5EV0A

Crystal structure of ragweed profilin amb a 8 in complex with poly-pro14
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
134
structure length
133
Chain Sequence
b'SGSWQTYVDEHLMDIEGTGQHLASAAIFGTDGNVWAKSSSFPEFKPDEINAIIKEFSEPGALAPTGLFLAGAKYMVIQGEPGAVIRGKKGAGGICIKKTGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Ambrosia artemisiifolia
molecule tags Allergen
total genus 38
structure length 133
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5ev0A00
3NULA 1Z09A 3L9KA 4FTXA 5EV0A 3T1QB 2JKGA 3U4LP 3T12B 2ZL1A 4X25A 2V8CA 3CPTA 3CHWP 3DAVA 1G5UA 2VK3A 2B95A 1VEUA 3L7HA 2V8FA 4D60A 1K0KA 2HZ5A 1F2KA 3UB5P 1PRQA 2ZL1B 2JKFA 3CPTB 3T1XA 1CF0A 5FEGA 3LEQA 1CJFA 1VEUB 2BTFP 1SZVA 4FUWA 3KYEA 3T1RA 1SKOA 2PAVP 3MS6A 1Y4OA 1HLUP 3LGOA 1VETB 3NECA 2E8JA 4ESPA 1VETA 5EM1A 1D1JA 2PRFA 3MSHA 5FEFA 1PFLA 1PNEA 1CQAA 2ACGA 3T1SA 2PBDP 3D9YA 1YPRA 5FDSA 1SKOB 1J3WA 4X1MA 1FILA 1AWIA 5EVEA 4X1LA 5EM0A 1A0KA 4QWOA 1ACFA 1FIKA
chains in the Genus database with same CATH superfamily
1YAXA 4EBLA 4MMNA 2VV6A 5DTTA 5FA7A 4UQIM 1JNUA 2Y55A 4PM5A 4S2NC 3KSFA 3V39A 3A3FA 2H0YA 1W7FA 2MJ6A 3MQ0A 1TVFA 2A24B 3B47A 3G32A 4UAAA 3SH7A 1L0FA 3IX3A 1CEGA 2VGKA 3P09A 3QP1A 4YNRA 3E2KA 4ETXA 3O86A 4RX2A 4WELA 5M19A 3IXBA 3O5YA 4JF4A 4IUHA 2QJ5A 3NDGA 3N4IA 4OQ0A 4G3VA 4PAUA 3TSGA 1BTLA 2W3FA 3V3SA 1ZG4A 2QPNA 5EPHA 1N9BA 5F69A 3ZG9B 3LGOA 4NG2A 3GV9A 3ISGA 4HJ6A 1DP8A 4JXSA 1E4DA 3BYDA 3UY6A 5TGFA 3GR2A 4GOGA 4IVIA 5IU1A 4QY5A 5J8XA 1MWUA 2EX2A 1CI9A 4HHDA 5HZHA 2I9VA 3HCYA 4KQRA 4MDZA 5K5BA 4MBKA 1DJAA 5EM0A 1KOUA 2DMWA 3T4JA 1MY8A 4HESA 3QNBA 1ACFA 4QWOA 1FIKA 4KZBA 4MEZA 5F82A 3UE6A 3IF6A 3OBFA 2DCFA 3C7UA 4LCMA 2XD1A 2UWXA 2Y2QA 5JYPA 4MN6A 2H28A 4ARZB 3L9KA 1FSWA 4C3QA 4P85A 1OJ5A 1TDGA 2JKGA 3A3IA 5HL6A 2HV1A 4M4XA 3VMAA 1GSVA 2O99A 5TBMA 2NUTC 2V2FF 3O87A 3BECA 1QMFA 2B95A 4CLCD 1VEUA 3QP2A 4KZ3A 3CAXA 4OQHA 2WKQA 3VP1A 2PD7A 5DKKA 5HAPA 4UEYA 4EU0A 4PM8A 5EOEA 2ZL1B 2JKFA 2B5RA 3LEQA 4KZ5A 1LT0A 2W3DA 4DRTA 4CJNA 1KE3A 3KSHA 4X55A 3LR0A 3T1RA 3VSKA 3IH9A 4FD8A 2QYBA 3ZNTA 3LIAA 2GX5A 4IVKA 2ZM2A 3M2KA 1MWRA 2ACGA 3BFDA 3HL9A 3PBSA 1I2SA 4G3KA 4HBTA 4WUJA 3FWLA 1G6OA 3VFFA 1FCNA 3NC8A 1L0EA 2ZMFA 5L09A 4GJ4A 4DXBA 3IF6C 3DTIA 4LPZA 1GSXA 1MC0A 3Q1FA 2V1ZA 4UA6A 2PD8A 2LB5A 4PM9A 2YKHA 3FV7A 3NI9A 1XA1A 2WUQA 1OTDA 3VSLA 2HJ9C 3HVFA 1JWVA 2Y59A 1G68A 5M1AA 2XQZA 1I5QA 3ICYA 1VHMA 3BQ8A 5FDHA 5FASA 1OTBA 3OPPA 2W3EA 3A3JA 2EFUA 4GDBA 3ZG0A 1BZAA 4GN2A 1NRJA 3UDIA 1W8YA 1K55A 5G18A 4UHUA 5FSRA 1PW1A 2ZJ9A 3PBRA 3MR0A 4OLDA 2I72A 2VJWA 5F1FA 2INWA 4QB8A 5C5KA 3CUEC 4F94A 1UWPX 5EVIC 4PHTA 4RQ9A 5FL3A 4F3LA 1H8ZA 1T18A 3LIFA 5HX9A 4P6ZM 4GZBA 1XJ4A 3O3VA 1BLSA 3BM6A 1ONHA 4HY8A 4GHIB 1J9MA 4Y0UA 1NWZA 1K57A 1W63M 2VLGA 2Y2PA 4FSFA 4HH2A 4BENA 3GQZA 3UE3A 1OMEA 4JPMA 4LV2A 4R1GA 3IS2B 3VOZA 3K3CA 4DF6A 4LRYC 1STZA 3Q81A 4CQHA 3G4PA 5CECA 2GJ3A 2HP5A 3UB8A 4MLLA 4OQGA 2EA9A 3NY4A 3SS3A 1PI5A 2VGLM 3DTEA 4MN7A 4HP9A 5U47A 3HJIA 3Q7ZA 5E43A 5FQQA 2GNXA 3LI8A 2G2UA 3EEHA 4ETZA 5DF7A 3P01A 4HBUA 1L0DA 3LIEA 1FCOA 4EERA 2PBYA 4MBHA 2HZ5A 2KLIA 2M7UA 3MQQA 3T4TA 1PI4A 4IUKA 2ZQ9A 3IT9A 4Q8IA 1NY0A 4HQAA 3C4OA 3R7WB 1TEMA 4GDNA 2OV5A 3A0SA 5LBRA 4I39A 4D2OA 3Q7VB 4I3JA 3KYEA 3N8LA 3BWLA 1BT5A 3H7WA 3OPHA 2Y2GA 4UA9A 3LEZA 3WRTA 4BBTA 5CRFA 4MN5A 1PIOA 4DJ2A 4FOFA 5EM1A 2WGWB 2J9OA 3E0YA 1H8YA 4EUVA 3D9YA 2Y91A 5FDSA 3VP2A 3ZGAB 4EEPA 3FZCA 3UDXA 1MWTA 1YLZA 2JKTM 3SW1A 4GLQA 1V9YA 4KZ7A 1F5MA 3IXGA 1S4RA 3SZTA 4WN5A 4R3AA 