5EUUA

Rat prestin stas domain in complex with chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
129
Chain Sequence
SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 42
structure length 129
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euuA00
5EUSA 2KLNA 3ZTBA 5EUWA 4DGHA 3OIZA 3MGLA 1TILB 3IHBA 3ZXNA 1H4YA 4XS5A 4DGFA 1THNB 4HYLA 3F43A 1T6RA 1H4ZA 3IH9A 1TH8B 1TIDB 3OIRA 1VC1A 3AGEA 1BUZA 5EUXA 3T6OA 3LKLA 4QTPA 3IH8A 5EZBA 1H4XA 1SBOA 3IHAA 3NY7A 5EUZA 5EUUA 3LLOA 3IF5A 1AUZA 3AGDA 2VY9A 2KA5A
chains in the Genus database with same CATH superfamily
3GVKA 4JC0A 3GVLA 3MGLA 1FC6A 4AEJA 1H4YA 3GK7A 4AE2A 4HYLA 3DORA 1K32A 2B78A 2ZO9B 3D03A 3VSEA 1WXWA 1FC9A 3LKLA 1FC7A 1FCFA 3NY7A 2KLNA 1N6DA 5EUWA 4DGHA 3D3UA 3OIZA 4DMGA 3DUPA 4DGFA 1THNB 2CWWA 1T6RA 3AGEA 1BUZA 5EUXA 3QDQA 3T6OA 4L1CA 3C0KA 1H4XA 1SBOA 3IHAA 3IF5A 2AS0A 3V97A 2VY9A 4GHNA 5EUSA 2DXNA 3IHBA 1BPLA 3LDFA 3F43A 1V0EA 1H4ZA 1TH8B 3K50A 1N6FA 1V0FA 2RRLA 3GHFA 3V8VA 3IH8A 3DJAA 5EUUA 1AUZA 3AGDA 2KA5A 1N6EA 3ZTBA 2ZOAA 1WXXA 4HIZA 3EH7A 1TILB 3ZXNA 4XS5A 3MOGA 3GMFA 1HF2A 4L8KA 3IH9A 1J7XA 1TIDB 3OIRA 1VC1A 4QTPA 5EZBA 3JU4A 5EUZA 3LLOA 2DXLA 3GVJA 2OASA
chains in the Genus database with same CATH topology
5EUSA 2KLNA 3ZTBA 5EUWA 4DGHA 3OIZA 3MGLA 1TILB 3IHBA 3ZXNA 1H4YA 4XS5A 4DGFA 1THNB 4HYLA 3F43A 1T6RA 1H4ZA 3IH9A 1TH8B 1TIDB 3OIRA 1VC1A 3AGEA 1BUZA 5EUXA 3T6OA 3LKLA 4QTPA 3IH8A 5EZBA 1H4XA 1SBOA 3IHAA 3NY7A 5EUZA 5EUUA 3LLOA 3IF5A 1AUZA 3AGDA 2VY9A 2KA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EUS A;  2KLN A;  3ZTB A;  5EUW A;  4DGH A;  3OIZ A;  3MGL A;  1TIL B;  3IHB A;  3ZXN A;  1H4Y A;  4XS5 A;  4DGF A;  1THN B;  4HYL A;  3F43 A;  1T6R A;  1H4Z A;  3IH9 A;  1TH8 B;  1TID B;  3OIR A;  1VC1 A;  3AGE A;  1BUZ A;  5EUX A;  3T6O A;  3LKL A;  4QTP A;  3IH8 A;  5EZB A;  1H4X A;  1SBO A;  3IHA A;  3NY7 A;  5EUZ A;  5EUU A;  3LLO A;  3IF5 A;  1AUZ A;  3AGD A;  2VY9 A;  2KA5 A; 
#chains in the Genus database with same CATH topology
 3GVK A;  4JC0 A;  3GVL A;  3MGL A;  1FC6 A;  4AEJ A;  1H4Y A;  3GK7 A;  4AE2 A;  4HYL A;  3DOR A;  1K32 A;  2B78 A;  2ZO9 B;  3D03 A;  3VSE A;  1WXW A;  1FC9 A;  3LKL A;  1FC7 A;  1FCF A;  3NY7 A;  2KLN A;  1N6D A;  5EUW A;  4DGH A;  3D3U A;  3OIZ A;  4DMG A;  3DUP A;  4DGF A;  1THN B;  2CWW A;  1T6R A;  3AGE A;  1BUZ A;  5EUX A;  3QDQ A;  3T6O A;  4L1C A;  3C0K A;  1H4X A;  1SBO A;  3IHA A;  3IF5 A;  2AS0 A;  3V97 A;  2VY9 A;  4GHN A;  5EUS A;  2DXN A;  3IHB A;  1BPL A;  3LDF A;  3F43 A;  1V0E A;  1H4Z A;  1TH8 B;  3K50 A;  1N6F A;  1V0F A;  2RRL A;  3GHF A;  3V8V A;  3IH8 A;  3DJA A;  5EUU A;  1AUZ A;  3AGD A;  2KA5 A;  1N6E A;  3ZTB A;  2ZOA A;  1WXX A;  4HIZ A;  3EH7 A;  1TIL B;  3ZXN A;  4XS5 A;  3MOG A;  3GMF A;  1HF2 A;  4L8K A;  3IH9 A;  1J7X A;  1TID B;  3OIR A;  1VC1 A;  4QTP A;  5EZB A;  3JU4 A;  5EUZ A;  3LLO A;  2DXL A;  3GVJ A;  2OAS A; 
#chains in the Genus database with same CATH homology
 5EUS A;  2KLN A;  3ZTB A;  5EUW A;  4DGH A;  3OIZ A;  3MGL A;  1TIL B;  3IHB A;  3ZXN A;  1H4Y A;  4XS5 A;  4DGF A;  1THN B;  4HYL A;  3F43 A;  1T6R A;  1H4Z A;  3IH9 A;  1TH8 B;  1TID B;  3OIR A;  1VC1 A;  3AGE A;  1BUZ A;  5EUX A;  3T6O A;  3LKL A;  4QTP A;  3IH8 A;  5EZB A;  1H4X A;  1SBO A;  3IHA A;  3NY7 A;  5EUZ A;  5EUU A;  3LLO A;  3IF5 A;  1AUZ A;  3AGD A;  2VY9 A;  2KA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...