  1DY3 A;  4M5K A;  1RU2 A;  3UD5 A;  3HSD A;  3MCO A;  3QBC A;  4M5M A;  5ETL A;  3ILL A;  2F63 A;  2BMB A;  3HSJ A;  4PZV A;  5ETT A;  1CBK A;  4CRJ A;  3KUH A;  1RU1 A;  3HT0 A;  3KUE A;  1EQ0 A;  3HSZ A;  4F7V A;  1IM6 A;  5ETO A;  5ETK A;  1KBR A;  4CYU A;  1Q0N A;  4AD6 A;  1RB0 A;  5ETR A;  3UDV A;  3MCN A;  3MCM A;  1HQ2 A;  3KUG A;  4CYU B;  3ILJ A;  2CG8 A;  4M5L A;  5ETN A;  3IP0 A;  2QX0 A;  4M5N A;  4CWB A;  1EQM A;  2F65 A;  1EX8 A;  4M5I A;  4M5G A;  4M5H A;  1HKA A;  5ETQ A;  3UDE A;  3HD1 A;  4M5J A;  3HD2 A;  1RTZ A;  3HCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...