1BLHA 3QP4A 2A24A 2RCXA 3G35A 2VX8A 5IS1A 2B02A 2P9VB 4FTXA 3BY9A 3EEAA 3BFEA 3UO9A 5J4EA 5KSCA 3PXPA 1KGFA 1W63Q 3KYQA 1YLJA 5MC7A 3MXRA 1Z6FA 4FH2A 2OSUA 4X25A 1JVJA 1IYPA 3M6HA 4S2JA 1ESIA 2WZXA 1OTAA 2X71A 2W3GA 3E4QA 3I7JA 4I3IA 5G4ZA 2EFXA 2KX6A 2XLNA 1XP4A 1ESUA 1YLYA 4JXVA 1O7EA 4JF6A 5DVAA 3MQOA 2R9WA 4ZRRA 4RYEA 3DWZA 2BTFP 2ZQ7A 4O0PA 3LIDA 3MS6A 3B42A 3MXSA 3LI9A 4XT2B 4S2MA 1XXMA 3NOTC 1IYQA 1OJGA 5HPIA 3ULFA 3UPPA 1N9OA 5FAQA 1PFLA 3C30A 3RFBA 4DE2A 1AWIA 3KO6A 4ARZA 5CEBA 3IBJA 3N8RA 4ZJ3A 1KVMA 3BLMA 2JKRM 4N92A 3ZQ5A 1E3UA 4R70A 3ZVWA 3B3XA 2C6WB 5EUAA 1SHVA 3PBNA 4LRXC 4EBPA 1IKGA 2XA7S 4BBUA 3ITAA 1PZOA 1XJ2A 4NK3A 2A3UA 2Q0OA 2ZLYA 1RGYA 4KENB 4N9KA 4ME4A 3HJKA 3S1YA 4DKIA 1GHMA 3T12B 4FH4A 2ZL1A 3UB9A 5I94A 4PM6A 1TF1A 1G5UA 3UE0A 1XKZA 1W5DA 5L8MA 1L2SA 3S22A 3D3OA 5E2FA 4GD6A 3NDEA 4LENA 5EVLA 4L0LA 1SCWA 4BD1A 4OPZA 1HD8A 5FQJA 3CPTB 3TW8A 3CLOA 5HARA 4EWFA 3E4OA 3HREA 2DNSA 3QP6A 4WZ4A 2XDMA 4Z9QA 1ES3A 1MBLA 3AGEA 5GHYA 2J8YA 3MFXA 4FUWA 3LR4A 5HAIA 4LV1A 1HVBA 4NKPA 3GRJA 2G2WA 5FAPA 4ID4A 2P7JA 3BFCA 2C5WB 1TDLA 1VETA 5AJGA 1H0MA 5FEFA 3MKEA 4IBXA 3IX4A 4ZAMA 5FATA 5HFOA 3G34A 3BRMA 1WYCA 3GECA 1DRMA 1Y54A 2PYRA 2HJEA 1YLPA 2FH5A 2V1BA 3MZEA 1GA9A 4CLCB 3NBLA 3TOIA 1K54A 5HDSA 3MJQA 1A0KA 5HDCA 1CK3A 1G28A 3UMDA 3F1OB 5A91A 4GW9A 4LGWA 1RCJA 3GDIA 2VZWA 1YQSA 2XSSA 1Z09A 1K4FA 1T1AA 3B33A 4BQMA 1ZG6A 3ZYTA 5FQMA 3IXHA 2JN7A 4EEUA 3T4KA 1Q2PA 1DJBA 4QJGA 4R4SA 2JKRI 1PZPA 2OLVA 3JVVA 5GL9A 1BSGA 2V8FA 5TR7A 3UB5P 2LB9A 3LO7A 1SDNA 2IWDA 1N9NA 4R38A 5AVEA 3RH8B 3IF5A 5CXWA 4JGOA 2VKSA 5FI6A 4S2IA 4X68A 2ZD8A 1EROA 1TS0A 4I3AA 4QY6A 4B93A 3IWOA 1PYYA 3UN7A 5GLAA 2OWJA 5KSHA 2ZC7A 3IS2A 1NLZA 4X69A 4GS9B 4H8RA 4ESPA 1FQGA 4Y0OA 1OT9A 5EOOA 3WS5A 1FR1A 3T4LA 3U2AA 5FI2A 1SKOB 2JHEA 1FILA 4KZ8A 4DXCA 1FR6A 5HDDA 3TRCA 3FYZA 1D7EA 1FCMA 4XUZA 3QNCA 4A5RA 3Q07A 3RXXA 2M1CA 2Y4AA 4GNUA 1H5XA 5JYOA 5HPFA 4OOYA 2AVXA 4RX3A 2ZOIA 1K25A 2XEPA 3EGXC 4JLFA 3ZVTA 2P08A 1KGEA 4WBGA 4Q0JA 3F1PB 3ZG5A 4DDYA 4EQ1A 3R4KA 5CTNA 3TJZC 1YLWA 4Y0TA 3JVUA 3R7WA 4Y13A 1E3UD 1M6KA 3GMWA 4Q0IA 1NLYA 3Q7VA 1F98A 5CEDA 3VOLA 4H6JB 1S6RA 4IHQA 1CI8A 2ZC3B 4BLMA 1FSYA 2EXAA 1AXBA 2XROA 4U0XA 2WGWA 4JGQA 3G6OA 3TG9A 3HLBA 3NJAA 4BL2A 2JBFA 3AGDA 3UMEA 3IWQA 2OWHA 4E3LA 3QP5A 2L0WA 4N9LA 4NXGA 4ZBEA 2ZC6B 2HDSA 5AQBA 1XFNA 4S2KA 3CWFA 2P9VA 4OKPA 1BLCA 1XGIA 2WZZA 1IYOA 4KZ4A 2FFYA 2ZQ8A 5CERA 3LIBA 5DFYA 1LSXA 3IHBA 3O88A 1NRFA 3NOPC 4E6XA 4PM7A 4Z1WA 1LHYA 3RTYA 1OPXA 4EW7A 3ZHHA 1S0WA 1KVLA 2IWBA 4KQQA 2K2NA 4R3BA 3NHQA 5EV0A 1S1YA 3MZDA 3HLFA 4NXEA 2JE5A 3KSGA 2NUPC 1ES2A 4UQIS 5TBMB 4IJGA 3C8CA 3PYPA 1MZUA 1GSWA 3IWIA 3N7WA 2Y2IA 1K0KA 2PU2A 3VOYA 3ZG7B 4R3JA 4XT2A 5GHXA 1EWZA 1Y28A 4LV0A 3T4SA 4KG6A 5F1GA 5IHVA 1KGGA 1YMSA 5BOHA 2Y2MA 1CJFA 1YLTA 2GZAA 3EGDC 4M3KA 5DF9A 1K55C 4IEDA 4KG2A 2W27A 3RXWA 2BG1A 3MFDA 3VP0A 4HI4A 5EVIB 2ZM0A 5E2GA 4CLCE 5A92A 1MPLA 1UWNX 2WKHA 3MSHA 4JBFA 1T19A 2V20A 3G2YA 3KSIA 3F1NB 3IHAA 5D3OA 3HUOA 3KX0X 4X1LA 1QMEA 1JWZA 2OOLA 2PDRA 1I2WA 3EQUA 4JXGA 3C2WA 1DY6A 3VE3A 2HP6A 1K57C 4DN0A 1V9ZA 1HZOA 4KQDA 4NEED 4QU3A 4E3OA 4OP5A 1X0OA 2JC7A 1OTEA 3C5AA 1DP6A 4N1HA 3FKVA 2V0WA 3CPTA 2EWWA 2ZQAA 4I38A 4U3TA 2VK3A 4P87A 5HSQA 3EOIA 4HEFA 5CGSA 3WS2A 4D60A 4E6WA 1F2KA 3S7NA 3FG8A 2ZOHA 2Z6CA 3FC7A 2XF3A 3BY8A 2QJ7A 5I5LA 2WKEA 3FPVA 2O0YA 5KIZA 1GA0A 4WF0A 5TJJA 2ZMVA 1LI9A 3H82B 2WGVA 1LL8A 3Q82A 4XXRA 1H3QA 5F68A 3LICA 1DJCA 3WS0A 1Y4OA 1HLUP 4R23A 5EFWA 4CLCA 1T1BA 2XH9A 2ZC4B 