5EUSA

Rat prestin stas domain in complex with bromide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
143
structure length
129
Chain Sequence
SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Rat prestin STAS domain
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 40
structure length 129
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5eusA00
4DGFA 3AGEA 3AGDA 4QTPA 3OIRA 5EUZA 3LKLA 4DGHA 1H4XA 5EUSA 3ZTBA 1AUZA 1TILB 3IF5A 1H4ZA 5EUWA 4HYLA 1VC1A 1THNB 1BUZA 3LLOA 3IH8A 3NY7A 3ZXNA 4XS5A 3IH9A 5EZBA 3T6OA 1SBOA 3IHBA 5EUUA 2KLNA 5EUXA 3F43A 1TH8B 1H4YA 3OIZA 2VY9A 3MGLA 2KA5A 1T6RA 3IHAA 1TIDB
chains in the Genus database with same CATH superfamily
4DGFA 3AGDA 4QTPA 5EUZA 2RRLA 1FCFA 1J7XA 5EUWA 3GVLA 3C0KA 3LLOA 3IH8A 4XS5A 3IH9A 5EZBA 3IHBA 3MOGA 3DJAA 2AS0A 2B78A 1H4YA 3MGLA 2CWWA 3VSEA 1TIDB 3DUPA 3LKLA 1K32A 2OASA 2DXLA 3EH7A 3QDQA 1THNB 3GVKA 5EUUA 1V0FA 3OIZA 4JC0A 3D03A 1HF2A 4AEJA 3D3UA 3AGEA 3V97A 3V8VA 1N6FA 4DGHA 3GHFA 1WXWA 4HIZA 3ZTBA 1AUZA 1N6EA 3IF5A 4AE2A 4DMGA 1FC9A 2DXNA 3K50A 4L1CA 3T6OA 2KLNA 3DORA 1WXXA 5EUXA 1TH8B 3LDFA 1T6RA 2ZO9B 3GVJA 3OIRA 1V0EA 1H4XA 5EUSA 1BPLA 4L8KA 1TILB 1H4ZA 1FC7A 1FC6A 3GK7A 4HYLA 1VC1A 1BUZA 3NY7A 3ZXNA 1SBOA 1N6DA 2ZOAA 4GHNA 3F43A 2VY9A 2KA5A 3IHAA 3JU4A 3GMFA
chains in the Genus database with same CATH topology
4DGFA 3AGEA 3AGDA 4QTPA 3OIRA 5EUZA 3LKLA 4DGHA 1H4XA 5EUSA 3ZTBA 1AUZA 1TILB 3IF5A 1H4ZA 5EUWA 4HYLA 1VC1A 1THNB 1BUZA 3LLOA 3IH8A 3NY7A 3ZXNA 4XS5A 3IH9A 5EZBA 3T6OA 1SBOA 3IHBA 5EUUA 2KLNA 5EUXA 3F43A 1TH8B 1H4YA 3OIZA 2VY9A 3MGLA 2KA5A 1T6RA 3IHAA 1TIDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGF A;  3AGE A;  3AGD A;  4QTP A;  3OIR A;  5EUZ A;  3LKL A;  4DGH A;  1H4X A;  5EUS A;  3ZTB A;  1AUZ A;  1TIL B;  3IF5 A;  1H4Z A;  5EUW A;  4HYL A;  1VC1 A;  1THN B;  1BUZ A;  3LLO A;  3IH8 A;  3NY7 A;  3ZXN A;  4XS5 A;  3IH9 A;  5EZB A;  3T6O A;  1SBO A;  3IHB A;  5EUU A;  2KLN A;  5EUX A;  3F43 A;  1TH8 B;  1H4Y A;  3OIZ A;  2VY9 A;  3MGL A;  2KA5 A;  1T6R A;  3IHA A;  1TID B; 
#chains in the Genus database with same CATH topology
 4DGF A;  3AGD A;  4QTP A;  5EUZ A;  2RRL A;  1FCF A;  1J7X A;  5EUW A;  3GVL A;  3C0K A;  3LLO A;  3IH8 A;  4XS5 A;  3IH9 A;  5EZB A;  3IHB A;  3MOG A;  3DJA A;  2AS0 A;  2B78 A;  1H4Y A;  3MGL A;  2CWW A;  3VSE A;  1TID B;  3DUP A;  3LKL A;  1K32 A;  2OAS A;  2DXL A;  3EH7 A;  3QDQ A;  1THN B;  3GVK A;  5EUU A;  1V0F A;  3OIZ A;  4JC0 A;  3D03 A;  1HF2 A;  4AEJ A;  3D3U A;  3AGE A;  3V97 A;  3V8V A;  1N6F A;  4DGH A;  3GHF A;  1WXW A;  4HIZ A;  3ZTB A;  1AUZ A;  1N6E A;  3IF5 A;  4AE2 A;  4DMG A;  1FC9 A;  2DXN A;  3K50 A;  4L1C A;  3T6O A;  2KLN A;  3DOR A;  1WXX A;  5EUX A;  1TH8 B;  3LDF A;  1T6R A;  2ZO9 B;  3GVJ A;  3OIR A;  1V0E A;  1H4X A;  5EUS A;  1BPL A;  4L8K A;  1TIL B;  1H4Z A;  1FC7 A;  1FC6 A;  3GK7 A;  4HYL A;  1VC1 A;  1BUZ A;  3NY7 A;  3ZXN A;  1SBO A;  1N6D A;  2ZOA A;  4GHN A;  3F43 A;  2VY9 A;  2KA5 A;  3IHA A;  3JU4 A;  3GMF A; 
#chains in the Genus database with same CATH homology
 4DGF A;  3AGE A;  3AGD A;  4QTP A;  3OIR A;  5EUZ A;  3LKL A;  4DGH A;  1H4X A;  5EUS A;  3ZTB A;  1AUZ A;  1TIL B;  3IF5 A;  1H4Z A;  5EUW A;  4HYL A;  1VC1 A;  1THN B;  1BUZ A;  3LLO A;  3IH8 A;  3NY7 A;  3ZXN A;  4XS5 A;  3IH9 A;  5EZB A;  3T6O A;  1SBO A;  3IHB A;  5EUU A;  2KLN A;  5EUX A;  3F43 A;  1TH8 B;  1H4Y A;  3OIZ A;  2VY9 A;  3MGL A;  2KA5 A;  1T6R A;  3IHA A;  1TID B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...