5EUUA

Rat prestin stas domain in complex with chloride
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
129
Chain Sequence
b'SPSYTVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYNIHTVILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTSNRFFENPALKELLFHSIHDAVLGSQVREA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prestin,Prestin
publication title The STAS domain of mammalian SLC26A5 prestin harbours an anion-binding site.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 42
structure length 129
sequence length 143
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 5euuA00
3AGDA 3NY7A 3ZXNA 1VC1A 3OIZA 4HYLA 1BUZA 3MGLA 3ZTBA 2KA5A 1SBOA 1TH8B 5EUXA 1TILB 1THNB 1H4XA 4DGFA 3LLOA 3OIRA 4QTPA 5EUWA 3T6OA 1H4ZA 3IH8A 1TIDB 1T6RA 1H4YA 5EUUA 3AGEA 3IH9A 3IF5A 3IHBA 5EUZA 3F43A 2KLNA 4XS5A 5EUSA 5EZBA 3IHAA 2VY9A 4DGHA 1AUZA 3LKLA
chains in the Genus database with same CATH superfamily
4HIZA 2KA5A 1SBOA 2DXLA 1THNB 1H4XA 4AEJA 3V8VA 2CWWA 3IH8A 3QDQA 2B78A 5EUUA 2ZOAA 3IF5A 5EUZA 1V0EA 4AE2A 2ZO9B 2RRLA 3IHAA 1N6DA 4DGHA 3ZXNA 4HYLA 1BUZA 3LDFA 1FC9A 1TH8B 1WXWA 3C0KA 4JC0A 4DGFA 2AS0A 5EUWA 1TIDB 3EH7A 3AGEA 3IH9A 3IHBA 3DORA 3GVLA 1N6EA 1WXXA 2KLNA 4XS5A 2DXNA 3GVJA 1TILB 4L8KA 3AGDA 4L1CA 3MGLA 3ZTBA 2OASA 1FC7A 3V97A 3GMFA 3LLOA 3OIRA 4QTPA 3T6OA 1H4ZA 1K32A 1T6RA 1H4YA 4GHNA 3D3UA 3DJAA 3VSEA 3F43A 3DUPA 5EUSA 3MOGA 1FCFA 1AUZA 3LKLA 3NY7A 1VC1A 1FC6A 3OIZA 3K50A 1BPLA 1J7XA 5EUXA 4DMGA 1N6FA 3JU4A 3GHFA 3D03A 1V0FA 3GK7A 1HF2A 5EZBA 2VY9A 3GVKA
chains in the Genus database with same CATH topology
3AGDA 3NY7A 3ZXNA 1VC1A 3OIZA 4HYLA 1BUZA 3MGLA 3ZTBA 2KA5A 1SBOA 1TH8B 5EUXA 1TILB 1THNB 1H4XA 4DGFA 3LLOA 3OIRA 4QTPA 5EUWA 3T6OA 1H4ZA 3IH8A 1TIDB 1T6RA 1H4YA 5EUUA 3AGEA 3IH9A 3IF5A 3IHBA 5EUZA 3F43A 2KLNA 4XS5A 5EUSA 5EZBA 3IHAA 2VY9A 4DGHA 1AUZA 3LKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGD A;  3NY7 A;  3ZXN A;  1VC1 A;  3OIZ A;  4HYL A;  1BUZ A;  3MGL A;  3ZTB A;  2KA5 A;  1SBO A;  1TH8 B;  5EUX A;  1TIL B;  1THN B;  1H4X A;  4DGF A;  3LLO A;  3OIR A;  4QTP A;  5EUW A;  3T6O A;  1H4Z A;  3IH8 A;  1TID B;  1T6R A;  1H4Y A;  5EUU A;  3AGE A;  3IH9 A;  3IF5 A;  3IHB A;  5EUZ A;  3F43 A;  2KLN A;  4XS5 A;  5EUS A;  5EZB A;  3IHA A;  2VY9 A;  4DGH A;  1AUZ A;  3LKL A; 
#chains in the Genus database with same CATH topology
 4HIZ A;  2KA5 A;  1SBO A;  2DXL A;  1THN B;  1H4X A;  4AEJ A;  3V8V A;  2CWW A;  3IH8 A;  3QDQ A;  2B78 A;  5EUU A;  2ZOA A;  3IF5 A;  5EUZ A;  1V0E A;  4AE2 A;  2ZO9 B;  2RRL A;  3IHA A;  1N6D A;  4DGH A;  3ZXN A;  4HYL A;  1BUZ A;  3LDF A;  1FC9 A;  1TH8 B;  1WXW A;  3C0K A;  4JC0 A;  4DGF A;  2AS0 A;  5EUW A;  1TID B;  3EH7 A;  3AGE A;  3IH9 A;  3IHB A;  3DOR A;  3GVL A;  1N6E A;  1WXX A;  2KLN A;  4XS5 A;  2DXN A;  3GVJ A;  1TIL B;  4L8K A;  3AGD A;  4L1C A;  3MGL A;  3ZTB A;  2OAS A;  1FC7 A;  3V97 A;  3GMF A;  3LLO A;  3OIR A;  4QTP A;  3T6O A;  1H4Z A;  1K32 A;  1T6R A;  1H4Y A;  4GHN A;  3D3U A;  3DJA A;  3VSE A;  3F43 A;  3DUP A;  5EUS A;  3MOG A;  1FCF A;  1AUZ A;  3LKL A;  3NY7 A;  1VC1 A;  1FC6 A;  3OIZ A;  3K50 A;  1BPL A;  1J7X A;  5EUX A;  4DMG A;  1N6F A;  3JU4 A;  3GHF A;  3D03 A;  1V0F A;  3GK7 A;  1HF2 A;  5EZB A;  2VY9 A;  3GVK A; 
#chains in the Genus database with same CATH homology
 3AGD A;  3NY7 A;  3ZXN A;  1VC1 A;  3OIZ A;  4HYL A;  1BUZ A;  3MGL A;  3ZTB A;  2KA5 A;  1SBO A;  1TH8 B;  5EUX A;  1TIL B;  1THN B;  1H4X A;  4DGF A;  3LLO A;  3OIR A;  4QTP A;  5EUW A;  3T6O A;  1H4Z A;  3IH8 A;  1TID B;  1T6R A;  1H4Y A;  5EUU A;  3AGE A;  3IH9 A;  3IF5 A;  3IHB A;  5EUZ A;  3F43 A;  2KLN A;  4XS5 A;  5EUS A;  5EZB A;  3IHA A;  2VY9 A;  4DGH A;  1AUZ A;  3LKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...