5EE8A 3P98A 3OCNA 3CITA 1D1JA 4KUKA 4P0MA 1N9LA 4II7A 1YM1A 3F1OA 4WMCA 1MKMA 5DFXA 3BJNA 1F9IA 4X1MA 5L2FA 1MXOA 1BUEA 1ES5A 3SOIA 3KYZA 5HD5A 4S2NA 4PPRA 2K7SA 4UA7A 3HUNA 5AQ7A 3NOUC 1VQQA 2E8IA 4LRZE 3MKFA 2O9AA 4B4XA 2D01A 2Y2HA 1IYSA 3ZDJA 3PAEA 4L9FA 3W4QA 2XRNA 4YOFA 4O01A 3LY3A 4KZAA 4K0WA 4EETB 5CHJA 4KZ6A 3DTMA 1XPBA 3OOVA 2V8CA 2Z6DA 3SS4A 3PBTA 4E04A 2QWSA 4HJ3A 1YKDA 2OLUA 4ZJ2A 2WAFA 2P04A 2EWVA 3CZDA 4KUOA 4KZ9A 2A2LA 4BMWA 2PHYA 2VV8A 5DTKA 4K08A 1K38A 4GS9A 5GLDA 4PKYG 2Y2OA 3G2ZA 1IELA 3V67A 1NJ4A 2XFTA 4Y17A 1SZVA 5J7EA 1SKOA 3A3EA 2W1RA 3HLGA 2QHKA 1ERQA 3N8SA 1TS8A 2EXBA 2WK0A 3A0VA 1K56A 3S7QA 5HW3A 4LV3A 3WRZA 4P6ZS 4E3KA 1J3WA 3IX8A 4YFMA 3UNWA 2D02A 1OTIA 2J7VA 4BD0A 5AQ9A 3BFGA 3F1PA 2J3TD 3LR3A 4EQIA 3BEBA 1ES4A 1JTGA 2OAP1 3W2ZA 5IT5A 3IXDA 4XUXA 4B88A 2XK1A 1VM1A 3BQAA 3LY4A 4JGRA 1IKIA 2H5SA 4FCFA 4QD4A 3V50A 3SH8A 4RVAA 1EW0A 2Y79A 3DTKA 3S7OA 4H6JA 2VGLS 2WKIA 4S2LA 2CMNA 1LSVA 3HLEA 4EUZA 4E3IA 4K0XA 4WZ5A 3V3RA 2PU4A 3L7HA 4EXOA 3BW6A 3IQAA 3UB6A 1PRQA 5A8BA 1IFQA 2BASA 1YT4A 3VP3A 4PMAA 3E2LA 4HNBA 4KG5A 4K91A 4R0QA 3OCLA 2WAEA 4ZJ1A 3W8KA 4QPRA 1RP5A 1FOFA 5KZHA 4JF5A 5GLCA 5FI7A 1ODVA 1TD5A 2E8JA 1DP9A 2JCHA 5EECA 2O9CA 1P97A 1PNEA 4OOLA 4S2PA 3T1SA 4MBFA 5L07A 1YPRA 4WM9A 4GHIA 2W1TB 1N4OA 1P9RA 3OLOA 5DJTA 5DJUA 1SDEA 4OOMA 3JPUA 3DWKA 3UPNA 3V5MA 1JTDA 4KQOA 3MMHA 2R78A 5HWWA 3SS5A 3P7NA 2GDNA 3OC2A 4PKYA 2QMIA 1L0GA 3CI6A 3WS1A 1K54C 3PHYA 4Y2FA 3GVBA 3LCEA 4WMCD 2PR6A 2H0TA 1M40A 4WZ5C 1ERMA 5CTMA 3CHWP 1T1CA 4JKTA 1PWDA 4Y5FA 2XD5A 5DTSA 2WYXA 1S66L 3E98A 4BL3A 3K2NA 4AFIA 3N6IA 2IWCA 4BWIA 5KMWA 3CUEA 2Z2LB 2VEAA 3LUQA 4B4ZA 3HUMA 5EVIA 3T1XA 4DE0A 5CX7A 3S4XA 1PW8A 3IH8A 1CF0A 4R6LA 1U60A 5FEGA 3FPWA 1GCEA 3HLCA 4NXFA 1O07A 3PBOA 1LSWA 3PBQA 3W4PA 3DW0A 3F1NA 3QHYA 3A0RA 3CJMA 1K6RA 3K3DA 4WYYA 4L9GA 1VETB 1YSQA 3MBZA 2VV7A 3PTEA 5F6AA 2DRWA 2ZQDA 4LFUA 3C4PA 3AGFA 4OLGA 2HP9A 1JWPA 2Q9NA 3TE8A 3PR6A 2Y2NA 2EX9A 2HF6A 1W8QA 3NIAA 2XGNA 3HBRA 2J3WA 3OPLA 2XA7M 4NETA 1YSPA 3UB7A 2Y2LA 1K56D 2V1AA 1S67L 2PR5A 3VE4A 2V9AA 5CGXA 3LYXA 1D06A 3U4LP 1BYWA 4C6YA 2L4RA 3IF6B 2ZBBA 3QP8A 4OPQA 4OONA 3DAVA 3C38A 4Y7PA 1BLPA 2OAQ1 5E2HA 3H82A 4GD8A 3ITBA 4JXWA 3LR5A 1P0ZA 4B9OA 3T4OA 3HLWA 4JGPA 4OVDA 1RGZA 3WS4A 3EQVA 1TS7A 5HWVA 3WWXA 4WEJA 5M18A 1VEUB 1L3LA 1LL5A 2QKPA 2YKFA 1S1ZA 3UPOA 2PAVP 1ALQA 2WADA 4DDSA 2KDKA 2Y2JA 5AVFA 3IBRA 2L1MA 4R4RA 4YWZA 2UV0E 2HDRA 1ZHHB 1HTZA 4HH3A 2K31A 4U0TA 1LI0A 1KE0A 4GCZA 4WLAA 1WYBA 4N1XA 2PBDP 2X02A 4S2OA 4X56A 2PT7A 2J80A 2Q9MA 4ZDXA 2V0UA 2KOIA 4WL9A 2XR0A 2O9BA 5CGWA 1WE4A 3C7VA 3HLDA 1GHIA 3DBAA 4QHCA 4O7DA 5HD3A 2EX8A 3T4QA 3VP4A 1IOUA 4OP8A 3MF0A 3D72A 2M7VA 1S4SA 4ZTKA 4HOIA 1PWGA 4BJPA 4OPRA 1NZOA 4EV4A 4EBNA 3GSGA 3M6BA 1CEFA 5HL1A 4LLOB 2X01A 3GTCA 3SH9A 3FKWA 2HDUA 4DMZA 1EI5A 1LLBA 2B18A 1VB6A 2J9PA 1BULA 4O8GA 2P74A 5HWTA 3D4FA 2H10A 4DE1A 1YMXA 1C3BA 1OT6A 1NYYA 5CHMA 5G4YA 1K4EA 1UGUA 4GKUA 2ZM8A 4DE3A 2ZQCA 2ZMAA 1XA7A 2HPBA 1XGJA 5F83A 3RJUA 3ZG8B 1P9WA 2J3TC 2W3HA 4E3MA 2PRFA 3A3DA 4GB7A 3OZHA 4LCLA 2A49A 5EVID 1TS6A 3UDFA 4F3LB 5EVEA 4Y3IA 1WA9A 5L10A 3OPRA 5GLBA 2XFSA 4G3WA 1GHPA 3VFHA 4C75A 4X53A 1XFQA 5J3WA 1ZKJA 5GHZA 3LFVA 4MNRA 4BBVA 3NULA 2G7UA 5AQAA 2WKRA 1NZUA 2VGJA 3M2JA 5HAQA 3E4PA 4HP4A 3G31A 1PWCA 1ZC2A 3T1QB 3T50A 3H9WA 4IBRA 4P6BA 5DKLA 5DF8A 3UE1A 1LL9A 3G30A 1H8MA 2RL3A 4MCWA 3NCKA 1ONGA 4DJ3A 1MKIA 1W79A 2VA0A 1NXYA 4WEKA 4HIAA 4E3JA 1K6SA 1KE4A 2CC1A 3BLSA 1ZTUA 2WGIA 3MXQA 1XX2A 4OQIA 4L9EA 3CG5A 4HJ4A 2WKPA 2HDQA 5FQKA 1MWSA 2EX6A 3EWKA 4E3NA 5A90A 2W0NA 2FFFB 4RA7A 3VV4A 4EESA 5TFQA 3JYIA 2IA2A 2Y2KA 2QZ6A 2W1TA 5F5YA 4YINA 3W4OA 4OH0A 1XJ3A 4NXBA 5CHUA 5FAOA 4OPYA 3NECA 2R9XA 1G6AA 5E2EA 1E25A 2ZC5B 5A93A 5FQ9A 2PYPA 3ZCZA 1CQAA 4Q0HA 4CPKA 1Q2QA 1SKFA 1IEMA 3ZFZA 2BLSA 2Y8HA 3H7WB 1KDWA 4X6TA 4CLCC 3ZNYA 3MZFA 3BFFA 4I5SA 4Y15A 2FZ0A 1KDSA 2Z2MB 2JKTI 1XJ6A 3CMZA 1NYMA 5FQIA 3S7PA 2HGVA 3PAGA
