5EU0A

Fic domain of bep1 from bartonella rochalimae in complex with biaa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
NLPLPIYYTYPNSLTLKNKYGIIDHKEFTDKCAHDSAKATINLHQEALPKEFNSSYLKYLHKCLFENTFEWAGCTRDIPFPFKDGTVAVMPEMMRSNWKTDQPIIFAIGNKVQDGLKNIDRILVEKNNLQNLPRQEFIHHLAEIFASLNYTHPFREGNGRTQRIFCEKLAQAANYNLDFSIVTKERMSEVSIAAAQDGNLEPMKKLFDDISHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for Rho-family GTPase discrimination by a bacterial virulence factor
rcsb
source organism Bartonella rochalimae atcc baa-1498
molecule tags Toxin
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
total genus 79
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 5eu0A00
5JFZA 4LU4A 3LETA 2VY3A 5CKLA 4XI8A 4PY3A 5EU0A 4WGJA 3SN9A 4U04A 5JJ6A 2JK8A 2F6SA 4M16A 5JFFA 3SE5A 4X2DA 4ITRA 3N3UA 4X2CA 3CUCA 3SHGA 2G03A 4X2EA 5JJ7A 4U0SA 2VZAA 3ZCBA 4U07A 5CMTA 3ZC7A 3ZLMA 4N67A 4U0ZA 3S6AA 5CGLA 4U0UA 4NPSA
chains in the Genus database with same CATH superfamily
5JFZA 4LU4A 3LETA 2VY3A 5CKLA 4XI8A 4PY3A 5EU0A 4WGJA 3SN9A 4U04A 2NUDA 2JK8A 5JJ6A 2F6SA 4M16A 5JFFA 3SE5A 4X2DA 4ITRA 3N3UA 4X2CA 3CUCA 3SHGA 2G03A 4X2EA 5JJ7A 4U0SA 2VZAA 3ZCBA 4U07A 1NH1A 5CMTA 3ZC7A 3ZLMA 4N67A 2NUNA 4U0ZA 3S6AA 5CGLA 4U0UA 4NPSA
chains in the Genus database with same CATH topology
5JFZA 4LU4A 3LETA 2VY3A 5CKLA 4XI8A 4PY3A 5EU0A 4WGJA 3SN9A 4U04A 5JJ6A 2JK8A 2F6SA 4M16A 5JFFA 3SE5A 4X2DA 4ITRA 3N3UA 4X2CA 3CUCA 3SHGA 2G03A 4X2EA 5JJ7A 4U0SA 2VZAA 3ZCBA 4U07A 5CMTA 3ZC7A 3ZLMA 4N67A 4U0ZA 3S6AA 5CGLA 4U0UA 4NPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFZ A;  4LU4 A;  3LET A;  2VY3 A;  5CKL A;  4XI8 A;  4PY3 A;  5EU0 A;  4WGJ A;  3SN9 A;  4U04 A;  5JJ6 A;  2JK8 A;  2F6S A;  4M16 A;  5JFF A;  3SE5 A;  4X2D A;  4ITR A;  3N3U A;  4X2C A;  3CUC A;  3SHG A;  2G03 A;  4X2E A;  5JJ7 A;  4U0S A;  2VZA A;  3ZCB A;  4U07 A;  5CMT A;  3ZC7 A;  3ZLM A;  4N67 A;  4U0Z A;  3S6A A;  5CGL A;  4U0U A;  4NPS A; 
#chains in the Genus database with same CATH topology
 5JFZ A;  4LU4 A;  3LET A;  2VY3 A;  5CKL A;  4XI8 A;  4PY3 A;  5EU0 A;  4WGJ A;  3SN9 A;  4U04 A;  2NUD A;  2JK8 A;  5JJ6 A;  2F6S A;  4M16 A;  5JFF A;  3SE5 A;  4X2D A;  4ITR A;  3N3U A;  4X2C A;  3CUC A;  3SHG A;  2G03 A;  4X2E A;  5JJ7 A;  4U0S A;  2VZA A;  3ZCB A;  4U07 A;  1NH1 A;  5CMT A;  3ZC7 A;  3ZLM A;  4N67 A;  2NUN A;  4U0Z A;  3S6A A;  5CGL A;  4U0U A;  4NPS A; 
#chains in the Genus database with same CATH homology
 5JFZ A;  4LU4 A;  3LET A;  2VY3 A;  5CKL A;  4XI8 A;  4PY3 A;  5EU0 A;  4WGJ A;  3SN9 A;  4U04 A;  5JJ6 A;  2JK8 A;  2F6S A;  4M16 A;  5JFF A;  3SE5 A;  4X2D A;  4ITR A;  3N3U A;  4X2C A;  3CUC A;  3SHG A;  2G03 A;  4X2E A;  5JJ7 A;  4U0S A;  2VZA A;  3ZCB A;  4U07 A;  5CMT A;  3ZC7 A;  3ZLM A;  4N67 A;  4U0Z A;  3S6A A;  5CGL A;  4U0U A;  4NPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...