chains in the Genus database with same CATH topology
3NULA 1Z09A 3L9KA 4FTXA 5EV0A 3T1QB 2JKGA 3U4LP 3T12B 2ZL1A 4X25A 2V8CA 3CPTA 3CHWP 3DAVA 1G5UA 2VK3A 2B95A 1VEUA 3L7HA 2V8FA 4D60A 1K0KA 2HZ5A 1F2KA 3UB5P 1PRQA 2ZL1B 2JKFA 3CPTB 3T1XA 1CF0A 5FEGA 3LEQA 1CJFA 1VEUB 2BTFP 1SZVA 4FUWA 3KYEA 3T1RA 1SKOA 2PAVP 3MS6A 1Y4OA 1HLUP 3LGOA 1VETB 3NECA 2E8JA 4ESPA 1VETA 5EM1A 1D1JA 2PRFA 3MSHA 5FEFA 1PFLA 1PNEA 1CQAA 2ACGA 3T1SA 2PBDP 3D9YA 1YPRA 5FDSA 1SKOB 1J3WA 4X1MA 1FILA 1AWIA 5EVEA 4X1LA 5EM0A 1A0KA 4QWOA 1ACFA 1FIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUL A;  1Z09 A;  3L9K A;  4FTX A;  5EV0 A;  3T1Q B;  2JKG A;  3U4L P;  3T12 B;  2ZL1 A;  4X25 A;  2V8C A;  3CPT A;  3CHW P;  3DAV A;  1G5U A;  2VK3 A;  2B95 A;  1VEU A;  3L7H A;  2V8F A;  4D60 A;  1K0K A;  2HZ5 A;  1F2K A;  3UB5 P;  1PRQ A;  2ZL1 B;  2JKF A;  3CPT B;  3T1X A;  1CF0 A;  5FEG A;  3LEQ A;  1CJF A;  1VEU B;  2BTF P;  1SZV A;  4FUW A;  3KYE A;  3T1R A;  1SKO A;  2PAV P;  3MS6 A;  1Y4O A;  1HLU P;  3LGO A;  1VET B;  3NEC A;  2E8J A;  4ESP A;  1VET A;  5EM1 A;  1D1J A;  2PRF A;  3MSH A;  5FEF A;  1PFL A;  1PNE A;  1CQA A;  2ACG A;  3T1S A;  2PBD P;  3D9Y A;  1YPR A;  5FDS A;  1SKO B;  1J3W A;  4X1M A;  1FIL A;  1AWI A;  5EVE A;  4X1L A;  5EM0 A;  1A0K A;  4QWO A;  1ACF A;  1FIK A; 
#chains in the Genus database with same CATH topology
 1YAX A;  4EBL A;  4MMN A;  2VV6 A;  5DTT A;  5FA7 A;  4UQI M;  1JNU A;  2Y55 A;  4PM5 A;  4S2N C;  3KSF A;  3V39 A;  3A3F A;  2H0Y A;  1W7F A;  2MJ6 A;  3MQ0 A;  1TVF A;  2A24 B;  3B47 A;  3G32 A;  4UAA A;  3SH7 A;  1L0F A;  3IX3 A;  1CEG A;  2VGK A;  3P09 A;  3QP1 A;  4YNR A;  3E2K A;  4ETX A;  3O86 A;  4RX2 A;  4WEL A;  5M19 A;  3IXB A;  3O5Y A;  4JF4 A;  4IUH A;  2QJ5 A;  3NDG A;  3N4I A;  4OQ0 A;  4G3V A;  4PAU A;  3TSG A;  1BTL A;  2W3F A;  3V3S A;  1ZG4 A;  2QPN A;  5EPH A;  1N9B A;  5F69 A;  3ZG9 B;  3LGO A;  4NG2 A;  3GV9 A;  3ISG A;  4HJ6 A;  1DP8 A;  4JXS A;  1E4D A;  3BYD A;  3UY6 A;  5TGF A;  3GR2 A;  4GOG A;  4IVI A;  5IU1 A;  4QY5 A;  5J8X A;  1MWU A;  2EX2 A;  1CI9 A;  4HHD A;  5HZH A;  2I9V A;  3HCY A;  4KQR A;  4MDZ A;  5K5B A;  4MBK A;  1DJA A;  5EM0 A;  1KOU A;  2DMW A;  3T4J A;  1MY8 A;  4HES A;  3QNB A;  1ACF A;  4QWO A;  1FIK A;  4KZB A;  4MEZ A;  5F82 A;  3UE6 A;  3IF6 A;  3OBF A;  2DCF A;  3C7U A;  4LCM A;  2XD1 A;  2UWX A;  2Y2Q A;  5JYP A;  4MN6 A;  2H28 A;  4ARZ B;  3L9K A;  1FSW A;  4C3Q A;  4P85 A;  1OJ5 A;  1TDG A;  2JKG A;  3A3I A;  5HL6 A;  2HV1 A;  4M4X A;  3VMA A;  1GSV A;  2O99 A;  5TBM A;  2NUT C;  2V2F F;  3O87 A;  3BEC A;  1QMF A;  2B95 A;  4CLC D;  1VEU A;  3QP2 A;  4KZ3 A;  3CAX A;  4OQH A;  2WKQ A;  3VP1 A;  2PD7 A;  5DKK A;  5HAP A;  4UEY A;  4EU0 A;  4PM8 A;  5EOE A;  2ZL1 B;  2JKF A;  2B5R A;  3LEQ A;  4KZ5 A;  1LT0 A;  2W3D A;  4DRT A;  4CJN A;  1KE3 A;  3KSH A;  4X55 A;  3LR0 A;  3T1R A;  3VSK A;  3IH9 A;  4FD8 A;  2QYB A;  3ZNT A;  3LIA A;  2GX5 A;  4IVK A;  2ZM2 A;  3M2K A;  1MWR A;  2ACG A;  3BFD A;  3HL9 A;  3PBS A;  1I2S A;  4G3K A;  4HBT A;  4WUJ A;  3FWL A;  1G6O A;  3VFF A;  1FCN A;  3NC8 A;  1L0E A;  2ZMF A;  5L09 A;  4GJ4 A;  4DXB A;  3IF6 C;  3DTI A;  4LPZ A;  1GSX A;  1MC0 A;  3Q1F A;  2V1Z A;  4UA6 A;  2PD8 A;  2LB5 A;  4PM9 A;  2YKH A;  3FV7 A;  3NI9 A;  1XA1 A;  2WUQ A;  1OTD A;  3VSL A;  2HJ9 C;  3HVF A;  1JWV A;  2Y59 A;  1G68 A;  5M1A A;  2XQZ A;  1I5Q A;  3ICY A;  1VHM A;  3BQ8 A;  5FDH A;  5FAS A;  1OTB A;  3OPP A;  2W3E A;  3A3J A;  2EFU A;  4GDB A;  3ZG0 A;  1BZA A;  4GN2 A;  1NRJ A;  3UDI A;  1W8Y A;  1K55 A;  5G18 A;  4UHU A;  5FSR A;  1PW1 A;  2ZJ9 A;  3PBR A;  3MR0 A;  4OLD A;  2I72 A;  2VJW A;  5F1F A;  2INW A;  4QB8 A;  5C5K A;  3CUE C;  4F94 A;  1UWP X;  5EVI C;  4PHT A;  4RQ9 A;  5FL3 A;  4F3L A;  1H8Z A;  1T18 A;  3LIF A;  5HX9 A;  4P6Z M;  4GZB A;  1XJ4 A;  3O3V A;  1BLS A;  3BM6 A;  1ONH A;  4HY8 A;  4GHI B;  1J9M A;  4Y0U A;  1NWZ A;  1K57 A;  1W63 M;  2VLG A;  2Y2P A;  4FSF A;  4HH2 A;  4BEN A;  3GQZ A;  3UE3 A;  1OME A;  4JPM A;  4LV2 A;  4R1G A;  3IS2 B;  3VOZ A;  3K3C A;  4DF6 A;  4LRY C;  1STZ A;  3Q81 A;  4CQH A;  3G4P A;  5CEC A;  2GJ3 A;  2HP5 A;  3UB8 A;  4MLL A;  4OQG A;  2EA9 A;  3NY4 A;  3SS3 A;  1PI5 A;  2VGL M;  3DTE A;  4MN7 A;  4HP9 A;  5U47 A;  3HJI A;  3Q7Z A;  5E43 A;  5FQQ A;  2GNX A;  3LI8 A;  2G2U A;  3EEH A;  4ETZ A;  5DF7 A;  3P01 A;  4HBU A;  1L0D A;  3LIE A;  1FCO A;  4EER A;  2PBY A;  4MBH A;  2HZ5 A;  2KLI A;  2M7U A;  3MQQ A;  3T4T A;  1PI4 A;  4IUK A;  2ZQ9 A;  3IT9 A;  4Q8I A;  1NY0 A;  4HQA A;  3C4O A;  3R7W B;  1TEM A;  4GDN A;  2OV5 A;  3A0S A;  5LBR A;  4I39 A;  4D2O A;  3Q7V B;  4I3J A;  3KYE A;  3N8L A;  3BWL A;  1BT5 A;  3H7W A;  3OPH A;  2Y2G A;  4UA9 A;  3LEZ A;  3WRT A;  4BBT A;  5CRF A;  4MN5 A;  1PIO A;  4DJ2 A;  4FOF A;  5EM1 A;  2WGW B;  2J9O A;  3E0Y A;  1H8Y A;  4EUV A;  3D9Y A;  2Y91 A;  5FDS A;  3VP2 A;  3ZGA B;  4EEP A;  3FZC A;  3UDX A;  1MWT A;  1YLZ A;  2JKT M;  3SW1 A;  4GLQ A;  1V9Y A;  4KZ7 A;  1F5M A;  3IXG A;  1S4R A;  3SZT A;  4WN5 A;  4R3A A;  1BLH A;  3QP4 A;  2A24 A;  2RCX A;  3G35 A;  2VX8 A;  5IS1 A;  2B02 A;  2P9V B;  4FTX A;  3BY9 A;  3EEA A;  3BFE A;  3UO9 A;  5J4E A;  5KSC A;  3PXP A;  1KGF A;  1W63 Q;  3KYQ A;  1YLJ A;  5MC7 A;  3MXR A;  1Z6F A;  4FH2 A;  2OSU A;  4X25 A;  1JVJ A;  1IYP A;  3M6H A;  4S2J A;  1ESI A;  2WZX A;  1OTA A;  2X71 A;  2W3G A;  3E4Q A;  3I7J A;  4I3I A;  5G4Z A;  2EFX A;  2KX6 A;  2XLN A;  1XP4 A;  1ESU A;  1YLY A;  4JXV A;  1O7E A;  4JF6 A;  5DVA A;  3MQO A;  2R9W A;  4ZRR A;  4RYE A;  3DWZ A;  2BTF P;  2ZQ7 A;  4O0P A;  3LID A;  3MS6 A;  3B42 A;  3MXS A;  3LI9 A;  4XT2 B;  4S2M A;  1XXM A;  3NOT C;  1IYQ A;  1OJG A;  5HPI A;  3ULF A;  3UPP A;  1N9O A;  5FAQ A;  1PFL A;  3C30 A;  3RFB A;  4DE2 A;  1AWI A;  3KO6 A;  4ARZ A;  5CEB A;  3IBJ A;  3N8R A;  4ZJ3 A;  1KVM A;  3BLM A;  2JKR M;  4N92 A;  3ZQ5 A;  1E3U A;  4R70 A;  3ZVW A;  3B3X A;  2C6W B;  5EUA A;  1SHV A;  3PBN A;  4LRX C;  4EBP A;  1IKG A;  2XA7 S;  4BBU A;  3ITA A;  1PZO A;  1XJ2 A;  4NK3 A;  2A3U A;  2Q0O A;  2ZLY A;  1RGY A;  4KEN B;  4N9K A;  4ME4 A;  3HJK A;  3S1Y A;  4DKI A;  1GHM A;  3T12 B;  4FH4 A;  2ZL1 A;  3UB9 A;  5I94 A;  4PM6 A;  1TF1 A;  1G5U A;  3UE0 A;  1XKZ A;  1W5D A;  5L8M A;  1L2S A;  3S22 A;  3D3O A;  5E2F A;  4GD6 A;  3NDE A;  4LEN A;  5EVL A;  4L0L A;  1SCW A;  4BD1 A;  4OPZ A;  1HD8 A;  5FQJ A;  3CPT B;  3TW8 A;  3CLO A;  5HAR A;  4EWF A;  3E4O A;  3HRE A;  2DNS A;  3QP6 A;  4WZ4 A;  2XDM A;  4Z9Q A;  1ES3 A;  1MBL A;  3AGE A;  5GHY A;  2J8Y A;  3MFX A;  4FUW A;  3LR4 A;  5HAI A;  4LV1 A;  1HVB A;  4NKP A;  3GRJ A;  2G2W A;  5FAP A;  4ID4 A;  2P7J A;  3BFC A;  2C5W B;  1TDL A;  1VET A;  5AJG A;  1H0M A;  5FEF A;  3MKE A;  4IBX A;  3IX4 A;  4ZAM A;  5FAT A;  5HFO A;  3G34 A;  3BRM A;  1WYC A;  3GEC A;  1DRM A;  1Y54 A;  2PYR A;  2HJE A;  1YLP A;  2FH5 A;  2V1B A;  3MZE A;  1GA9 A;  4CLC B;  3NBL A;  3TOI A;  1K54 A;  5HDS A;  3MJQ A;  1A0K A;  5HDC A;  1CK3 A;  1G28 A;  3UMD A;  3F1O B;  5A91 A;  4GW9 A;  4LGW A;  1RCJ A;  3GDI A;  2VZW A;  1YQS A;  2XSS A;  1Z09 A;  1K4F A;  1T1A A;  3B33 A;  4BQM A;  1ZG6 A;  3ZYT A;  5FQM A;  3IXH A;  2JN7 A;  4EEU A;  3T4K A;  1Q2P A;  1DJB A;  4QJG A;  4R4S A;  2JKR I;  1PZP A;  2OLV A;  3JVV A;  5GL9 A;  1BSG A;  2V8F A;  5TR7 A;  3UB5 P;  2LB9 A;  3LO7 A;  1SDN A;  2IWD A;  1N9N A;  4R38 A;  5AVE A;  3RH8 B;  3IF5 A;  5CXW A;  4JGO A;  2VKS A;  5FI6 A;  4S2I A;  4X68 A;  2ZD8 A;  1ERO A;  1TS0 A;  4I3A A;  4QY6 A;  4B93 A;  3IWO A;  1PYY A;  3UN7 A;  5GLA A;  2OWJ A;  5KSH A;  2ZC7 A;  3IS2 A;  1NLZ A;  4X69 A;  4GS9 B;  4H8R A;  4ESP A;  1FQG A;  4Y0O A;  1OT9 A;  5EOO A;  3WS5 A;  1FR1 A;  3T4L A;  3U2A A;  5FI2 A;  1SKO B;  2JHE A;  1FIL A;  4KZ8 A;  4DXC A;  1FR6 A;  5HDD A;  3TRC A;  3FYZ A;  1D7E A;  1FCM A;  4XUZ A;  3QNC A;  4A5R A;  3Q07 A;  3RXX A;  2M1C A;  2Y4A A;  4GNU A;  1H5X A;  5JYO A;  5HPF A;  4OOY A;  2AVX A;  4RX3 A;  2ZOI A;  1K25 A;  2XEP A;  3EGX C;  4JLF A;  3ZVT A;  2P08 A;  1KGE A;  4WBG A;  4Q0J A;  3F1P B;  3ZG5 A;  4DDY A;  4EQ1 A;  3R4K A;  5CTN A;  3TJZ C;  1YLW A;  4Y0T A;  3JVU A;  3R7W A;  4Y13 A;  1E3U D;  1M6K A;  3GMW A;  4Q0I A;  1NLY A;  3Q7V A;  1F98 A;  5CED A;  3VOL A;  4H6J B;  1S6R A;  4IHQ A;  1CI8 A;  2ZC3 B;  4BLM A;  1FSY A;  2EXA A;  1AXB A;  2XRO A;  4U0X A;  2WGW A;  4JGQ A;  3G6O A;  3TG9 A;  3HLB A;  3NJA A;  4BL2 A;  2JBF A;  3AGD A;  3UME A;  3IWQ A;  2OWH A;  4E3L A;  3QP5 A;  2L0W A;  4N9L A;  4NXG A;  4ZBE A;  2ZC6 B;  2HDS A;  5AQB A;  1XFN A;  4S2K A;  3CWF A;  2P9V A;  4OKP A;  1BLC A;  1XGI A;  2WZZ A;  1IYO A;  4KZ4 A;  2FFY A;  2ZQ8 A;  5CER A;  3LIB A;  5DFY A;  1LSX A;  3IHB A;  3O88 A;  1NRF A;  3NOP C;  4E6X A;  4PM7 A;  4Z1W A;  1LHY A;  3RTY A;  1OPX A;  4EW7 A;  3ZHH A;  1S0W A;  1KVL A;  2IWB A;  4KQQ A;  2K2N A;  4R3B A;  3NHQ A;  5EV0 A;  1S1Y A;  3MZD A;  3HLF A;  4NXE A;  2JE5 A;  3KSG A;  2NUP C;  1ES2 A;  4UQI S;  5TBM B;  4IJG A;  3C8C A;  3PYP A;  1MZU A;  1GSW A;  3IWI A;  3N7W A;  2Y2I A;  1K0K A;  2PU2 A;  3VOY A;  3ZG7 B;  4R3J A;  4XT2 A;  5GHX A;  1EWZ A;  1Y28 A;  4LV0 A;  3T4S A;  4KG6 A;  5F1G A;  5IHV A;  1KGG A;  1YMS A;  5BOH A;  2Y2M A;  1CJF A;  1YLT A;  2GZA A;  3EGD C;  4M3K A;  5DF9 A;  1K55 C;  4IED A;  4KG2 A;  2W27 A;  3RXW A;  2BG1 A;  3MFD A;  3VP0 A;  4HI4 A;  5EVI B;  2ZM0 A;  5E2G A;  4CLC E;  5A92 A;  1MPL A;  1UWN X;  2WKH A;  3MSH A;  4JBF A;  1T19 A;  2V20 A;  3G2Y A;  3KSI A;  3F1N B;  3IHA A;  5D3O A;  3HUO A;  3KX0 X;  4X1L A;  1QME A;  1JWZ A;  2OOL A;  2PDR A;  1I2W A;  3EQU A;  4JXG A;  3C2W A;  1DY6 A;  3VE3 A;  2HP6 A;  1K57 C;  4DN0 A;  1V9Z A;  1HZO A;  4KQD A;  4NEE D;  4QU3 A;  4E3O A;  4OP5 A;  1X0O A;  2JC7 A;  1OTE A;  3C5A A;  1DP6 A;  4N1H A;  3FKV A;  2V0W A;  3CPT A;  2EWW A;  2ZQA A;  4I38 A;  4U3T A;  2VK3 A;  4P87 A;  5HSQ A;  3EOI A;  4HEF A;  5CGS A;  3WS2 A;  4D60 A;  4E6W A;  1F2K A;  3S7N A;  3FG8 A;  2ZOH A;  2Z6C A;  3FC7 A;  2XF3 A;  3BY8 A;  2QJ7 A;  5I5L A;  2WKE A;  3FPV A;  2O0Y A;  5KIZ A;  1GA0 A;  4WF0 A;  5TJJ A;  2ZMV A;  1LI9 A;  3H82 B;  2WGV A;  1LL8 A;  3Q82 A;  4XXR A;  1H3Q A;  5F68 A;  3LIC A;  1DJC A;  3WS0 A;  1Y4O A;  1HLU P;  4R23 A;  5EFW A;  4CLC A;  1T1B A;  2XH9 A;  2ZC4 B;  5EE8 A;  3P98 A;  3OCN A;  3CIT A;  1D1J A;  4KUK A;  4P0M A;  1N9L A;  4II7 A;  1YM1 A;  3F1O A;  4WMC A;  1MKM A;  5DFX A;  3BJN A;  1F9I A;  4X1M A;  5L2F A;  1MXO A;  1BUE A;  1ES5 A;  3SOI A;  3KYZ A;  5HD5 A;  4S2N A;  4PPR A;  2K7S A;  4UA7 A;  3HUN A;  5AQ7 A;  3NOU C;  1VQQ A;  2E8I A;  4LRZ E;  3MKF A;  2O9A A;  4B4X A;  2D01 A;  2Y2H A;  1IYS A;  3ZDJ A;  3PAE A;  4L9F A;  3W4Q A;  2XRN A;  4YOF A;  4O01 A;  3LY3 A;  4KZA A;  4K0W A;  4EET B;  5CHJ A;  4KZ6 A;  3DTM A;  1XPB A;  3OOV A;  2V8C A;  2Z6D A;  3SS4 A;  3PBT A;  4E04 A;  2QWS A;  4HJ3 A;  1YKD A;  2OLU A;  4ZJ2 A;  2WAF A;  2P04 A;  2EWV A;  3CZD A;  4KUO A;  4KZ9 A;  2A2L A;  4BMW A;  2PHY A;  2VV8 A;  5DTK A;  4K08 A;  1K38 A;  4GS9 A;  5GLD A;  4PKY G;  2Y2O A;  3G2Z A;  1IEL A;  3V67 A;  1NJ4 A;  2XFT A;  4Y17 A;  1SZV A;  5J7E A;  1SKO A;  3A3E A;  2W1R A;  3HLG A;  2QHK A;  1ERQ A;  3N8S A;  1TS8 A;  2EXB A;  2WK0 A;  3A0V A;  1K56 A;  3S7Q A;  5HW3 A;  4LV3 A;  3WRZ A;  4P6Z S;  4E3K A;  1J3W A;  3IX8 A;  4YFM A;  3UNW A;  2D02 A;  1OTI A;  2J7V A;  4BD0 A;  5AQ9 A;  3BFG A;  3F1P A;  2J3T D;  3LR3 A;  4EQI A;  3BEB A;  1ES4 A;  1JTG A;  2OAP 1;  3W2Z A;  5IT5 A;  3IXD A;  4XUX A;  4B88 A;  2XK1 A;  1VM1 A;  3BQA A;  3LY4 A;  4JGR A;  1IKI A;  2H5S A;  4FCF A;  4QD4 A;  3V50 A;  3SH8 A;  4RVA A;  1EW0 A;  2Y79 A;  3DTK A;  3S7O A;  4H6J A;  2VGL S;  2WKI A;  4S2L A;  2CMN A;  1LSV A;  3HLE A;  4EUZ A;  4E3I A;  4K0X A;  4WZ5 A;  3V3R A;  2PU4 A;  3L7H A;  4EXO A;  3BW6 A;  3IQA A;  3UB6 A;  1PRQ A;  5A8B A;  1IFQ A;  2BAS A;  1YT4 A;  3VP3 A;  4PMA A;  3E2L A;  4HNB A;  4KG5 A;  4K91 A;  4R0Q A;  3OCL A;  2WAE A;  4ZJ1 A;  3W8K A;  4QPR A;  1RP5 A;  1FOF A;  5KZH A;  4JF5 A;  5GLC A;  5FI7 A;  1ODV A;  1TD5 A;  2E8J A;  1DP9 A;  2JCH A;  5EEC A;  2O9C A;  1P97 A;  1PNE A;  4OOL A;  4S2P A;  3T1S A;  4MBF A;  5L07 A;  1YPR A;  4WM9 A;  4GHI A;  2W1T B;  1N4O A;  1P9R A;  3OLO A;  5DJT A;  5DJU A;  1SDE A;  4OOM A;  3JPU A;  3DWK A;  3UPN A;  3V5M A;  1JTD A;  4KQO A;  3MMH A;  2R78 A;  5HWW A;  3SS5 A;  3P7N A;  2GDN A;  3OC2 A;  4PKY A;  2QMI A;  1L0G A;  3CI6 A;  3WS1 A;  1K54 C;  3PHY A;  4Y2F A;  3GVB A;  3LCE A;  4WMC D;  2PR6 A;  2H0T A;  1M40 A;  4WZ5 C;  1ERM A;  5CTM A;  3CHW P;  1T1C A;  4JKT A;  1PWD A;  4Y5F A;  2XD5 A;  5DTS A;  2WYX A;  1S66 L;  3E98 A;  4BL3 A;  3K2N A;  4AFI A;  3N6I A;  2IWC A;  4BWI A;  5KMW A;  3CUE A;  2Z2L B;  2VEA A;  3LUQ A;  4B4Z A;  3HUM A;  5EVI A;  3T1X A;  4DE0 A;  5CX7 A;  3S4X A;  1PW8 A;  3IH8 A;  1CF0 A;  4R6L A;  1U60 A;  5FEG A;  3FPW A;  1GCE A;  3HLC A;  4NXF A;  1O07 A;  3PBO A;  1LSW A;  3PBQ A;  3W4P A;  3DW0 A;  3F1N A;  3QHY A;  3A0R A;  3CJM A;  1K6R A;  3K3D A;  4WYY A;  4L9G A;  1VET B;  1YSQ A;  3MBZ A;  2VV7 A;  3PTE A;  5F6A A;  2DRW A;  2ZQD A;  4LFU A;  3C4P A;  3AGF A;  4OLG A;  2HP9 A;  1JWP A;  2Q9N A;  3TE8 A;  3PR6 A;  2Y2N A;  2EX9 A;  2HF6 A;  1W8Q A;  3NIA A;  2XGN A;  3HBR A;  2J3W A;  3OPL A;  2XA7 M;  4NET A;  1YSP A;  3UB7 A;  2Y2L A;  1K56 D;  2V1A A;  1S67 L;  2PR5 A;  3VE4 A;  2V9A A;  5CGX A;  3LYX A;  1D06 A;  3U4L P;  1BYW A;  4C6Y A;  2L4R A;  3IF6 B;  2ZBB A;  3QP8 A;  4OPQ A;  4OON A;  3DAV A;  3C38 A;  4Y7P A;  1BLP A;  2OAQ 1;  5E2H A;  3H82 A;  4GD8 A;  3ITB A;  4JXW A;  3LR5 A;  1P0Z A;  4B9O A;  3T4O A;  3HLW A;  4JGP A;  4OVD A;  1RGZ A;  3WS4 A;  3EQV A;  1TS7 A;  5HWV A;  3WWX A;  4WEJ A;  5M18 A;  1VEU B;  1L3L A;  1LL5 A;  2QKP A;  2YKF A;  1S1Z A;  3UPO A;  2PAV P;  1ALQ A;  2WAD A;  4DDS A;  2KDK A;  2Y2J A;  5AVF A;  3IBR A;  2L1M A;  4R4R A;  4YWZ A;  2UV0 E;  2HDR A;  1ZHH B;  1HTZ A;  4HH3 A;  2K31 A;  4U0T A;  1LI0 A;  1KE0 A;  4GCZ A;  4WLA A;  1WYB A;  4N1X A;  2PBD P;  2X02 A;  4S2O A;  4X56 A;  2PT7 A;  2J80 A;  2Q9M A;  4ZDX A;  2V0U A;  2KOI A;  4WL9 A;  2XR0 A;  2O9B A;  5CGW A;  1WE4 A;  3C7V A;  3HLD A;  1GHI A;  3DBA A;  4QHC A;  4O7D A;  5HD3 A;  2EX8 A;  3T4Q A;  3VP4 A;  1IOU A;  4OP8 A;  3MF0 A;  3D72 A;  2M7V A;  1S4S A;  4ZTK A;  4HOI A;  1PWG A;  4BJP A;  4OPR A;  1NZO A;  4EV4 A;  4EBN A;  3GSG A;  3M6B A;  1CEF A;  5HL1 A;  4LLO B;  2X01 A;  3GTC A;  3SH9 A;  3FKW A;  2HDU A;  4DMZ A;  1EI5 A;  1LLB A;  2B18 A;  1VB6 A;  2J9P A;  1BUL A;  4O8G A;  2P74 A;  5HWT A;  3D4F A;  2H10 A;  4DE1 A;  1YMX A;  1C3B A;  1OT6 A;  1NYY A;  5CHM A;  5G4Y A;  1K4E A;  1UGU A;  4GKU A;  2ZM8 A;  4DE3 A;  2ZQC A;  2ZMA A;  1XA7 A;  2HPB A;  1XGJ A;  5F83 A;  3RJU A;  3ZG8 B;  1P9W A;  2J3T C;  2W3H A;  4E3M A;  2PRF A;  3A3D A;  4GB7 A;  3OZH A;  4LCL A;  2A49 A;  5EVI D;  1TS6 A;  3UDF A;  4F3L B;  5EVE A;  4Y3I A;  1WA9 A;  5L10 A;  3OPR A;  5GLB A;  2XFS A;  4G3W A;  1GHP A;  3VFH A;  4C75 A;  4X53 A;  1XFQ A;  5J3W A;  1ZKJ A;  5GHZ A;  3LFV A;  4MNR A;  4BBV A;  3NUL A;  2G7U A;  5AQA A;  2WKR A;  1NZU A;  2VGJ A;  3M2J A;  5HAQ A;  3E4P A;  4HP4 A;  3G31 A;  1PWC A;  1ZC2 A;  3T1Q B;  3T50 A;  3H9W A;  4IBR A;  4P6B A;  5DKL A;  5DF8 A;  3UE1 A;  1LL9 A;  3G30 A;  1H8M A;  2RL3 A;  4MCW A;  3NCK A;  1ONG A;  4DJ3 A;  1MKI A;  1W79 A;  2VA0 A;  1NXY A;  4WEK A;  4HIA A;  4E3J A;  1K6S A;  1KE4 A;  2CC1 A;  3BLS A;  1ZTU A;  2WGI A;  3MXQ A;  1XX2 A;  4OQI A;  4L9E A;  3CG5 A;  4HJ4 A;  2WKP A;  2HDQ A;  5FQK A;  1MWS A;  2EX6 A;  3EWK A;  4E3N A;  5A90 A;  2W0N A;  2FFF B;  4RA7 A;  3VV4 A;  4EES A;  5TFQ A;  3JYI A;  2IA2 A;  2Y2K A;  2QZ6 A;  2W1T A;  5F5Y A;  4YIN A;  3W4O A;  4OH0 A;  1XJ3 A;  4NXB A;  5CHU A;  5FAO A;  4OPY A;  3NEC A;  2R9X A;  1G6A A;  5E2E A;  1E25 A;  2ZC5 B;  5A93 A;  5FQ9 A;  2PYP A;  3ZCZ A;  1CQA A;  4Q0H A;  4CPK A;  1Q2Q A;  1SKF A;  1IEM A;  3ZFZ A;  2BLS A;  2Y8H A;  3H7W B;  1KDW A;  4X6T A;  4CLC C;  3ZNY A;  3MZF A;  3BFF A;  4I5S A;  4Y15 A;  2FZ0 A;  1KDS A;  2Z2M B;  2JKT I;  1XJ6 A;  3CMZ A;  1NYM A;  5FQI A;  3S7P A;  2HGV A;  3PAG A; 
#chains in the Genus database with same CATH homology
 3NUL A;  1Z09 A;  3L9K A;  4FTX A;  5EV0 A;  3T1Q B;  2JKG A;  3U4L P;  3T12 B;  2ZL1 A;  4X25 A;  2V8C A;  3CPT A;  3CHW P;  3DAV A;  1G5U A;  2VK3 A;  2B95 A;  1VEU A;  3L7H A;  2V8F A;  4D60 A;  1K0K A;  2HZ5 A;  1F2K A;  3UB5 P;  1PRQ A;  2ZL1 B;  2JKF A;  3CPT B;  3T1X A;  1CF0 A;  5FEG A;  3LEQ A;  1CJF A;  1VEU B;  2BTF P;  1SZV A;  4FUW A;  3KYE A;  3T1R A;  1SKO A;  2PAV P;  3MS6 A;  1Y4O A;  1HLU P;  3LGO A;  1VET B;  3NEC A;  2E8J A;  4ESP A;  1VET A;  5EM1 A;  1D1J A;  2PRF A;  3MSH A;  5FEF A;  1PFL A;  1PNE A;  1CQA A;  2ACG A;  3T1S A;  2PBD P;  3D9Y A;  1YPR A;  5FDS A;  1SKO B;  1J3W A;  4X1M A;  1FIL A;  1AWI A;  5EVE A;  4X1L A;  5EM0 A;  1A0K A;  4QWO A;  1ACF A;  1FIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...